1 Some mRNA (or DNA if replace U with T) cacgccugcaggucgacucuagaggauccccggguaccggucgccaccauggugagcaag ggcgaggagcuguucaccgggguggugcccauccuggucgagcuggacggcgacguaaac ggccacaaguucagcguguccggcgagggcgagggcgaugccaccuacggcaagcugacc cugaaguucaucugcaccaccggcaagcugcccgugcccuggcccacccucgugaccacc cugaccuacggcgugcagugcuucagccgcuaccccgaccacaugaagcagcacgacuuc uucaaguccgccaugcccgaaggcuacguccaggagcgcaccaucuucuucaaggacgac ggcaacuacaagacccgcgccgaggugaaguucgagggcgacacccuggugaaccgcauc gagcugaagggcaucgacuucaaggaggacggcaacauccuggggcacaagcuggaguac aacuacaacagccacaacgucuauaucauggccgacaagcagaagaacggcaucaaggug aacuucaagauccgccacaacaucgaggacggcagcgugcagcucgccgaccacuaccag cagaacacccccaucggcgacggccccgugcugcugcccgacaaccacuaccugagcacc caguccgcccugagcaaagaccccaacgagaagcgcgaucacaugguccugcuggaguuc gugaccgccgccgggaucacucucggcauggacgagcuguacaaguaaagcggccgcgac which contains the gene for this protein MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTY GVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKED GNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHY LSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK Where does the protein start in the mRNA? Where does it end? http://arbl.cvmbs.colostate.edu/molkit/index.html 2 • Here is a tool for translation of DNA into protein. This one is nice because it gives a graphical output that can be quickly interpreted. • http://arbl.cvmbs.colostate.edu/molkit/index.html • Paste your DNA or RNA sequence into the box. http://arbl.cvmbs.colostate.edu/molkit/index.html 3 • Here is the output for the DNA sequence provided earlier. • There are 6 reading frames, the 3 forward and 3 reverse frames. Which one looks like the most reasonable sequence, given that this sequence is supposed to encode a protein? • Little green lines represent start codons, while little purple lines represent stop codons. • A line that is littered in purple probably does not encode a protein (e.g. reverse #3). Forward frame #2 could, in principle, encode one very small peptide. A line with no green dashes can not be a protein since there is no ‘start’ signal (e.g. forward #3). • • The correct reading frame is frame #1. Extra green dashes are okay, these simply represent methionine residues in the protein. www.expasy.org (rerouted to ca.expasy.org) • 4 The ExPASy translate tool is generally more useful than the previous one if the actual sequence of the protein is desired. http://ca.expasy.org/tools/dna.html Verbose/compact/include nucleotide 5 http://ca.expasy.org/tools/dna.html 6 • The results of translation were obtained in the ‘compact’ mode • The graphical results and the detailed sequence results present exactly the same information, just in a different format. For example, anywhere that there is a green dash in the figure, there should be an ‘M’ in the sequence http://ca.expasy.org/tools/dna.html 7 •Include nucleotide give 3 forward and 3 reverse translations •Only 2 translations are shown: • This is the ‘include nucleotide’ mode. Generally speaking, this mode is the most useful for molecular biology applications.