MMP-2 protects the LDLR Corresponding author: Carlos Fernandez-Patron MMP-2 inhibits PCSK9-induced degradation of the LDLR in Hepa1-c1c7 cells Xiang Wang(1,6), Evan Berry(1,6), Samuel Hernandez-Anzaldo(1,6), Difei Sun(2,7), Ayinuer Adijiang(3,6), Liang Li(2,7), Dawei Zhang(1,3,6), and Carlos Fernandez-Patron(1,4,5,6) Departments of Biochemistry (1), Chemistry (2), Group on Molecular and Cell Biology of Lipids (3) Mazankowski Alberta Heart Institute (4) Cardiovascular Research Group (5) Faculty of Medicine and Dentistry (6) Faculty of Science (7) University of Alberta Edmonton, Alberta, Canada Correspondence: Carlos Fernandez-Patron (cf2@ualberta.ca) Associate Professor 3-19 Medical Sciences Building Department of Biochemistry Mazankowski Alberta Heart Institute Cardiovascular Research Group Faculty of Medicine and Dentistry University of Alberta Edmonton, AB T6G 2H7 CANADA Tel: 780-492-9540 (office) Tel: 780-492-7618 (lab) 1 MMP-2 protects the LDLR Corresponding author: Carlos Fernandez-Patron * mRNA expression (% of AdGFP) 250 200 150 100 50 0 Sr * * * * r f2 gc eb Hm * lr 1 2 3 2 Ld nsig nsig 1h 1h I I Nr Nr AdGFP AdMMP2 Supplementary Figure 1: Effect of MMP-2 overexpression on mRNA levels of lipid metabolic genes as determined by qRT-PCR analysis. The figure shows that MMP-2 overexpression causes a downregulation of SREBP-2 and target genes. Other transcription factors such as Nr1h2 and Nr1h3 (which encode LXR-β and LXR-α, respectively) are inversely regulated. Results are mean±sem. n = 4. *: p<0.05 vs. AdGFP (vehicle). 2 MMP-2 protects the LDLR Corresponding author: Carlos Fernandez-Patron sp|Q80W65|PCSK9_MOUSE Proprotein convertase subtilisin/kexin type 9 OS=Mus musculus GN=Pcsk9 PE=1 SV=2 MGTHCSAWLRWPLLPLLPPLLLLLLLLCPTGAGAQDEDGDYEELMLALPSQEDGLADEAA HVATATFRRCSKEAWRLPGTYIVVLMEETQRLQIEQTAHRLQTRAARRGYVIKVLHIFYD LFPGFLVKMSSDLLGLALKLPHVEYIEEDSFVFAQSIPWNLERIIPAWHQTEEDRSPDGS SQVEVYLLDTSIQGAHREIEGRVTITDFNSVPEEDGTRFHRQASKCDSHGTHLAGVVSGR DAGVAKGTSLHSLRVLNCQGKGTVSGTLIGLEFIRKSQLIQPSGPLVVLLPLAGGYSRIL NAACRHLARTGVVLVAAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGR CVDLFAPGKDIIGASSDCSTCFMSQSGTSQAAAHVAGIVARMLSREPTLTLAELRQRLIH FSTKDVINMAWFPEDQQVLTPNLVATLPPSTHETGGQLLCRTVWSAHSGPTRTATATARC APEEELLSCSSFSRSGRRRGDWIEAIGGQQVCKALNAFGGEGVYAVARCCLVPRANCSIH NTPAARAGLETHVHCHQKDHVLTGCSFHWEVEDLSVRRQPALRSRRQPGQCVGHQAASVY ASCCHAPGLECKIKEHGISGPSEQVTVACEAGWTLTGCNVLPGASLTLGAYSVDNLCVAR VHDTARADRTSGEATVAAAICCRSRPSAKASWVQ Supplementary Figure 2: Matrix assisted laser desorption ionization-time of flight (MALDITOF) mass spectroscopy of recombinant mouse (rm) PCSK9 after digestion for 16 hrs at 37C with APMA-activated recombinant human (rh) pro-MMP-2. The analysis suggested two putative cleavage sites both occurring at GlyIle bonds that would yield peptides with the experimentally observed masses values of 33174.81 Da (red + green) and 22757.56 Da (red). A peptide with mass of 8620.60 Da (green) was observed as well. The experiment was performed using mouse PCSK9 and recombinant human MMP-2. The prodomain sequence is underlined. The AlaIle cleavage site is predicted from the analysis of human PCSK9 (Supplementary Table 1). Detailed MALDI-TOF data is found in Supplementary Table 2. 3 MMP-2 protects the LDLR Corresponding author: Carlos Fernandez-Patron Supplementary Figure 3: LDLR positive cells were transduced with either AdGFP or AdMMP2 to overexpress MMP-2. 24 hours later, the medium was replaced by media without serum. 16 hours later, the pharmacological MMP-2 inhibitor III (40 μmol/L) or vehicle was added to the cells. 1 hour later, rhPCSK9 was added to the cells. 4 hours later, the cells were collected and lysed, The lysates were subjected to western blot with LDLR antibodies. Partial LDLR protection by MMP-2 was observed even in the presence of MMP-2 inhibitor III. *: p <0.05 vs. AdGFP (vehicle). n=3-4 / group. 4 MMP-2 protects the LDLR Corresponding author: Carlos Fernandez-Patron Supplementary Table 1 List of peptides identified by LC-MS/MS analysis of in-gel microwaveassisted acid hydrolysis products of PCSK9 prodomain cleavage fragment. Matched peptides shown in Bold Red QEDEDGDYEE LVLALRSEEDGLAEAPEHGTTATFHRCAKDPWRLPGTYVV VLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDL LELALKLPHVDYIEEDSSVFAQ Start - End 15 - 27 15 - 28 15 - 29 15 - 29 15 - 32 15 - 38 score 15) 15 - 39 score 36) 15 - 40 score 31) 15 - 40 score 25) 19 - 29 20 - 29 21 - 35 21 - 39 21 - 40 41 - 45 41 - 46 41 - 46 41 - 47 41 - 48 41 - 53 43 - 53 43 - 55 44 - 55 45 - 52 45 - 55 45 - 55 46 - 55 47 - 54 47 - 55 47 - 55 47 - 55 47 - 55 47 - 56 47 - 57 47 - 57 47 - 58 47 - 58 47 - 58 47 - 58 47 - 59 Observed Mr(expt) Mr(calc) 708.3392 1414.6638 1414.6576 518.2374 1551.6904 1551.7165 805.3794 1608.7442 1608.7379 537.2596 1608.7570 1608.7379 628.3018 1881.8836 1881.8704 664.5649 2654.2305 2654.2143 ppm 4 -17 4 12 7 Miss Sequence 0 A.LRSEEDGLAEAPE.H (Ions score 46) 0 A.LRSEEDGLAEAPEH.G (Ions score 30) 0 A.LRSEEDGLAEAPEHG.T (Ions score 34) 0 A.LRSEEDGLAEAPEHG.T (Ions score 23) 0 A.LRSEEDGLAEAPEHGTTA.T (Ions score 30) 6 0 A.LRSEEDGLAEAPEHGTTATFHRCA.K (Ions 696.5886 2782.3253 2782.3093 6 0 A.LRSEEDGLAEAPEHGTTATFHRCAK.D (Ions 725.3466 2897.3573 2897.3362 7 0 A.LRSEEDGLAEAPEHGTTATFHRCAKD.P (Ions 725.3492 2897.3677 2897.3362 11 0 A.LRSEEDGLAEAPEHGTTATFHRCAKD.P (Ions 562.7459 1123.4772 1123.4782 498.2356 994.4566 994.4356 513.5804 1537.7194 1537.7161 514.2590 2053.0069 2052.9799 723.6776 2168.0110 2168.0069 334.6987 667.3828 667.3806 725.4178 724.4105 724.4020 363.2128 724.4110 724.4020 413.7353 825.4560 825.4497 495.2643 988.5140 988.5130 509.9779 1526.9119 1526.8973 622.8951 1243.7756 1243.7652 751.9345 1501.8544 1501.8504 673.8861 1345.7576 1345.7493 847.4999 846.4926 846.4851 617.3485 1232.6824 1232.6653 1233.7047 1232.6974 1232.6653 568.8229 1135.6312 1135.6125 950.5647 949.5574 949.5484 1079.5810 1078.5737 1078.5910 540.3074 1078.6002 1078.5910 1079.6105 1078.6032 1078.5910 540.3099 1078.6052 1078.5910 1180.6616 1179.6543 1179.6387 659.3600 1316.7054 1316.6976 439.9098 1316.7076 1316.6976 715.9019 1429.7892 1429.7817 715.9032 1429.7918 1429.7817 477.6062 1429.7968 1429.7817 477.6089 1429.8049 1429.7817 759.4209 1516.8272 1516.8137 -1 0 E.EDGLAEAPEHG.T (Ions score 15) 21 0 E.DGLAEAPEHG.T (Ions score 20) 2 0 D.GLAEAPEHGTTATFH.R (Ions score 13) 13 0 D.GLAEAPEHGTTATFHRCAK.D (Ions score 19) 2 0 D.GLAEAPEHGTTATFHRCAKD.P (Ions score 25) 3 0 D.PWRLP.G (Ions score 18) 12 0 D.PWRLPG.T (Ions score 14) 12 0 D.PWRLPG.T (Ions score 21) 8 0 D.PWRLPGT.Y (Ions score 15) 1 0 D.PWRLPGTY.V (Ions score 18) 10 0 D.PWRLPGTYVVVLK.E (Ions score 25) 8 0 W.RLPGTYVVVLK.E (Ions score 24) 3 0 W.RLPGTYVVVLKEE.T (Ions score 31) 6 0 R.LPGTYVVVLKEE.T (Ions score 58) 9 0 L.PGTYVVVL.K (Ions score 17) 14 0 L.PGTYVVVLKEE.T (Ions score 39) 26 0 L.PGTYVVVLKEE.T (Ions score 24) 17 0 P.GTYVVVLKEE.T (Ions score 36) 9 0 G.TYVVVLKE.E (Ions score 24) -16 0 G.TYVVVLKEE.T (Ions score 39) 9 0 G.TYVVVLKEE.T (Ions score 14) 11 0 G.TYVVVLKEE.T (Ions score 18) 13 0 G.TYVVVLKEE.T (Ions score 53) 13 0 G.TYVVVLKEET.H (Ions score 28) 6 0 G.TYVVVLKEETH.L (Ions score 33) 8 0 G.TYVVVLKEETH.L (Ions score 43) 5 0 G.TYVVVLKEETHL.S (Ions score 56) 7 0 G.TYVVVLKEETHL.S (Ions score 33) 11 0 G.TYVVVLKEETHL.S (Ions score 38) 16 0 G.TYVVVLKEETHL.S (Ions score 14) 9 0 G.TYVVVLKEETHLS.Q (Ions score 28) 5 MMP-2 protects the LDLR Corresponding author: Carlos Fernandez-Patron 47 - 60 823.9393 1645.8640 1645.8563 score 34) 47 - 60 823.9457 1645.8768 1645.8563 score 36) 47 - 63 673.6873 2018.0401 2018.0320 (Ions score 58) 59 - 76 512.0271 2044.0793 2044.0521 (NQ) (Ions score 21) 77 - 85 567.3436 1132.6726 1132.6645 77 - 85 378.5659 1132.6759 1132.6645 77 - 86 635.8766 1269.7386 1269.7234 77 - 86 635.8767 1269.7388 1269.7234 77 - 87 664.3871 1326.7596 1326.7448 77 - 87 664.3874 1326.7602 1326.7448 77 - 87 664.3877 1326.7608 1326.7448 79 - 86 332.1994 993.5764 993.5760 79 - 91 716.4277 1430.8408 1430.8398 79 - 91 716.4278 1430.8410 1430.8398 81 - 91 601.8560 1201.6974 1201.6972 86 - 95 540.8341 1079.6536 1079.6492 86 - 96 606.3616 1210.7086 1210.6896 86 - 96 614.3541 1226.6936 1226.6846 86 - 97 657.8685 1313.7224 1313.7166 17) 86 - 98 686.3815 1370.7484 1370.7381 28) 87 - 96 545.8290 1089.6434 1089.6256 87 - 98 617.8545 1233.6944 1233.6791 49) 87 - 98 617.8551 1233.6956 1233.6791 48) 88 - 97 552.8310 1103.6474 1103.6413 88 - 98 589.3408 1176.6670 1176.6577 89 - 95 773.5010 772.4937 772.4847 89 - 96 452.7703 903.5260 903.5252 89 - 96 460.7707 919.5268 919.5201 89 - 97 496.2884 990.5622 990.5572 89 - 98 1048.5946 1047.5873 1047.5787 89 - 98 524.8014 1047.5882 1047.5787 89 - 98 532.8002 1063.5858 1063.5736 90 - 95 660.4127 659.4054 659.4007 90 - 95 330.7106 659.4066 659.4007 90 - 95 660.4166 659.4093 659.4007 90 - 96 791.4514 790.4441 790.4411 90 - 96 791.4560 790.4487 790.4411 90 - 96 404.2278 806.4410 806.4361 90 - 96 807.4555 806.4482 806.4361 90 - 98 468.2598 934.5050 934.4946 97 - 106 1058.6117 1057.6044 1057.6019 97 - 106 529.8137 1057.6128 1057.6019 98 - 106 486.2919 970.5692 970.5699 99 - 105 786.4677 785.4604 785.4534 99 - 106 457.7831 913.5516 913.5484 99 - 106 914.5659 913.5586 913.5484 100 - 106 400.2675 798.5204 798.5215 100 - 106 799.5364 798.5291 798.5215 5 0 G.TYVVVLKEETHLSQ.S Deamidated (NQ) (Ions 12 0 G.TYVVVLKEETHLSQ.S Deamidated (NQ) (Ions 4 0 G.TYVVVLKEETHLSQSER.T Deamidated (NQ) 13 7 10 12 12 11 12 12 0 1 1 0 4 16 7 0 L.SQSERTARRLQAQAARRG.Y 3 Deamidated 0 G.YLTKILHVF.H (Ions score 40) 0 G.YLTKILHVF.H (Ions score 15) 0 G.YLTKILHVFH.G (Ions score 68) 0 G.YLTKILHVFH.G (Ions score 75) 0 G.YLTKILHVFHG.L (Ions score 78) 0 G.YLTKILHVFHG.L (Ions score 73) 0 G.YLTKILHVFHG.L (Ions score 64) 0 L.TKILHVFH.G (Ions score 17) 0 L.TKILHVFHGLLPG.F (Ions score 22) 0 L.TKILHVFHGLLPG.F (Ions score 29) 0 K.ILHVFHGLLPG.F (Ions score 39) 0 F.HGLLPGFLVK.M (Ions score 43) 0 F.HGLLPGFLVKM.S (Ions score 27) 0 F.HGLLPGFLVKM.S Oxidation (M) (Ions score 50) 4 0 F.HGLLPGFLVKMS.G Oxidation (M) (Ions score 8 0 F.HGLLPGFLVKMSG.D Oxidation (M) (Ions score 16 0 H.GLLPGFLVKM.S Oxidation (M) (Ions score 35) 12 0 H.GLLPGFLVKMSG.D Oxidation (M) (Ions score 13 0 H.GLLPGFLVKMSG.D Oxidation (M) (Ions score 6 0 G.LLPGFLVKMS.G (Ions score 23) 8 0 G.LLPGFLVKMSG.D Oxidation (M) (Ions score 28) 12 0 L.LPGFLVK.M (Ions score 15) 1 0 L.LPGFLVKM.S (Ions score 27) 7 0 L.LPGFLVKM.S Oxidation (M) (Ions score 27) 5 0 L.LPGFLVKMS.G (Ions score 22) 8 0 L.LPGFLVKMSG.D (Ions score 23) 9 0 L.LPGFLVKMSG.D (Ions score 36) 12 0 L.LPGFLVKMSG.D Oxidation (M) (Ions score 32) 7 0 L.PGFLVK.M (Ions score 20) 9 0 L.PGFLVK.M (Ions score 15) 13 0 L.PGFLVK.M (Ions score 22) 4 0 L.PGFLVKM.S (Ions score 15) 10 0 L.PGFLVKM.S (Ions score 17) 6 0 L.PGFLVKM.S Oxidation (M) (Ions score 19) 15 0 L.PGFLVKM.S Oxidation (M) (Ions score 16) 11 0 L.PGFLVKMSG.D (Ions score 17) 2 0 M.SGDLLELALK.L (Ions score 40) 10 0 M.SGDLLELALK.L (Ions score 66) -1 0 S.GDLLELALK.L (Ions score 18) 9 0 G.DLLELAL.K (Ions score 22) 4 0 G.DLLELALK.L (Ions score 32) 11 0 G.DLLELALK.L (Ions score 32) -1 0 D.LLELALK.L (Ions score 32) 10 0 D.LLELALK.L (Ions score 27) 6 MMP-2 protects the LDLR Corresponding author: Carlos Fernandez-Patron 100 - 106 799.5389 798.5316 798.5215 101 - 106 686.4523 685.4450 685.4374 101 - 111 624.3684 1246.7222 1246.7285 102 - 116 892.4559 1782.8972 1782.9039 107 - 116 615.2934 1228.5722 1228.5612 107 - 116 1229.5891 1228.5818 1228.5612 107 - 117 658.8066 1315.5986 1315.5932 108 - 116 1116.4860 1115.4787 1115.4771 108 - 116 558.7541 1115.4936 1115.4771 108 - 122 868.8883 1735.7620 1735.7577 score 70) 13 0 D.LLELALK.L (Ions score 16) 11 0 L.LELALK.L (Ions score 21) -5 0 L.LELALKLPHVD.Y (Ions score 26) -4 0 L.ELALKLPHVDYIEED.S (Ions score 16) 9 0 K.LPHVDYIEED.S (Ions score 36) 17 0 K.LPHVDYIEED.S (Ions score 34) 4 0 K.LPHVDYIEEDS.S (Ions score 21) 1 0 L.PHVDYIEED.S (Ions score 29) 15 0 L.PHVDYIEED.S (Ions score 18) 3 0 L.PHVDYIEEDSSVFAQ.- Deamidated (NQ) (Ions 7 MMP-2 protects the LDLR Corresponding author: Carlos Fernandez-Patron Supplementary Table 2 List of peptides identified by MALDI-TOF MS analysis of rmPCSK9 cleavage fragments after 16 hrs at 37C with rhMMP-2 (PCSK9:MMP-2 = 10:1; mol:mol). Molecular weights from 8000 - 100000 Da were generated using SA as the matrix Molecular weights from 500 - 8000 Da were generated using ACH as the matrix. Matched peptides shown in Bold Red Index Centroid Mass Lower Bound Upper Bound Charge (z) Height Relative intensity Area 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 8003.35273 8010.22506 8016.95363 8033.39634 8045.59378 8070.0824 8095.82056 8116.67446 8129.89402 8145.44661 8152.57061 8170.84332 8184.51132 8193.43533 8218.53951 8237.34411 8245.89366 8263.06146 8277.95137 8286.6256 8313.72245 8324.31284 8334.92649 8355.8099 8372.639 8396.16453 8413.8471 8429.58411 8438.94195 8460.16717 8478.50042 8498.107 8003.35 8010.23 8016.95 8033.4 8045.59 8070.08 8095.82 8116.67 8129.89 8145.45 8152.57 8170.84 8184.51 8193.44 8218.54 8237.34 8245.89 8263.06 8277.95 8286.63 8313.72 8324.31 8334.93 8355.81 8372.64 8396.16 8413.85 8429.58 8438.94 8460.17 8478.5 8498.11 8003.35 8010.23 8016.95 8033.4 8045.59 8070.08 8095.82 8116.67 8129.89 8145.45 8152.57 8170.84 8184.51 8193.44 8218.54 8237.34 8245.89 8263.06 8277.95 8286.63 8313.72 8324.31 8334.93 8355.81 8372.64 8396.16 8413.85 8429.58 8438.94 8460.17 8478.5 8498.11 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4632 6196 15467 9094 18442 60391 27435 19856 4590 13595 4102 18865 5235 5948 63811 7877 5912 22540 3156 24456 18124 9995 29247 26734 32866 16210 14358 7028 12738 34149 10800 21227 7.15 9.56 23.87 14.03 28.46 93.18 42.33 30.64 7.08 20.98 6.33 29.11 8.08 9.18 98.46 12.15 9.12 34.78 4.87 37.74 27.97 15.42 45.13 41.25 50.71 25.01 22.15 10.84 19.65 52.69 16.66 32.75 4631.7 6195.65 15467.3 9094.22 18442.28 60390.67 27435.29 19855.86 4589.53 13594.5 4101.58 18864.65 5235.22 5947.5 63811.45 7876.98 5911.74 22540.15 3156.41 24456.1 18124.11 9995.47 29247.13 26734.12 32866.28 16209.99 14358.07 7027.92 12737.93 34148.55 10800.11 21227.1 8 MMP-2 protects the LDLR Corresponding author: Carlos Fernandez-Patron 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 8510.36238 8526.23572 8539.11436 8570.55283 8589.48764 8603.17631 8620.64271 8652.75515 8670.67744 8691.62197 8708.71323 8728.47055 8746.19293 8762.32244 8788.88674 8810.08045 8831.13589 8854.36404 8863.73201 8876.50075 8894.03704 8912.53927 8929.67705 8951.70734 8964.57592 8988.46859 9022.37345 9036.11506 9045.78323 9059.78364 9084.98272 9103.64497 9114.25136 9122.91948 9142.26181 9157.0637 9170.96119 9178.73357 9197.94731 9228.8384 9246.83811 9262.06287 9274.96254 8510.36 8526.24 8539.11 8570.55 8589.49 8603.18 8620.64 8652.76 8670.68 8691.62 8708.71 8728.47 8746.19 8762.32 8788.89 8810.08 8831.14 8854.36 8863.73 8876.5 8894.04 8912.54 8929.68 8951.71 8964.58 8988.47 9022.37 9036.12 9045.78 9059.78 9084.98 9103.64 9114.25 9122.92 9142.26 9157.06 9170.96 9178.73 9197.95 9228.84 9246.84 9262.06 9274.96 8510.36 8526.24 8539.11 8570.55 8589.49 8603.18 8620.64 8652.76 8670.68 8691.62 8708.71 8728.47 8746.19 8762.32 8788.89 8810.08 8831.14 8854.36 8863.73 8876.5 8894.04 8912.54 8929.68 8951.71 8964.58 8988.47 9022.37 9036.12 9045.78 9059.78 9084.98 9103.64 9114.25 9122.92 9142.26 9157.06 9170.96 9178.73 9197.95 9228.84 9246.84 9262.06 9274.96 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 7408 19087 28528 13792 7856 16812 26962 27883 24833 64809 8442 30938 16413 18244 29050 14801 36291 14221 9869 7910 6828 10787 8073 23459 16560 10863 14021 1608 16118 8158 19494 5097 1609 3571 4448 11439 7333 17883 22113 12189 12411 7214 3558 11.43 29.45 44.02 21.28 12.12 25.94 41.6 43.02 38.32 100 13.03 47.74 25.33 28.15 44.82 22.84 56 21.94 15.23 12.21 10.54 16.64 12.46 36.2 25.55 16.76 21.63 2.48 24.87 12.59 30.08 7.86 2.48 5.51 6.86 17.65 11.31 27.59 34.12 18.81 19.15 11.13 5.49 7408.48 19086.93 28527.91 13792.3 7855.64 16812.47 26962.33 27882.68 24832.99 64809.25 8441.59 30937.86 16413.1 18243.59 29049.83 14800.96 36291.39 14220.53 9869.48 7910.14 6827.76 10787.19 8073.38 23458.91 16560.46 10863.25 14020.68 1608.31 16118.38 8157.98 19494.38 5096.86 1608.62 3571.29 4448.16 11439.35 7332.64 17882.54 22113.16 12189.45 12410.55 7214.18 3558.43 9 MMP-2 protects the LDLR Corresponding author: Carlos Fernandez-Patron 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 9287.38054 9306.73332 9340.49727 9361.96168 9383.44023 9404.00473 9426.5684 9440.47546 9460.09092 9473.22975 9495.29395 9511.55071 9532.31265 9548.88833 9574.61414 9584.30016 9608.13013 9625.6835 9645.10138 9661.24299 9685.04718 9694.30653 9708.72275 9721.25605 9747.57377 9783.92179 9804.93948 9819.09378 9838.86977 9856.83684 9873.21816 9896.6643 9917.38553 9934.84508 9960.55045 9979.54127 9992.75229 10011.34519 10029.16877 10041.3677 10060.77819 10082.05081 10099.39538 9287.38 9306.73 9340.5 9361.96 9383.44 9404 9426.57 9440.48 9460.09 9473.23 9495.29 9511.55 9532.31 9548.89 9574.61 9584.3 9608.13 9625.68 9645.1 9661.24 9685.05 9694.31 9708.72 9721.26 9747.57 9783.92 9804.94 9819.09 9838.87 9856.84 9873.22 9896.66 9917.39 9934.85 9960.55 9979.54 9992.75 10011.35 10029.17 10041.37 10060.78 10082.05 10099.4 9287.38 9306.73 9340.5 9361.96 9383.44 9404 9426.57 9440.48 9460.09 9473.23 9495.29 9511.55 9532.31 9548.89 9574.61 9584.3 9608.13 9625.68 9645.1 9661.24 9685.05 9694.31 9708.72 9721.26 9747.57 9783.92 9804.94 9819.09 9838.87 9856.84 9873.22 9896.66 9917.39 9934.85 9960.55 9979.54 9992.75 10011.35 10029.17 10041.37 10060.78 10082.05 10099.4 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11597 19807 26043 12530 36023 21095 37315 31475 12058 17383 5782 16557 11292 20091 15467 2919 10146 13819 19790 8492 12063 3176 2883 13490 17721 14870 15169 8294 25825 6900 17476 37854 10992 18826 9592 4770 5833 6822 8313 8249 19938 4037 15397 17.89 30.56 40.18 19.33 55.58 32.55 57.58 48.57 18.6 26.82 8.92 25.55 17.42 31 23.87 4.5 15.65 21.32 30.54 13.1 18.61 4.9 4.45 20.82 27.34 22.94 23.41 12.8 39.85 10.65 26.97 58.41 16.96 29.05 14.8 7.36 9 10.53 12.83 12.73 30.76 6.23 23.76 11597.26 19807.26 26042.6 12529.95 36022.66 21094.57 37314.59 31474.75 12057.71 17382.87 5781.72 16557.02 11292.11 20090.95 15467.34 2919.47 10145.65 13819.06 19789.72 8492.29 12063.31 3176.01 2883.25 13490.35 17721.03 14870.16 15169.49 8294.11 25824.69 6900.49 17475.96 37853.73 10992.29 18826.42 9591.63 4769.6 5833.15 6821.93 8313.07 8248.98 19937.62 4036.77 15397.35 10 MMP-2 protects the LDLR Corresponding author: Carlos Fernandez-Patron 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 10136.70459 10171.75991 10189.56144 10200.35178 10220.29065 10239.1736 10279.31273 10306.83387 10329.82334 10341.08613 10369.66989 10378.28469 10415.07128 10426.87063 10476.35056 10507.61526 10520.12994 10533.38072 10544.9019 10557.73051 10565.33212 10589.3416 10607.33715 10631.97694 10669.67203 10692.54594 10712.52651 10734.80417 10751.63845 10767.81661 10787.6157 10819.81882 10847.24943 10863.67585 10879.00825 10891.62926 10922.01733 10947.03634 10970.54142 10990.32787 11018.29959 11042.74422 11059.15092 10136.7 10171.76 10189.56 10200.35 10220.29 10239.17 10279.31 10306.83 10329.82 10341.09 10369.67 10378.28 10415.07 10426.87 10476.35 10507.62 10520.13 10533.38 10544.9 10557.73 10565.33 10589.34 10607.34 10631.98 10669.67 10692.55 10712.53 10734.8 10751.64 10767.82 10787.62 10819.82 10847.25 10863.68 10879.01 10891.63 10922.02 10947.04 10970.54 10990.33 11018.3 11042.74 11059.15 10136.7 10171.76 10189.56 10200.35 10220.29 10239.17 10279.31 10306.83 10329.82 10341.09 10369.67 10378.28 10415.07 10426.87 10476.35 10507.62 10520.13 10533.38 10544.9 10557.73 10565.33 10589.34 10607.34 10631.98 10669.67 10692.55 10712.53 10734.8 10751.64 10767.82 10787.62 10819.82 10847.25 10863.68 10879.01 10891.63 10922.02 10947.04 10970.54 10990.33 11018.3 11042.74 11059.15 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 48185 10016 5625 9368 4523 18570 11277 17700 7870 10810 7061 10983 5352 10960 34003 7563 11924 3759 10781 3366 7123 11561 4378 26043 27171 6699 15288 7950 7751 5128 22294 6042 7768 7806 4920 5730 10268 5133 22460 6246 16352 3257 4845 74.35 15.46 8.68 14.46 6.98 28.65 17.4 27.31 12.14 16.68 10.89 16.95 8.26 16.91 52.47 11.67 18.4 5.8 16.64 5.19 10.99 17.84 6.76 40.18 41.93 10.34 23.59 12.27 11.96 7.91 34.4 9.32 11.99 12.05 7.59 8.84 15.84 7.92 34.66 9.64 25.23 5.03 7.48 48185.03 10016.31 5624.98 9368.46 4522.89 18569.93 11276.97 17699.69 7869.95 10810.27 7060.81 10983.34 5351.74 10959.88 34003.07 7563.4 11924.02 3759.18 10781.09 3366.2 7123.46 11560.97 4378.07 26042.96 27171.5 6698.8 15288.2 7950.15 7751.02 5127.58 22293.63 6041.65 7767.53 7806.32 4919.54 5730.23 10268.31 5132.82 22460.12 6245.73 16351.59 3256.71 4845.4 11 MMP-2 protects the LDLR Corresponding author: Carlos Fernandez-Patron 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 11070.80027 11091.8824 11117.23114 11125.9473 11149.3371 11182.57481 11198.90635 11231.98873 11276.54465 11309.07885 11333.73336 11375.92264 11410.33782 11435.93991 11458.46926 11470.08405 11483.79908 11498.98029 11525.67447 11546.96109 11573.88793 11593.18122 11640.24732 11671.21429 11690.37788 11721.28212 11734.03125 11758.24447 11785.50245 11815.651 11832.36911 11855.94008 11879.26717 11911.31743 11942.53242 11954.01055 11989.65874 12010.17327 12049.67256 12062.32242 12106.96346 12130.01001 12153.0532 11070.8 11091.88 11117.23 11125.95 11149.34 11182.57 11198.91 11231.99 11276.54 11309.08 11333.73 11375.92 11410.34 11435.94 11458.47 11470.08 11483.8 11498.98 11525.67 11546.96 11573.89 11593.18 11640.25 11671.21 11690.38 11721.28 11734.03 11758.24 11785.5 11815.65 11832.37 11855.94 11879.27 11911.32 11942.53 11954.01 11989.66 12010.17 12049.67 12062.32 12106.96 12130.01 12153.05 11070.8 11091.88 11117.23 11125.95 11149.34 11182.57 11198.91 11231.99 11276.54 11309.08 11333.73 11375.92 11410.34 11435.94 11458.47 11470.08 11483.8 11498.98 11525.67 11546.96 11573.89 11593.18 11640.25 11671.21 11690.38 11721.28 11734.03 11758.24 11785.5 11815.65 11832.37 11855.94 11879.27 11911.32 11942.53 11954.01 11989.66 12010.17 12049.67 12062.32 12106.96 12130.01 12153.05 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 8833 9497 3590 5276 23412 9161 16390 19810 30651 8449 35813 35773 14003 22914 10037 3532 4452 16298 4435 13957 2523 20141 12758 16172 5451 6344 6887 7262 10632 12776 5246 11119 9270 4530 5436 10306 8022 6600 13655 7145 15325 2151 4631 13.63 14.65 5.54 8.14 36.12 14.14 25.29 30.57 47.29 13.04 55.26 55.2 21.61 35.36 15.49 5.45 6.87 25.15 6.84 21.54 3.89 31.08 19.69 24.95 8.41 9.79 10.63 11.2 16.4 19.71 8.09 17.16 14.3 6.99 8.39 15.9 12.38 10.18 21.07 11.02 23.65 3.32 7.15 8833.02 9497.21 3589.96 5276 23411.87 9161.04 16389.65 19809.88 30650.87 8449.34 35812.82 35772.72 14002.91 22913.82 10037.01 3531.69 4452.01 16298.45 4434.98 13957.1 2523.27 20140.56 12758.14 16172.4 5450.88 6343.63 6886.59 7261.52 10631.94 12775.68 5246.15 11118.81 9270.36 4530.31 5436.28 10305.79 8022.31 6600.3 13654.78 7145.14 15325.43 2151.38 4630.97 12 MMP-2 protects the LDLR Corresponding author: Carlos Fernandez-Patron 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 12178.77394 12197.0696 12222.08249 12240.68072 12278.91258 12293.78547 12315.10091 12336.07905 12384.07913 12397.96743 12423.03526 12444.10068 12463.36964 12481.93819 12516.02051 12544.83889 12574.61749 12597.50392 12640.38028 12672.65489 12691.3169 12708.811 12745.20714 12772.94977 12804.84339 12829.19123 12872.68246 12931.21008 12961.00758 12980.1784 13007.33615 13031.55056 13069.99973 13090.93227 13101.54041 13122.43099 13142.80661 13168.00294 13199.50944 13212.41908 13237.51163 13262.55288 13292.19448 12178.77 12197.07 12222.08 12240.68 12278.91 12293.79 12315.1 12336.08 12384.08 12397.97 12423.04 12444.1 12463.37 12481.94 12516.02 12544.84 12574.62 12597.5 12640.38 12672.65 12691.32 12708.81 12745.21 12772.95 12804.84 12829.19 12872.68 12931.21 12961.01 12980.18 13007.34 13031.55 13070 13090.93 13101.54 13122.43 13142.81 13168 13199.51 13212.42 13237.51 13262.55 13292.19 12178.77 12197.07 12222.08 12240.68 12278.91 12293.79 12315.1 12336.08 12384.08 12397.97 12423.04 12444.1 12463.37 12481.94 12516.02 12544.84 12574.62 12597.5 12640.38 12672.65 12691.32 12708.81 12745.21 12772.95 12804.84 12829.19 12872.68 12931.21 12961.01 12980.18 13007.34 13031.55 13070 13090.93 13101.54 13122.43 13142.81 13168 13199.51 13212.42 13237.51 13262.55 13292.19 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 7301 9669 3730 11259 7337 1632 20067 8670 8898 3923 4931 1729 25553 7133 3386 5933 8538 28676 5864 4672 9155 1519 13268 16990 9989 11579 14777 16115 3197 6491 16402 26415 12357 7925 6252 10458 2134 7486 6124 10159 15322 8010 4422 11.26 14.92 5.76 17.37 11.32 2.52 30.96 13.38 13.73 6.05 7.61 2.67 39.43 11.01 5.22 9.16 13.17 44.25 9.05 7.21 14.13 2.34 20.47 26.21 15.41 17.87 22.8 24.87 4.93 10.02 25.31 40.76 19.07 12.23 9.65 16.14 3.29 11.55 9.45 15.67 23.64 12.36 6.82 7300.68 9669.2 3730.28 11259.46 7337.49 1632.08 20067.35 8669.7 8898.41 3922.98 4931.46 1728.74 25552.58 7132.86 3385.82 5933.47 8537.7 28676.37 5863.92 4672.39 9154.67 1518.95 13268.1 16989.71 9989.29 11579.28 14777.37 16115.02 3196.96 6491.17 16402.43 26414.53 12357.02 7924.62 6251.82 10458.43 2133.58 7486.34 6123.79 10158.55 15321.83 8009.99 4421.66 13 MMP-2 protects the LDLR Corresponding author: Carlos Fernandez-Patron 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 13308.55929 13340.19553 13369.35926 13404.23162 13429.23745 13445.40743 13468.8257 13498.61492 13526.25507 13550.51939 13587.69616 13610.89422 13628.71542 13688.70691 13701.59126 13732.57938 13753.34934 13775.96795 13796.39433 13817.85317 13847.01984 13875.21887 13896.7679 13925.52931 13943.07448 13991.57026 14005.50446 14036.50207 14090.64435 14139.57749 14169.57756 14202.64879 14227.17806 14250.46773 14266.02515 14283.36974 14303.20768 14333.15463 14350.44258 14367.08638 14392.52375 14439.68476 14451.22637 13308.56 13340.2 13369.36 13404.23 13429.24 13445.41 13468.83 13498.61 13526.26 13550.52 13587.7 13610.89 13628.72 13688.71 13701.59 13732.58 13753.35 13775.97 13796.39 13817.85 13847.02 13875.22 13896.77 13925.53 13943.07 13991.57 14005.5 14036.5 14090.64 14139.58 14169.58 14202.65 14227.18 14250.47 14266.03 14283.37 14303.21 14333.15 14350.44 14367.09 14392.52 14439.68 14451.23 13308.56 13340.2 13369.36 13404.23 13429.24 13445.41 13468.83 13498.61 13526.26 13550.52 13587.7 13610.89 13628.72 13688.71 13701.59 13732.58 13753.35 13775.97 13796.39 13817.85 13847.02 13875.22 13896.77 13925.53 13943.07 13991.57 14005.5 14036.5 14090.64 14139.58 14169.58 14202.65 14227.18 14250.47 14266.03 14283.37 14303.21 14333.15 14350.44 14367.09 14392.52 14439.68 14451.23 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 6686 2696 7607 9036 5452 1680 12925 2079 6860 13925 23370 3903 22766 2147 9485 4418 7876 3272 10578 4153 8197 15493 5624 2966 7432 2931 3280 3647 14319 1919 11236 6393 1881 3253 3457 3971 6193 1306 4852 9369 13701 3075 7095 10.32 4.16 11.74 13.94 8.41 2.59 19.94 3.21 10.58 21.49 36.06 6.02 35.13 3.31 14.64 6.82 12.15 5.05 16.32 6.41 12.65 23.91 8.68 4.58 11.47 4.52 5.06 5.63 22.09 2.96 17.34 9.86 2.9 5.02 5.33 6.13 9.56 2.01 7.49 14.46 21.14 4.74 10.95 6685.7 2696.34 7607.13 9035.62 5452.42 1680.34 12925.28 2079.29 6859.95 13925.17 23370.43 3903.44 22765.74 2146.69 9484.91 4418.24 7876.01 3271.66 10578.2 4152.51 8196.67 15493.03 5623.74 2965.64 7432.22 2931.43 3279.51 3647.17 14319.44 1919.39 11235.95 6393.07 1881.06 3252.61 3457.43 3970.96 6193.29 1305.89 4851.79 9369.38 13701.19 3075.04 7094.67 14 MMP-2 protects the LDLR Corresponding author: Carlos Fernandez-Patron 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 14486.82011 14518.01346 14582.55647 14603.15386 14632.25684 14692.62535 14740.61138 14779.06885 14851.058 14885.77307 14923.9019 14953.57643 15021.4995 15039.18187 15088.74671 15119.73222 15164.86325 15212.40584 15247.46305 15291.02257 15312.23079 15342.32151 15413.05612 15447.23223 15467.72271 15485.22362 15508.71573 15551.26875 15585.96905 15631.78528 15683.2234 15721.2878 15764.47019 15812.21213 15854.59869 15877.19117 15905.97067 15924.51209 15966.23506 16027.39008 16078.64209 16110.13995 16146.87735 14486.82 14518.01 14582.56 14603.15 14632.26 14692.63 14740.61 14779.07 14851.06 14885.77 14923.9 14953.58 15021.5 15039.18 15088.75 15119.73 15164.86 15212.41 15247.46 15291.02 15312.23 15342.32 15413.06 15447.23 15467.72 15485.22 15508.72 15551.27 15585.97 15631.79 15683.22 15721.29 15764.47 15812.21 15854.6 15877.19 15905.97 15924.51 15966.24 16027.39 16078.64 16110.14 16146.88 14486.82 14518.01 14582.56 14603.15 14632.26 14692.63 14740.61 14779.07 14851.06 14885.77 14923.9 14953.58 15021.5 15039.18 15088.75 15119.73 15164.86 15212.41 15247.46 15291.02 15312.23 15342.32 15413.06 15447.23 15467.72 15485.22 15508.72 15551.27 15585.97 15631.79 15683.22 15721.29 15764.47 15812.21 15854.6 15877.19 15905.97 15924.51 15966.24 16027.39 16078.64 16110.14 16146.88 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5178 12166 11514 5802 8806 18630 13282 9839 12110 9242 10603 3703 4184 7297 9020 17628 13476 2747 11700 2760 4738 2561 10110 3837 6208 4388 8030 1318 8069 11419 14283 8135 3682 5397 4379 1556 2765 2231 5129 19502 5508 11913 2222 7.99 18.77 17.77 8.95 13.59 28.75 20.49 15.18 18.69 14.26 16.36 5.71 6.46 11.26 13.92 27.2 20.79 4.24 18.05 4.26 7.31 3.95 15.6 5.92 9.58 6.77 12.39 2.03 12.45 17.62 22.04 12.55 5.68 8.33 6.76 2.4 4.27 3.44 7.91 30.09 8.5 18.38 3.43 5177.81 12165.76 11513.77 5801.5 8806 18629.75 13282.18 9839.44 12110.31 9241.53 10602.91 3702.88 4183.94 7296.8 9019.6 17627.76 13475.52 2746.5 11700.04 2760.35 4737.89 2561.05 10109.58 3836.84 6208.28 4388.33 8030.07 1318.5 8069.37 11418.67 14283.21 8135.08 3681.76 5396.97 4378.5 1556.16 2764.9 2231.17 5129.24 19502.44 5508.29 11912.62 2221.56 15 MMP-2 protects the LDLR Corresponding author: Carlos Fernandez-Patron 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 16173.08012 16187.48284 16207.11346 16234.91885 16273.84455 16326.59228 16348.30879 16373.6685 16399.48529 16452.6305 16483.57856 16529.98484 16563.08858 16605.82206 16633.62736 16657.45221 16684.10001 16734.39107 16773.43602 16828.31733 16926.99753 16952.66531 16974.1629 17010.27114 17035.75525 17064.14809 17108.80374 17144.91866 17189.93794 17236.38008 17277.38694 17313.41401 17344.24066 17356.56782 17401.40189 17473.92352 17498.20649 17530.24175 17590.92143 17627.65462 17663.34113 17704.19698 17758.68046 16173.08 16187.48 16207.11 16234.92 16273.84 16326.59 16348.31 16373.67 16399.49 16452.63 16483.58 16529.98 16563.09 16605.82 16633.63 16657.45 16684.1 16734.39 16773.44 16828.32 16927 16952.67 16974.16 17010.27 17035.76 17064.15 17108.8 17144.92 17189.94 17236.38 17277.39 17313.41 17344.24 17356.57 17401.4 17473.92 17498.21 17530.24 17590.92 17627.65 17663.34 17704.2 17758.68 16173.08 16187.48 16207.11 16234.92 16273.84 16326.59 16348.31 16373.67 16399.49 16452.63 16483.58 16529.98 16563.09 16605.82 16633.63 16657.45 16684.1 16734.39 16773.44 16828.32 16927 16952.67 16974.16 17010.27 17035.76 17064.15 17108.8 17144.92 17189.94 17236.38 17277.39 17313.41 17344.24 17356.57 17401.4 17473.92 17498.21 17530.24 17590.92 17627.65 17663.34 17704.2 17758.68 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4693 2557 7296 8716 4419 7047 2134 2025 8838 9500 5122 7375 7247 5926 3509 6529 5812 17151 4173 6051 5693 4427 8109 4103 1415 7439 4708 2101 3735 3795 11517 2689 4397 7539 6260 4308 7501 12543 3977 2888 7761 2561 10430 7.24 3.94 11.26 13.45 6.82 10.87 3.29 3.12 13.64 14.66 7.9 11.38 11.18 9.14 5.41 10.07 8.97 26.46 6.44 9.34 8.78 6.83 12.51 6.33 2.18 11.48 7.26 3.24 5.76 5.86 17.77 4.15 6.78 11.63 9.66 6.65 11.57 19.35 6.14 4.46 11.98 3.95 16.09 4692.96 2556.59 7296.48 8716.2 4419.34 7047.22 2134.17 2025.1 8838.46 9499.84 5121.97 7375.35 7246.86 5925.89 3509 6529.2 5811.69 17151.07 4172.82 6051.44 5693.35 4427.19 8109.23 4103.16 1414.78 7438.83 4707.69 2101.29 3734.78 3795.31 11516.76 2688.73 4397.21 7538.94 6259.89 4307.86 7501.01 12543.18 3977.32 2887.75 7761.15 2561.38 10430.48 16 MMP-2 protects the LDLR Corresponding author: Carlos Fernandez-Patron 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 17804.0661 17854.42215 17907.80284 17993.53385 18026.12786 18061.87547 18079.59715 18106.01522 18139.32452 18176.20819 18242.54937 18266.51414 18351.78743 18403.25478 18449.56319 18482.94149 18587.95184 18645.08472 18655.90975 18696.29871 18745.07463 18790.90623 18808.72301 18834.38178 18908.21628 18963.02404 19013.5108 19093.76575 19168.62933 19250.92069 19290.15419 19327.31534 19346.52483 19400.30029 19440.18941 19460.38196 19487.68786 19539.75905 19583.69497 19629.69382 19652.2631 19702.8883 19726.25085 17804.07 17854.42 17907.8 17993.53 18026.13 18061.88 18079.6 18106.02 18139.32 18176.21 18242.55 18266.51 18351.79 18403.25 18449.56 18482.94 18587.95 18645.08 18655.91 18696.3 18745.07 18790.91 18808.72 18834.38 18908.22 18963.02 19013.51 19093.77 19168.63 19250.92 19290.15 19327.32 19346.52 19400.3 19440.19 19460.38 19487.69 19539.76 19583.69 19629.69 19652.26 19702.89 19726.25 17804.07 17854.42 17907.8 17993.53 18026.13 18061.88 18079.6 18106.02 18139.32 18176.21 18242.55 18266.51 18351.79 18403.25 18449.56 18482.94 18587.95 18645.08 18655.91 18696.3 18745.07 18790.91 18808.72 18834.38 18908.22 18963.02 19013.51 19093.77 19168.63 19250.92 19290.15 19327.32 19346.52 19400.3 19440.19 19460.38 19487.69 19539.76 19583.69 19629.69 19652.26 19702.89 19726.25 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 7842 11927 4075 5456 4499 5610 4153 6511 1316 4119 4778 4589 9964 6748 3857 7355 6549 7662 6626 10870 9228 3285 1966 7533 6301 10097 23507 7255 18626 5801 8344 8349 8352 12602 1510 4093 9183 8255 5420 2723 4368 2706 3864 12.1 18.4 6.29 8.42 6.94 8.66 6.41 10.05 2.03 6.36 7.37 7.08 15.37 10.41 5.95 11.35 10.1 11.82 10.22 16.77 14.24 5.07 3.03 11.62 9.72 15.58 36.27 11.19 28.74 8.95 12.87 12.88 12.89 19.44 2.33 6.32 14.17 12.74 8.36 4.2 6.74 4.17 5.96 7842.18 11926.79 4074.51 5455.95 4499.03 5610.35 4153.46 6510.84 1315.77 4118.65 4777.98 4588.95 9963.9 6747.94 3856.62 7354.68 6548.72 7662.41 6625.98 10869.8 9227.51 3285.5 1966.07 7532.54 6301.25 10096.94 23507.39 7254.84 18625.53 5801.08 8343.75 8348.55 8351.67 12601.95 1510.35 4093.21 9183.05 8255.22 5420.43 2723.21 4367.97 2705.76 3863.59 17 MMP-2 protects the LDLR Corresponding author: Carlos Fernandez-Patron 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 19771.01707 19823.92619 19877.32035 19896.82482 19939.58903 19985.37695 20119.02791 20164.2317 20266.86039 20314.04876 20389.65854 20440.9929 20463.85606 20515.51568 20542.99405 20714.31699 20773.22575 20816.36557 20872.93593 20909.69815 20948.61439 21003.14848 21057.67804 21190.39613 21279.14337 21354.17312 21397.45633 21464.67206 21547.95517 21618.59991 21693.50359 21822.55902 21858.41175 21949.84596 22013.24546 22064.71398 22134.51337 22173.2166 22248.46904 22278.24426 22391.17713 22441.08478 22517.38789 19771.02 19823.93 19877.32 19896.82 19939.59 19985.38 20119.03 20164.23 20266.86 20314.05 20389.66 20440.99 20463.86 20515.52 20542.99 20714.32 20773.23 20816.37 20872.94 20909.7 20948.61 21003.15 21057.68 21190.4 21279.14 21354.17 21397.46 21464.67 21547.96 21618.6 21693.5 21822.56 21858.41 21949.85 22013.25 22064.71 22134.51 22173.22 22248.47 22278.24 22391.18 22441.08 22517.39 19771.02 19823.93 19877.32 19896.82 19939.59 19985.38 20119.03 20164.23 20266.86 20314.05 20389.66 20440.99 20463.86 20515.52 20542.99 20714.32 20773.23 20816.37 20872.94 20909.7 20948.61 21003.15 21057.68 21190.4 21279.14 21354.17 21397.46 21464.67 21547.96 21618.6 21693.5 21822.56 21858.41 21949.85 22013.25 22064.71 22134.51 22173.22 22248.47 22278.24 22391.18 22441.08 22517.39 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 3592 1589 1766 3088 9114 5858 5268 4702 13255 13778 10078 3482 5661 5806 3639 2820 3905 4141 8299 3111 1831 6594 5380 13657 2099 1460 2475 7149 20722 12516 1981 1911 2420 16913 4886 5857 9410 6996 4195 1310 2041 6977 5290 5.54 2.45 2.72 4.76 14.06 9.04 8.13 7.25 20.45 21.26 15.55 5.37 8.74 8.96 5.62 4.35 6.03 6.39 12.81 4.8 2.83 10.17 8.3 21.07 3.24 2.25 3.82 11.03 31.97 19.31 3.06 2.95 3.73 26.1 7.54 9.04 14.52 10.79 6.47 2.02 3.15 10.76 8.16 3591.96 1589.21 1765.76 3088.07 9113.53 5858.39 5268.44 4701.73 13255.02 13778.14 10077.87 3482.11 5661.42 5805.56 3639.44 2819.71 3905.21 4141.12 8299.08 3110.54 1831.32 6593.99 5379.98 13657.09 2098.75 1459.7 2475.06 7148.88 20722.49 12515.99 1980.76 1910.85 2419.67 16912.63 4886.06 5857.09 9410.15 6996.15 4195.44 1310.02 2041.45 6976.55 5290.18 18 MMP-2 protects the LDLR Corresponding author: Carlos Fernandez-Patron 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 22551.91348 22590.46118 22650.03762 22691.8517 22740.34407 22757.55806 22801.08495 22907.70677 22943.20806 23003.56481 23051.30522 23112.50389 23152.72484 23291.28949 23371.51856 23407.84262 23453.85972 23545.20751 23608.74814 23662.56567 23756.07338 23791.97282 23829.21055 23866.02315 23942.62448 23999.71884 24026.52065 24097.65594 24133.13531 24161.75999 24205.12292 24241.95967 24289.78041 24340.82357 24380.34861 24424.43216 24499.43995 24561.23215 24610.78375 24642.13591 24764.20374 24817.57395 24929.80547 22551.91 22590.46 22650.04 22691.85 22740.34 22757.56 22801.08 22907.71 22943.21 23003.56 23051.31 23112.5 23152.72 23291.29 23371.52 23407.84 23453.86 23545.21 23608.75 23662.57 23756.07 23791.97 23829.21 23866.02 23942.62 23999.72 24026.52 24097.66 24133.14 24161.76 24205.12 24241.96 24289.78 24340.82 24380.35 24424.43 24499.44 24561.23 24610.78 24642.14 24764.2 24817.57 24929.81 22551.91 22590.46 22650.04 22691.85 22740.34 22757.56 22801.08 22907.71 22943.21 23003.56 23051.31 23112.5 23152.72 23291.29 23371.52 23407.84 23453.86 23545.21 23608.75 23662.57 23756.07 23791.97 23829.21 23866.02 23942.62 23999.72 24026.52 24097.66 24133.14 24161.76 24205.12 24241.96 24289.78 24340.82 24380.35 24424.43 24499.44 24561.23 24610.78 24642.14 24764.2 24817.57 24929.81 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 2903 5637 9453 13166 6643 9629 2433 5883 5158 1785 2255 1826 2106 4697 3757 5583 2784 8035 6982 6316 3942 4852 2263 3335 1939 2217 1533 2528 1485 8365 2409 4629 10462 8028 5905 2115 2811 5005 3804 16095 1563 6662 12067 4.48 8.7 14.59 20.31 10.25 14.86 3.75 9.08 7.96 2.75 3.48 2.82 3.25 7.25 5.8 8.61 4.3 12.4 10.77 9.75 6.08 7.49 3.49 5.15 2.99 3.42 2.37 3.9 2.29 12.91 3.72 7.14 16.14 12.39 9.11 3.26 4.34 7.72 5.87 24.83 2.41 10.28 18.62 2902.68 5636.56 9453.08 13165.52 6642.92 9629.15 2433.12 5883.46 5158.37 1785.23 2254.76 1826.27 2105.81 4696.76 3756.71 5582.63 2784.43 8034.63 6982.32 6316.27 3941.59 4852.35 2262.77 3334.85 1939.07 2217.49 1533.29 2528.39 1484.71 8365.22 2409.01 4628.7 10462.32 8027.6 5904.75 2114.97 2810.7 5005.08 3803.84 16094.69 1563.06 6662.14 12067.49 19 MMP-2 protects the LDLR Corresponding author: Carlos Fernandez-Patron 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 532 533 534 535 536 537 538 539 540 541 542 543 544 545 546 547 548 25031.4669 25086.03146 25126.60693 25195.10362 25295.86598 25355.07863 25425.44611 25480.84931 25541.08335 25563.33055 25592.90066 25635.42654 25726.19204 25763.63461 25803.02635 25895.74892 25937.52504 25982.88387 26070.90444 26146.27033 26236.23739 26284.99017 26330.61308 26356.20644 26446.83547 26514.78258 26593.22725 26614.56287 26637.97728 26700.42713 26783.38119 26925.87362 26984.3891 27049.19791 27178.325 27267.7004 27355.34163 27428.89417 27571.2736 27626.81779 27714.48141 27775.92435 27818.62516 25031.47 25086.03 25126.61 25195.1 25295.87 25355.08 25425.45 25480.85 25541.08 25563.33 25592.9 25635.43 25726.19 25763.63 25803.03 25895.75 25937.53 25982.88 26070.9 26146.27 26236.24 26284.99 26330.61 26356.21 26446.84 26514.78 26593.23 26614.56 26637.98 26700.43 26783.38 26925.87 26984.39 27049.2 27178.32 27267.7 27355.34 27428.89 27571.27 27626.82 27714.48 27775.92 27818.63 25031.47 25086.03 25126.61 25195.1 25295.87 25355.08 25425.45 25480.85 25541.08 25563.33 25592.9 25635.43 25726.19 25763.63 25803.03 25895.75 25937.53 25982.88 26070.9 26146.27 26236.24 26284.99 26330.61 26356.21 26446.84 26514.78 26593.23 26614.56 26637.98 26700.43 26783.38 26925.87 26984.39 27049.2 27178.32 27267.7 27355.34 27428.89 27571.27 27626.82 27714.48 27775.92 27818.63 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1846 4420 3219 6822 8757 3639 2725 8914 6323 5032 2704 1795 3745 6090 10591 4372 3896 5618 8771 14572 3762 2811 6576 1889 2216 2453 1624 1634 3074 4754 9310 10902 6554 2465 5341 2959 1801 4500 1421 8003 10733 5430 2867 2.85 6.82 4.97 10.53 13.51 5.61 4.2 13.75 9.76 7.76 4.17 2.77 5.78 9.4 16.34 6.75 6.01 8.67 13.53 22.48 5.81 4.34 10.15 2.91 3.42 3.78 2.51 2.52 4.74 7.34 14.37 16.82 10.11 3.8 8.24 4.57 2.78 6.94 2.19 12.35 16.56 8.38 4.42 1846.33 4419.67 3219.23 6822.19 8756.78 3638.52 2724.83 8913.65 6323.14 5032.32 2704.09 1794.59 3745.12 6090.05 10590.75 4372.18 3896.29 5618.26 8771.44 14571.73 3762.49 2810.85 6576.21 1888.63 2215.63 2452.89 1624.24 1634.45 3073.71 4754.14 9309.99 10902.29 6553.92 2464.87 5340.91 2958.83 1801.17 4500.07 1421.45 8002.86 10732.9 5429.97 2866.75 20 MMP-2 protects the LDLR Corresponding author: Carlos Fernandez-Patron 549 550 551 552 553 554 555 556 557 558 559 560 561 562 563 564 565 566 567 568 569 570 571 572 573 574 575 576 577 578 579 580 581 582 583 584 585 586 587 588 589 590 591 27861.05649 27956.81379 28008.1579 28128.01869 28201.24689 28258.51642 28302.94237 28421.75163 28507.36111 28595.32925 28670.56048 28738.19225 28920.24827 29063.84993 29114.44798 29142.2189 29201.80191 29242.56173 29342.38615 29396.36982 29445.97801 29525.25288 29564.20877 29754.87248 29821.06824 29872.44101 29912.31254 29955.80609 30013.74777 30051.31483 30080.7517 30164.90623 30271.67163 30310.92822 30513.46524 30551.27696 30705.32005 30886.87384 31013.31856 31068.12606 31158.98293 31249.36289 31307.73948 27861.06 27956.81 28008.16 28128.02 28201.25 28258.52 28302.94 28421.75 28507.36 28595.33 28670.56 28738.19 28920.25 29063.85 29114.45 29142.22 29201.8 29242.56 29342.39 29396.37 29445.98 29525.25 29564.21 29754.87 29821.07 29872.44 29912.31 29955.81 30013.75 30051.31 30080.75 30164.91 30271.67 30310.93 30513.47 30551.28 30705.32 30886.87 31013.32 31068.13 31158.98 31249.36 31307.74 27861.06 27956.81 28008.16 28128.02 28201.25 28258.52 28302.94 28421.75 28507.36 28595.33 28670.56 28738.19 28920.25 29063.85 29114.45 29142.22 29201.8 29242.56 29342.39 29396.37 29445.98 29525.25 29564.21 29754.87 29821.07 29872.44 29912.31 29955.81 30013.75 30051.31 30080.75 30164.91 30271.67 30310.93 30513.47 30551.28 30705.32 30886.87 31013.32 31068.13 31158.98 31249.36 31307.74 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1889 9846 1959 4873 3291 3943 3292 6054 3333 5519 5645 2338 5247 5360 1619 1382 4093 5149 1890 4283 6019 6191 2269 7990 3553 7268 2794 5224 3333 2326 2375 4488 3564 4369 2981 4664 9299 6566 2798 2700 9286 3192 2434 2.91 15.19 3.02 7.52 5.08 6.08 5.08 9.34 5.14 8.52 8.71 3.61 8.1 8.27 2.5 2.13 6.32 7.94 2.92 6.61 9.29 9.55 3.5 12.33 5.48 11.21 4.31 8.06 5.14 3.59 3.66 6.93 5.5 6.74 4.6 7.2 14.35 10.13 4.32 4.17 14.33 4.92 3.76 1889.15 9846.29 1959.43 4873.09 3291.41 3943.39 3292.36 6054.38 3332.65 5519.48 5645.06 2338.17 5247.16 5360.05 1619.33 1382.41 4093.15 5148.84 1890.04 4282.53 6018.53 6191.13 2268.71 7990.34 3553.09 7268.22 2794.12 5224.24 3332.5 2326.23 2374.88 4488.06 3564.49 4369.46 2981.36 4664.23 9299.05 6566.13 2798.07 2700.05 9286.09 3191.81 2433.88 21 MMP-2 protects the LDLR Corresponding author: Carlos Fernandez-Patron 592 593 594 595 596 597 598 599 600 601 602 603 604 605 606 607 608 609 610 611 612 613 614 615 616 617 618 619 620 621 622 623 624 625 626 627 628 629 630 631 632 633 634 31376.77041 31502.30944 31611.64682 31881.0232 31975.47897 32023.92116 32069.92701 32136.02302 32210.9941 32445.44493 32493.69822 33007.61261 33100.0858 33174.80712 33375.28816 33428.82237 33469.37372 33511.31024 33608.33349 33675.7968 33737.4811 33793.19211 33859.0455 33897.34234 33975.1254 34175.35124 34299.78603 34358.32333 34422.18907 34456.70577 34639.11206 34751.38071 34834.45197 34983.60742 35046.67178 35094.35342 35142.75742 35290.80436 35351.18827 35460.59072 35708.49215 35914.55594 35972.99983 31376.77 31502.31 31611.65 31881.02 31975.48 32023.92 32069.93 32136.02 32210.99 32445.44 32493.7 33007.61 33100.09 33174.81 33375.29 33428.82 33469.37 33511.31 33608.33 33675.8 33737.48 33793.19 33859.05 33897.34 33975.13 34175.35 34299.79 34358.32 34422.19 34456.71 34639.11 34751.38 34834.45 34983.61 35046.67 35094.35 35142.76 35290.8 35351.19 35460.59 35708.49 35914.56 35973 31376.77 31502.31 31611.65 31881.02 31975.48 32023.92 32069.93 32136.02 32210.99 32445.44 32493.7 33007.61 33100.09 33174.81 33375.29 33428.82 33469.37 33511.31 33608.33 33675.8 33737.48 33793.19 33859.05 33897.34 33975.13 34175.35 34299.79 34358.32 34422.19 34456.71 34639.11 34751.38 34834.45 34983.61 35046.67 35094.35 35142.76 35290.8 35351.19 35460.59 35708.49 35914.56 35973 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1592 3156 1410 2689 4066 1618 7389 1783 1592 1635 1457 2147 10935 9432 8937 1427 2012 1359 2416 2835 4894 3147 1993 1537 3231 4390 2554 5900 2698 2460 9010 4553 5874 1467 2496 1909 5181 6062 3587 5111 14831 8577 5894 2.46 4.87 2.18 4.15 6.27 2.5 11.4 2.75 2.46 2.52 2.25 3.31 16.87 14.55 13.79 2.2 3.1 2.1 3.73 4.37 7.55 4.86 3.08 2.37 4.99 6.77 3.94 9.1 4.16 3.8 13.9 7.03 9.06 2.26 3.85 2.95 7.99 9.35 5.54 7.89 22.88 13.23 9.09 1591.55 3155.8 1410 2689.26 4066.23 1618.44 7388.77 1782.63 1592.06 1634.96 1456.75 2147.18 10934.86 9432.29 8937.4 1427.37 2012.14 1359.5 2415.99 2834.5 4894.33 3147.24 1993.13 1536.93 3231.32 4390.18 2553.6 5900.3 2698.15 2459.6 9009.84 4553.48 5873.97 1467.26 2495.57 1909.27 5180.54 6062.24 3587.3 5110.81 14830.7 8576.77 5894.28 22 MMP-2 protects the LDLR Corresponding author: Carlos Fernandez-Patron 635 636 637 638 639 640 641 642 643 644 645 646 647 648 649 650 651 652 653 654 655 656 657 658 659 660 661 662 663 664 665 666 667 668 669 670 671 672 673 674 675 676 677 36042.37377 36140.82609 36206.05385 36320.76758 36464.72184 36642.10152 36681.48541 36769.97813 36926.52166 37037.94299 37080.03141 37232.50747 37296.25979 37375.17496 37435.27686 37522.88338 37644.67772 37829.82572 37858.59383 37975.67727 38095.20547 38197.16801 38254.57181 38341.74101 38389.76921 38690.02268 39067.78354 39149.84695 39194.0269 39337.19351 39436.14578 39531.17694 39702.18774 39759.41904 39836.62159 39876.98401 39909.70242 40510.0649 40559.08437 40614.14025 40706.9323 40799.14666 41003.47782 36042.37 36140.83 36206.05 36320.77 36464.72 36642.1 36681.49 36769.98 36926.52 37037.94 37080.03 37232.51 37296.26 37375.17 37435.28 37522.88 37644.68 37829.83 37858.59 37975.68 38095.21 38197.17 38254.57 38341.74 38389.77 38690.02 39067.78 39149.85 39194.03 39337.19 39436.15 39531.18 39702.19 39759.42 39836.62 39876.98 39909.7 40510.06 40559.08 40614.14 40706.93 40799.15 41003.48 36042.37 36140.83 36206.05 36320.77 36464.72 36642.1 36681.49 36769.98 36926.52 37037.94 37080.03 37232.51 37296.26 37375.17 37435.28 37522.88 37644.68 37829.83 37858.59 37975.68 38095.21 38197.17 38254.57 38341.74 38389.77 38690.02 39067.78 39149.85 39194.03 39337.19 39436.15 39531.18 39702.19 39759.42 39836.62 39876.98 39909.7 40510.06 40559.08 40614.14 40706.93 40799.15 41003.48 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 2374 5698 2998 1723 3734 3200 4059 4046 4131 5263 5415 3109 4042 4653 3266 2162 5253 1686 5640 1701 5966 2765 6045 4229 3587 4406 2030 3559 2242 6347 3090 1460 1412 1308 1954 1951 2674 2231 2244 2624 2775 6113 4830 3.66 8.79 4.63 2.66 5.76 4.94 6.26 6.24 6.37 8.12 8.36 4.8 6.24 7.18 5.04 3.34 8.11 2.6 8.7 2.63 9.21 4.27 9.33 6.53 5.54 6.8 3.13 5.49 3.46 9.79 4.77 2.25 2.18 2.02 3.02 3.01 4.13 3.44 3.46 4.05 4.28 9.43 7.45 2374.44 5698.26 2998.28 1723.33 3733.59 3200.41 4058.66 4046.16 4130.53 5262.86 5415.39 3109.43 4041.76 4653.21 3265.58 2161.82 5253.32 1686.2 5640.43 1701.37 5966.06 2765.41 6044.7 4229.4 3587.27 4406.28 2029.95 3559.2 2241.93 6346.53 3089.7 1459.61 1411.99 1307.52 1954.08 1950.64 2674.48 2231.17 2243.55 2623.78 2775.32 6113.07 4829.8 23 MMP-2 protects the LDLR Corresponding author: Carlos Fernandez-Patron 678 679 680 681 682 683 684 685 686 687 688 689 690 691 692 693 694 695 696 697 698 699 700 701 702 703 704 705 706 707 708 709 710 711 712 713 714 715 716 717 718 719 720 41232.96778 41655.10395 41723.55763 41833.15847 42008.72677 42119.09451 42255.33484 42319.16187 42409.58335 42688.95085 42762.81713 42835.83747 42930.71946 43018.35188 43182.85891 43280.49622 43387.22131 43501.57677 43717.70731 43830.79639 43960.25532 44061.75802 44164.53555 44270.80551 44340.57618 44543.95857 44601.44579 44793.3086 44893.49616 44984.79607 45043.47346 45082.92726 45484.10152 45609.75765 45678.44941 45849.21891 46012.61234 46131.34752 46246.12009 46444.53529 46919.03101 46962.01345 47178.00546 41232.97 41655.1 41723.56 41833.16 42008.73 42119.09 42255.33 42319.16 42409.58 42688.95 42762.82 42835.84 42930.72 43018.35 43182.86 43280.5 43387.22 43501.58 43717.71 43830.8 43960.26 44061.76 44164.54 44270.81 44340.58 44543.96 44601.45 44793.31 44893.5 44984.8 45043.47 45082.93 45484.1 45609.76 45678.45 45849.22 46012.61 46131.35 46246.12 46444.54 46919.03 46962.01 47178.01 41232.97 41655.1 41723.56 41833.16 42008.73 42119.09 42255.33 42319.16 42409.58 42688.95 42762.82 42835.84 42930.72 43018.35 43182.86 43280.5 43387.22 43501.58 43717.71 43830.8 43960.26 44061.76 44164.54 44270.81 44340.58 44543.96 44601.45 44793.31 44893.5 44984.8 45043.47 45082.93 45484.1 45609.76 45678.45 45849.22 46012.61 46131.35 46246.12 46444.54 46919.03 46962.01 47178.01 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1813 3744 3279 1737 1380 1490 2439 2399 1376 5468 6246 2649 3889 3242 6759 3173 2190 1585 4602 4541 5717 4327 3500 2035 2379 3162 1870 9593 4478 4512 1515 1943 2344 2723 1748 1321 5874 2312 2182 2099 2460 3083 2044 2.8 5.78 5.06 2.68 2.13 2.3 3.76 3.7 2.12 8.44 9.64 4.09 6 5 10.43 4.9 3.38 2.45 7.1 7.01 8.82 6.68 5.4 3.14 3.67 4.88 2.88 14.8 6.91 6.96 2.34 3 3.62 4.2 2.7 2.04 9.06 3.57 3.37 3.24 3.8 4.76 3.15 1812.99 3743.64 3279.13 1737.28 1380.5 1489.69 2439.49 2399.21 1376.44 5468.14 6246.1 2649.03 3888.62 3241.87 6758.87 3173.1 2189.82 1584.59 4601.68 4541.07 5716.87 4327.31 3499.53 2034.99 2379.38 3162.41 1869.67 9592.78 4478.22 4512.02 1515.07 1943.1 2343.52 2722.67 1748.46 1321.23 5873.62 2312.47 2181.9 2098.9 2460.13 3082.68 2043.76 24 MMP-2 protects the LDLR Corresponding author: Carlos Fernandez-Patron 721 722 723 724 725 726 727 728 729 730 731 732 733 734 735 736 737 738 739 740 741 742 743 744 745 746 747 748 749 750 751 752 753 754 755 756 757 758 759 760 761 762 763 47451.56111 47671.98838 47749.6663 47807.14871 47890.91333 47941.24827 48005.33276 48111.31771 48241.70913 48403.82858 48473.76057 48773.25501 48920.44627 49062.07495 49385.01424 49558.99394 49756.26213 49973.91614 50281.29527 50395.99211 50967.47004 51092.11709 51158.52182 51282.21412 51412.90117 51516.70114 51830.17984 51941.66576 51998.24379 52423.71642 52481.45377 52551.27447 52619.56169 52781.64693 52972.70642 53078.62571 53445.89677 53678.15797 53900.97965 54168.51812 54347.26544 54497.48678 54591.43596 47451.56 47671.99 47749.67 47807.15 47890.91 47941.25 48005.33 48111.32 48241.71 48403.83 48473.76 48773.26 48920.45 49062.07 49385.01 49558.99 49756.26 49973.92 50281.3 50395.99 50967.47 51092.12 51158.52 51282.21 51412.9 51516.7 51830.18 51941.67 51998.24 52423.72 52481.45 52551.27 52619.56 52781.65 52972.71 53078.63 53445.9 53678.16 53900.98 54168.52 54347.27 54497.49 54591.44 47451.56 47671.99 47749.67 47807.15 47890.91 47941.25 48005.33 48111.32 48241.71 48403.83 48473.76 48773.26 48920.45 49062.07 49385.01 49558.99 49756.26 49973.92 50281.3 50395.99 50967.47 51092.12 51158.52 51282.21 51412.9 51516.7 51830.18 51941.67 51998.24 52423.72 52481.45 52551.27 52619.56 52781.65 52972.71 53078.63 53445.9 53678.16 53900.98 54168.52 54347.27 54497.49 54591.44 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 3907 1423 1574 3052 3103 2266 3910 3331 4081 1403 1527 1772 2140 2664 2832 1341 9794 3809 3871 1456 12639 3784 4669 2269 4473 1880 2170 3240 1858 1497 2030 1652 1469 3091 6033 7743 5198 5060 1453 4215 6261 5135 1383 6.03 2.2 2.43 4.71 4.79 3.5 6.03 5.14 6.3 2.17 2.36 2.73 3.3 4.11 4.37 2.07 15.11 5.88 5.97 2.25 19.5 5.84 7.2 3.5 6.9 2.9 3.35 5 2.87 2.31 3.13 2.55 2.27 4.77 9.31 11.95 8.02 7.81 2.24 6.5 9.66 7.92 2.13 3906.65 1423.06 1573.58 3051.7 3103 2265.99 3910.04 3331.47 4080.95 1403.22 1526.86 1771.62 2139.82 2663.63 2832.24 1340.88 9793.95 3809.49 3870.59 1455.61 12639.47 3783.69 4668.55 2268.67 4472.67 1880.46 2170.02 3239.57 1858.21 1497.48 2030.13 1651.63 1469.16 3091.31 6033.24 7743.07 5198.27 5060.4 1452.88 4215.21 6260.61 5134.56 1382.74 25 MMP-2 protects the LDLR Corresponding author: Carlos Fernandez-Patron 764 765 766 767 768 769 770 771 772 773 774 775 776 777 778 779 780 781 782 783 784 785 786 787 788 789 790 791 792 793 794 795 796 797 798 799 800 801 802 803 804 805 806 54659.94021 54835.25796 54978.90794 55793.47439 56041.51953 56123.37365 56208.83622 56270.25218 56570.15692 56728.34318 56794.62227 56870.608 57192.49641 57433.06708 57521.29214 57580.50105 57652.4281 58094.37879 58205.86596 58392.86644 58484.386 59102.21303 59362.90422 59521.83187 59657.81009 59800.50507 59949.00443 60097.73147 60306.21352 60476.98435 61121.03081 61208.27375 61363.27474 61762.28254 61832.00061 61938.19001 62125.9876 62390.87375 62482.12866 62819.68904 63157.64433 63348.9405 63465.45953 54659.94 54835.26 54978.91 55793.47 56041.52 56123.37 56208.84 56270.25 56570.16 56728.34 56794.62 56870.61 57192.5 57433.07 57521.29 57580.5 57652.43 58094.38 58205.87 58392.87 58484.39 59102.21 59362.9 59521.83 59657.81 59800.51 59949 60097.73 60306.21 60476.98 61121.03 61208.27 61363.27 61762.28 61832 61938.19 62125.99 62390.87 62482.13 62819.69 63157.64 63348.94 63465.46 54659.94 54835.26 54978.91 55793.47 56041.52 56123.37 56208.84 56270.25 56570.16 56728.34 56794.62 56870.61 57192.5 57433.07 57521.29 57580.5 57652.43 58094.38 58205.87 58392.87 58484.39 59102.21 59362.9 59521.83 59657.81 59800.51 59949 60097.73 60306.21 60476.98 61121.03 61208.27 61363.27 61762.28 61832 61938.19 62125.99 62390.87 62482.13 62819.69 63157.64 63348.94 63465.46 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 2441 3752 2631 4091 1693 1738 2426 4212 1667 1966 1442 1831 1952 5287 3805 3014 1780 3550 3601 3843 2433 1979 1363 2039 2859 3550 2498 5420 1635 1777 5417 2952 2730 2519 1731 2743 3569 2500 2496 1414 4827 5090 5770 3.77 5.79 4.06 6.31 2.61 2.68 3.74 6.5 2.57 3.03 2.23 2.83 3.01 8.16 5.87 4.65 2.75 5.48 5.56 5.93 3.75 3.05 2.1 3.15 4.41 5.48 3.85 8.36 2.52 2.74 8.36 4.55 4.21 3.89 2.67 4.23 5.51 3.86 3.85 2.18 7.45 7.85 8.9 2440.87 3751.56 2630.96 4091.21 1693.22 1737.73 2425.71 4211.76 1666.58 1965.75 1442.08 1830.93 1952.11 5286.66 3805.08 3014.3 1779.9 3550.33 3601.11 3842.58 2433.19 1978.98 1362.53 2039 2859.37 3549.86 2497.94 5419.8 1635.04 1776.56 5417.06 2951.79 2730.19 2518.96 1731.33 2742.53 3568.83 2500.13 2495.58 1413.82 4827.2 5089.65 5769.73 26 MMP-2 protects the LDLR Corresponding author: Carlos Fernandez-Patron 807 808 809 810 811 812 813 814 815 816 817 818 819 820 821 822 823 824 825 826 827 828 829 830 831 832 833 834 835 836 837 838 839 840 841 842 843 844 845 846 847 848 849 63618.57218 63683.07454 64308.42071 64435.76685 64529.10799 64645.741 64747.40754 65007.84687 65535.49225 65675.20315 65783.02988 65837.81529 66384.24306 66545.02746 66632.83092 66755.75405 66865.48561 67311.20735 67619.03043 67853.28343 68015.49426 68235.06356 68339.12024 68498.31135 69204.62282 69269.14803 69400.4874 69492.91266 69929.39744 70222.10609 70523.8375 71792.01668 72457.99029 72707.23263 72810.4406 72966.22091 73275.44302 73473.75172 73583.45823 74035.1818 74283.23887 74454.94352 74721.11929 63618.57 63683.07 64308.42 64435.77 64529.11 64645.74 64747.41 65007.85 65535.49 65675.2 65783.03 65837.82 66384.24 66545.03 66632.83 66755.75 66865.49 67311.21 67619.03 67853.28 68015.49 68235.06 68339.12 68498.31 69204.62 69269.15 69400.49 69492.91 69929.4 70222.11 70523.84 71792.02 72457.99 72707.23 72810.44 72966.22 73275.44 73473.75 73583.46 74035.18 74283.24 74454.94 74721.12 63618.57 63683.07 64308.42 64435.77 64529.11 64645.74 64747.41 65007.85 65535.49 65675.2 65783.03 65837.82 66384.24 66545.03 66632.83 66755.75 66865.49 67311.21 67619.03 67853.28 68015.49 68235.06 68339.12 68498.31 69204.62 69269.15 69400.49 69492.91 69929.4 70222.11 70523.84 71792.02 72457.99 72707.23 72810.44 72966.22 73275.44 73473.75 73583.46 74035.18 74283.24 74454.94 74721.12 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4444 2588 4065 1724 2844 2633 1658 1509 3562 4030 1867 2015 4262 1406 2504 1300 5444 5958 4224 2389 7138 5465 1983 4766 1853 7114 7804 4124 7460 5451 4276 2201 2422 2401 4340 4351 1503 1968 2644 2638 4046 2874 3000 6.86 3.99 6.27 2.66 4.39 4.06 2.56 2.33 5.5 6.22 2.88 3.11 6.58 2.17 3.86 2.01 8.4 9.19 6.52 3.69 11.01 8.43 3.06 7.35 2.86 10.98 12.04 6.36 11.51 8.41 6.6 3.4 3.74 3.71 6.7 6.71 2.32 3.04 4.08 4.07 6.24 4.43 4.63 4444.28 2587.91 4065.04 1723.59 2843.67 2633.39 1658.09 1509.09 3561.56 4029.88 1867.28 2015.16 4262.24 1405.84 2504.23 1300.15 5444.05 5957.7 4224.06 2389.12 7137.63 5464.84 1982.82 4765.68 1853.49 7113.84 7804.08 4124.04 7460.47 5451.02 4275.51 2201.36 2422.25 2401.24 4339.94 4351.28 1502.99 1968.18 2644.17 2637.82 4046.41 2873.64 3000.16 27 MMP-2 protects the LDLR Corresponding author: Carlos Fernandez-Patron 850 851 852 853 854 855 856 857 858 859 860 861 862 863 864 865 866 867 868 869 870 871 872 873 874 875 876 877 878 879 880 881 882 883 884 885 886 887 888 889 890 891 892 74849.8156 75025.54993 75106.95684 75148.0919 76038.72114 76178.39876 76468.16234 76738.71238 76950.85487 77599.41911 78321.7697 79142.25898 79575.8237 79949.64691 81182.96853 81287.77023 81463.68709 81568.37468 82591.20039 82878.25295 83103.06701 83289.10812 83444.3822 83764.96681 84244.83881 85044.61264 85440.86963 85602.32305 85761.11307 85874.29718 86126.0953 86466.16713 87408.01648 87586.29232 87917.53258 87999.42745 88064.43076 88452.1409 88791.27734 89088.75493 90137.91512 90420.12323 90590.06627 74849.82 75025.55 75106.96 75148.09 76038.72 76178.4 76468.16 76738.71 76950.85 77599.42 78321.77 79142.26 79575.82 79949.65 81182.97 81287.77 81463.69 81568.37 82591.2 82878.25 83103.07 83289.11 83444.38 83764.97 84244.84 85044.61 85440.87 85602.32 85761.11 85874.3 86126.1 86466.17 87408.02 87586.29 87917.53 87999.43 88064.43 88452.14 88791.28 89088.75 90137.92 90420.12 90590.07 74849.82 75025.55 75106.96 75148.09 76038.72 76178.4 76468.16 76738.71 76950.85 77599.42 78321.77 79142.26 79575.82 79949.65 81182.97 81287.77 81463.69 81568.37 82591.2 82878.25 83103.07 83289.11 83444.38 83764.97 84244.84 85044.61 85440.87 85602.32 85761.11 85874.3 86126.1 86466.17 87408.02 87586.29 87917.53 87999.43 88064.43 88452.14 88791.28 89088.75 90137.92 90420.12 90590.07 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 2750 2613 2715 1689 1528 4274 7260 2692 1831 1546 4463 1385 1927 2382 1703 1944 1808 1631 2669 1765 1644 1792 5580 2588 1846 3371 2250 3656 3651 2577 1716 1552 1363 2770 2275 1542 1792 4539 3574 2440 4071 3672 2418 4.24 4.03 4.19 2.61 2.36 6.59 11.2 4.15 2.83 2.39 6.89 2.14 2.97 3.68 2.63 3 2.79 2.52 4.12 2.72 2.54 2.76 8.61 3.99 2.85 5.2 3.47 5.64 5.63 3.98 2.65 2.39 2.1 4.27 3.51 2.38 2.77 7 5.52 3.77 6.28 5.67 3.73 2749.91 2612.74 2714.59 1688.65 1528.37 4273.72 7259.78 2691.68 1831.41 1546.4 4462.57 1385.1 1927.31 2382.1 1702.72 1944.44 1807.77 1630.65 2668.82 1765.43 1643.82 1791.58 5580.24 2588.46 1845.89 3371.47 2249.68 3656.38 3650.54 2577.17 1716.11 1551.9 1363.35 2770.37 2275.27 1542.36 1792.07 4538.51 3574.28 2440.15 4070.51 3671.98 2418.26 28 MMP-2 protects the LDLR Corresponding author: Carlos Fernandez-Patron 893 894 895 896 897 898 899 900 901 902 903 904 905 906 907 908 909 910 911 912 913 914 915 916 917 918 919 920 921 922 91145.21031 91297.90072 91585.59417 92286.32007 92878.52177 93055.74872 93207.0997 93406.03164 93646.70281 94244.13615 94495.34991 95122.7597 95424.44269 95594.21604 95816.35819 96609.58053 97223.78409 97468.31429 97681.16997 97902.54238 98030.92996 98416.60581 98626.52081 98792.64708 98859.20509 99152.7477 99359.00965 99463.42371 99774.5923 99931.407 91145.21 91297.9 91585.59 92286.32 92878.52 93055.75 93207.1 93406.03 93646.7 94244.14 94495.35 95122.76 95424.44 95594.22 95816.36 96609.58 97223.78 97468.31 97681.17 97902.54 98030.93 98416.61 98626.52 98792.65 98859.21 99152.75 99359.01 99463.42 99774.59 99931.41 91145.21 91297.9 91585.59 92286.32 92878.52 93055.75 93207.1 93406.03 93646.7 94244.14 94495.35 95122.76 95424.44 95594.22 95816.36 96609.58 97223.78 97468.31 97681.17 97902.54 98030.93 98416.61 98626.52 98792.65 98859.21 99152.75 99359.01 99463.42 99774.59 99931.41 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 2989 3355 5808 1688 1875 1325 1426 1792 2906 4799 2792 7186 2662 1585 3060 4206 24898 3155 1326 2058 2698 2195 4984 2012 3521 2012 2240 2423 1920 2058 4.61 5.18 8.96 2.6 2.89 2.04 2.2 2.77 4.48 7.41 4.31 11.09 4.11 2.45 4.72 6.49 38.42 4.87 2.05 3.17 4.16 3.39 7.69 3.1 5.43 3.1 3.46 3.74 2.96 3.17 2989.21 3354.51 5808.08 1687.98 1874.57 1325.16 1425.99 1792.42 2906.3 4799.23 2791.68 7186.03 2661.64 1584.96 3060.23 4205.57 24898.06 3154.96 1326 2057.58 2697.72 2194.75 4983.92 2011.86 3520.75 2011.86 2240.48 2423.37 1920.41 2057.58 Index Centroid Mass Lower Bound Upper Bound Charge (z) Height Relative intensity Area 1 2 3 4 5 525.63906 530.88114 532.57291 534.81387 537.76009 525.64 530.88 532.57 534.81 537.76 525.64 530.88 532.57 534.81 537.76 0 0 0 0 0 7320 9980 8055 8280 13947 2.25 3.07 2.47 2.54 4.28 7320.39 9980.14 8055.4 8279.82 13947.32 29 MMP-2 protects the LDLR Corresponding author: Carlos Fernandez-Patron 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 539.71697 542.89528 543.74455 544.95373 547.66619 548.8223 550.9401 551.65639 552.00071 552.83419 554.3509 558.84676 559.78257 561.63873 562.68592 563.75125 565.78262 566.58949 569.6768 571.56219 573.45516 574.77953 576.94726 580.70903 581.92034 584.54447 587.05032 588.14221 588.86656 591.74872 592.59573 597.78782 599.93287 602.88555 604.84526 610.66984 611.90955 613.74049 619.90039 622.55384 624.87267 625.93732 630.87007 539.72 542.9 543.74 544.95 547.67 548.82 550.94 551.66 552 552.83 554.35 558.85 559.78 561.64 562.69 563.75 565.78 566.59 569.68 571.56 573.46 574.78 576.95 580.71 581.92 584.54 587.05 588.14 588.87 591.75 592.6 597.79 599.93 602.89 604.85 610.67 611.91 613.74 619.9 622.55 624.87 625.94 630.87 539.72 542.9 543.74 544.95 547.67 548.82 550.94 551.66 552 552.83 554.35 558.85 559.78 561.64 562.69 563.75 565.78 566.59 569.68 571.56 573.46 574.78 576.95 580.71 581.92 584.54 587.05 588.14 588.87 591.75 592.6 597.79 599.93 602.89 604.85 610.67 611.91 613.74 619.9 622.55 624.87 625.94 630.87 0 0 0 0 1 1 1 0 1 0 0 1 1 1 1 1 0 0 0 0 0 0 0 0 0 0 1 1 0 0 0 0 0 0 0 0 0 0 0 0 1 1 0 8757 11137 8340 10226 19319 8897 8547 7710 7116 10843 14567 12851 9727 19382 22673 7835 7150 13191 35661 19639 7575 11808 17665 16465 21328 7066 8054 6704 7448 14493 10314 11192 8493 7089 7404 10346 15136 25351 7756 17890 10073 6864 7025 2.69 3.42 2.56 3.14 5.93 2.73 2.63 2.37 2.19 3.33 4.47 3.95 2.99 5.95 6.96 2.41 2.2 4.05 10.95 6.03 2.33 3.63 5.43 5.06 6.55 2.17 2.47 2.06 2.29 4.45 3.17 3.44 2.61 2.18 2.27 3.18 4.65 7.79 2.38 5.49 3.09 2.11 2.16 8757.08 11137.08 8339.97 10225.69 19318.53 8896.57 8547.12 7710.37 7115.6 10843.21 14567.06 12851.13 9727.19 19382.24 22672.8 7835.48 7149.9 13190.67 35661.34 19638.53 7575.33 11807.76 17664.68 16465.03 21328.47 7065.98 8053.72 6703.99 7448.39 14492.88 10314.36 11192.4 8492.96 7089.16 7404.42 10346.1 15136.01 25351.35 7755.52 17890.45 10073.27 6864.42 7024.91 30 MMP-2 protects the LDLR Corresponding author: Carlos Fernandez-Patron 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 633.78435 643.95509 645.33796 646.81164 649.97874 651.67735 653.50552 654.09033 656.91784 657.59333 658.54209 660.93141 664.64014 667.84091 670.93919 672.49318 673.85236 675.85254 676.70389 677.76877 678.82085 684.8594 686.14007 689.75358 699.68648 700.92858 708.86951 726.75154 729.01643 731.90104 733.98172 743.67292 746.62722 749.2144 760.93497 778.58799 780.11427 783.07656 786.17914 791.83369 793.65317 799.81981 803.95668 633.78 643.96 645.34 646.81 649.98 651.68 653.51 654.09 656.92 657.59 658.54 660.93 664.64 667.84 670.94 672.49 673.85 675.85 676.7 677.77 678.82 684.86 686.14 689.75 699.69 700.93 708.87 726.75 729.02 731.9 733.98 743.67 746.63 749.21 760.93 778.59 780.11 783.08 786.18 791.83 793.65 799.82 803.96 633.78 643.96 645.34 646.81 649.98 651.68 653.51 654.09 656.92 657.59 658.54 660.93 664.64 667.84 670.94 672.49 673.85 675.85 676.7 677.77 678.82 684.86 686.14 689.75 699.69 700.93 708.87 726.75 729.02 731.9 733.98 743.67 746.63 749.21 760.93 778.59 780.11 783.08 786.18 791.83 793.65 799.82 803.96 0 0 0 0 0 0 0 0 0 1 1 0 0 0 0 0 0 0 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11907 12215 7923 8140 10764 325602 19447 20988 7835 127244 16075 16880 7639 70780 7780 8608 40951 12172 8615 12703 15936 14365 11579 16208 9363 7432 10893 6812 19828 12904 7656 8612 8126 9949 6622 7431 8757 11437 7548 7641 7355 6914 8626 3.66 3.75 2.43 2.5 3.31 100 5.97 6.45 2.41 39.08 4.94 5.18 2.35 21.74 2.39 2.64 12.58 3.74 2.65 3.9 4.89 4.41 3.56 4.98 2.88 2.28 3.35 2.09 6.09 3.96 2.35 2.64 2.5 3.06 2.03 2.28 2.69 3.51 2.32 2.35 2.26 2.12 2.65 11906.7 12215.5 7922.53 8140.45 10764.19 325601.69 19446.86 20988.07 7835.12 127244.15 16074.94 16879.61 7638.71 70780.01 7779.69 8607.76 40950.68 12171.85 8615.31 12703.38 15935.57 14365.24 11578.58 16207.53 9363.09 7431.61 10892.7 6811.5 19828.36 12904.28 7655.74 8611.55 8125.83 9949.26 6621.89 7430.96 8757.25 11436.62 7548.08 7640.68 7355.38 6913.6 8625.52 31 MMP-2 protects the LDLR Corresponding author: Carlos Fernandez-Patron 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 818.95419 855.3258 856.9775 862.71885 864.55013 866.50313 868.4639 878.04006 878.87642 883.61808 885.49115 887.51882 891.11193 898.99899 914.88621 924.43488 934.23027 942.03926 944.74341 946.6284 953.14296 957.25759 960.04869 979.33159 980.22612 999.87652 1011.91622 1024.42436 1048.34962 1065.83554 1067.90023 1073.76855 1074.71465 1079.61203 1091.33902 1093.75608 1103.08826 1223.4262 1224.25865 1267.49881 1268.3317 1275.19299 1284.22659 818.95 855.33 856.98 862.72 864.55 866.5 868.46 878.04 878.88 883.62 885.49 887.52 891.11 899 914.89 924.43 934.23 942.04 944.74 946.63 953.14 957.26 960.05 979.33 980.23 999.88 1011.92 1024.42 1048.35 1065.84 1067.9 1073.77 1074.71 1079.61 1091.34 1093.76 1103.09 1223.43 1224.26 1267.5 1268.33 1275.19 1284.23 818.95 855.33 856.98 862.72 864.55 866.5 868.46 878.04 878.88 883.62 885.49 887.52 891.11 899 914.89 924.43 934.23 942.04 944.74 946.63 953.14 957.26 960.05 979.33 980.23 999.88 1011.92 1024.42 1048.35 1065.84 1067.9 1073.77 1074.71 1079.61 1091.34 1093.76 1103.09 1223.43 1224.26 1267.5 1268.33 1275.19 1284.23 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 1 0 0 0 0 0 0 1 1 0 0 0 0 0 0 0 0 0 0 6876 7945 32332 223342 59784 11657 13803 7003 19973 9483 10180 7187 8554 8347 8656 6572 6629 7320 8422 8649 8337 105323 10278 26204 7066 9146 8913 8918 18195 10660 12541 22252 31755 15154 6901 9397 7345 9511 7111 8410 13042 8650 10261 2.11 2.44 9.93 68.59 18.36 3.58 4.24 2.15 6.13 2.91 3.13 2.21 2.63 2.56 2.66 2.02 2.04 2.25 2.59 2.66 2.56 32.35 3.16 8.05 2.17 2.81 2.74 2.74 5.59 3.27 3.85 6.83 9.75 4.65 2.12 2.89 2.26 2.92 2.18 2.58 4.01 2.66 3.15 6875.91 7945.5 32332.16 223342.02 59783.59 11656.74 13803.33 7002.68 19972.76 9482.8 10180.29 7186.98 8554.2 8347.1 8655.58 6571.64 6628.88 7319.65 8422.15 8648.69 8336.63 105323.37 10277.89 26204.21 7066.34 9146.25 8913.4 8917.65 18194.96 10659.67 12541.48 22251.77 31755.2 15154.22 6901.37 9397.29 7344.77 9511.29 7111.07 8409.53 13042.49 8649.58 10260.69 32 MMP-2 protects the LDLR Corresponding author: Carlos Fernandez-Patron 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 1311.44418 1319.17387 1349.90553 1355.55102 1364.15229 1399.57519 1400.77101 1443.48131 1487.59763 1531.59773 1534.34639 1575.62672 1576.75029 1620.54363 1663.87705 1671.69195 1690.44042 1694.3402 1708.66937 1712.4299 1752.35717 1821.44139 2029.64052 2034.48121 2050.4504 2053.11788 2177.53383 2404.74245 2426.40995 2435.377 2573.1001 2590.26601 2611.65718 3827.38766 5270.20392 5600.47507 6044.72257 6789.03196 7851.36002 1311.44 1319.17 1349.91 1355.55 1364.15 1399.58 1400.77 1443.48 1487.6 1531.6 1534.35 1575.63 1576.75 1620.54 1663.88 1671.69 1690.44 1694.34 1708.67 1712.43 1752.36 1821.44 2029.64 2034.48 2050.45 2053.12 2177.53 2404.74 2426.41 2435.38 2573.1 2590.27 2611.66 3827.39 5270.2 5600.48 6044.72 6789.03 7851.36 1311.44 1319.17 1349.91 1355.55 1364.15 1399.58 1400.77 1443.48 1487.6 1531.6 1534.35 1575.63 1576.75 1620.54 1663.88 1671.69 1690.44 1694.34 1708.67 1712.43 1752.36 1821.44 2029.64 2034.48 2050.45 2053.12 2177.53 2404.74 2426.41 2435.38 2573.1 2590.27 2611.66 3827.39 5270.2 5600.48 6044.72 6789.03 7851.36 0 0 0 0 0 0 0 0 0 0 0 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 17922 7454 6597 14377 8745 9570 19417 24364 9485 7055 8982 6598 7813 7169 10167 7392 21357 7879 9533 13937 12890 6783 19279 19320 11604 7646 6989 57444 8782 14350 9225 152988 52959 7488 11444 14840 62486 10679 13035 5.5 2.29 2.03 4.42 2.69 2.94 5.96 7.48 2.91 2.17 2.76 2.03 2.4 2.2 3.12 2.27 6.56 2.42 2.93 4.28 3.96 2.08 5.92 5.93 3.56 2.35 2.15 17.64 2.7 4.41 2.83 46.99 16.27 2.3 3.51 4.56 19.19 3.28 4 17922.12 7454.15 6597.07 14377.3 8744.76 9569.71 19416.76 24363.57 9485.01 7054.92 8981.76 6597.66 7812.51 7169.34 10167.07 7392.41 21356.71 7878.85 9533.2 13937.19 12889.88 6782.63 19279.33 19319.56 11603.51 7645.58 6989.14 57444.48 8782.19 14350.36 9224.79 152988.02 52959.23 7488.36 11443.91 14839.64 62486.47 10678.88 13034.68 33