Chem 453 Quiz 1 !!! Do in Pairs! NAMES . Attach requested data to this sheet. 1) We will soon be purifying and analyzing a protein called Alkaline Phosphatase (AP) from E. coli. Go to http://ca.expasy.org/ and find and copy the amino acid sequence of the HUMAN PLACENTAL version of this protein (or its precursor with signal). >sp|P05187|PPB1_HUMAN Alkaline phosphatase, placental type precursor (EC 3.1.3.1) (PLAP-1) (Regan isozyme) - Homo sapiens (Human). MLGPCMLLLLLLLGLRLQLSLGIIPVEEENPDFWNREAAEALGAAKKLQPAQTAAKNLII FLGDGMGVSTVTAARILKGQKKDKLGPEIPLAMDRFPYVALSKTYNVDKHVPDSGATATA YLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAG TYAHTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFRMGTPDPEYP DDYSQGGTRLDGKNLVQEWLAKRQGARYVWNRTELMQASLDPSVTHLMGLFEPGDMKYEI HRDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAI ERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPG YVLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVAVFARGPQAHLVHGVQEQTFI AHVMAFAACLEPYTACDLAPPAGTTDAAHPGRSVVPALLPLLAGTLLLLETATAP 2) Go to Prot-Param database (http://ca.expasy.org/tools/protparam.html) and find the pI (isoelectric point) of AP (without precursor signal sequence). What charge would this protein have at pH 7.0? Theoretical pI: 5.74 Negative 3) What is the extinction coefficient estimate of AP at 280 nm and calculate the following. Assume no half-cysteines: =47330 You have purified AP and have 76.0 mL of a solution giving an absorbance of 0.87 at 280 nm in a 1 cm cuvette. How many MOLES of AP do you have? How many GRAMS of AP do you have? 0.87=47330*1*c c= 1.8 X 10-5 mol/L 1.8 X 10-5 mol/L* .076 L= 1.4 X 10-6 moles 1.4 X 10-6 moles X 52745.3 g/mol = 0.074 g or 74 mg