Recombinant Enzyme Product Specification Sheet Cat. No.: PRO-E0075 LOT: 2008-0075 Activity: Phosphatase Synonyms: - Nomenclature: HAD5, YjjG, b4374, JW4336 Source organism: Escherichia coli K-12 (MG1655) Enzyme Commission No.: 3.1.3.- Activity: - Specific activity: - Purity: - Form and storage: - pH optimum: - Temperature optimum: - [Protein]: - Sequence length: 225 amino acids (view sequence) Accession No.: P0A8Y1 Molecular weight: 27463.9 Da (theoretical) - (observed by SDS-PAGE) - (observed by mass spectrometry) NOTE: this product is currently under development. If you wish to prioritise the production of this or any other enzyme/protein under development, please follow this link. Biological function: Catalyses the dephosphorylation of pNP-phosphate, acetylphosphate, carbamoyl-phosphate, imido-diphosphate and various natural nucleotide (and other) phosphates, most notably UMP, but also (in order of increasing specific activity): dAMP, 6phosphogluconate, AMP, dGMP, GMP, UDP, IMP, TDP, dUMP and dTMP. Major applications: Research Comments: Belongs to the HAD-like hydrolase superfamily Usage: - Assay: - Primary sequence: MKWDWIFFDADETLFTFDSFTGLQRMFLDYSVTFTAEDFQDYQAVNKPLWVDYQNGAITSLQLQHGRFES WAERLNVEPGKLNEAFINAMAEICTPLPGAVSLLNAIRGNAKIGIITNGFSALQQVRLERTGLRDYFDLL VISEEVGVAKPNKKIFDYALEQAGNPDRSRVLMVGDTAESDILGGINAGLATCWLNAHHREQPEGIAPTW TVSSLHELEQLLCKH Literature: 1. Kuznetsova et al. (2006) J. Biol. Chem. 281, 36149-36161.