Ladda ner hela produktkatalogen för 2014 (pdf 9,5

advertisement
2014
t
i
.
.. oves!
m
ti Warrant
y
ran
aranti Wa
r
•G
TEE
AN
GUAR
years
arranty • Ga
iW
Tel/phone: +46 (0)477-549 90
ALLA PRODUKTER PÅ LAGER!
1
ordermail: [email protected]
5
ALL PRODUCTS IN STOCK!
• Garan
nty
t
ra
...it oves!
m
ÅTERFÖRSÄLJARE: ERGOFF MILJÖ AB
Hållnäsgatan 5
752 28 Uppsala
T 018-18 68 80
E [email protected]
I www.ergoff.se
INNEHÅLL - CONTENT
Lätta vagnar metall/trä
Light Trolleys Metal/Wood
5-13
Lätta vagnar metall/plast
Light Trolleys Metal/Plastic
14-15
Avfallsvagnar
Waste Trolleys
101-106
16-25
Kärror
Trucks
107-116
Platåvagnar
Platform Trolleys
26-28
Kontor/konferens
Office/Conference
117-120
Rostfria vagnar
Stainless Steel Trolleys
29-34
Torkvagnar
Drying Trolleys
121-124
Flexibla hyllvagnar
Flexible Shelf Trolleys
35-40
Byggvagnar
ConstructionTrolleys
125-131
Trådvagnar
Net/Mesh Trolleys
41-47
Konga Moving System
132-134
Tunga vagnar
Heavy Duty Trolleys
48-69
Konga Mover
135-136
Stora vagnar
Large Material Trolleys
70-73
ESD vagnar
ESD Trolleys
137-141
Pallvagnar
Pallet Trucks
74-78
Spridarvagnar
Spreaders
142-143
79-89
Hjul
Wheels
144-148
m
Tel/phone: +46 (0)477-549 90
95-100
Special
Special
aranti Wa
r
•G
TEE
AN
GUAR
• Garan
nty
t
ra
2
Pallramar/trådburar
PalletFrames/PalletContainers90-94
...it oves!
ti Warrant
y
ran
Rullconatiners
RollContainers
rs
ordermail:försäljningsvillkor/General
[email protected]
Allmänna
5yea Sales Condition
arranty • Ga
iW
Lätta vagnar metall
Light Trolleys/Metal
Brick och backvagnar
Tray and Bin Trolleys
149-150
151
ÅTERFÖRSÄLJARE: ERGOFF MILJÖ AB
Hållnäsgatan 5
752 28 Uppsala
T 018-18 68 80
E [email protected]
I www.ergoff.se
ÅTERFÖRSÄLJARE: ERGOFF MILJÖ AB
Hållnäsgatan 5
752 28 Uppsala
T 018-18 68 80
E [email protected]
I www.ergoff.se
ALLA PRODUKTER PÅ LAGER!
ALL PRODUCTS IN STOCK!
Våra lätta vagnar i metall/trä är en serie snygga funktionella vagnar som har många
användningsområden.
Vagnarna är utformade för att klara olika påfrestningar och har till exempel hyllplan i metall
eller olika träslag. Ytbehandlingarna är också anpassade för att du som kund ska kunna hitta
det som passar dig och det användningsområde du tänkt dig.
Light Trolleys metal/wood are functional and good looking for many different uses.
The Trolleys have a design that should suit different strains and they are equipped with for
example shelves in metal or different woods. That means that you as a customer can find the
trolley that suits you and the functionality that you need.
T 018-18 68 80
E [email protected]
I www.ergoff.se
aranti Wa
r
•G
ANTEE
GUAR
5
• Garan
nty
t
ra
ti Warrant
y
ran
ÅTERFÖRSÄLJARE: ERGOFF MILJÖ AB
Hållnäsgatan 5
752 28 Uppsala
years
arranty • Ga
iW
Symbolen/The symbol = Denna produkt
levereras i platt paket/This product will be
deliveredinflatpack
5-års garanti på alla våra vagnar/
5 years warranty for all of our Trolleys
2 bromsade hjul/2 wheels with
brakes EN 1757-3
Lätta vagnar metall/trä
Light Trolleys Metal/Wood
5-13
5
X2005 SERVERINGSVAGN/SERVICE TROLLEY
ART.NR.
Ram
Frame
Skiva
Top
L x B x H (mm)
L x B x H (mm)
Vikt (kg)
Weight
X2005
X2005-B
Vit/White
Blå/Blue
Vit/White
Vit/White
760 x 520 x 900
760 x 520 x 900
19
19
TILLBEHÖR/ACCESSORIES
ART.NR.
Färg
Colour
L x B x H (mm) Vikt (kg)
LxBxH(mm) Weight
X2005-L
Vit/White 420 x 260 x 105
*Låda/Box
•
•
•
•
•
Pulverlackeradmedhyllplanavlaminat
Höjdtillöverstahyllplan740mm
Avståndmellanhyllplan370mm
4länkhjulvarav2medbroms,100mm
Belastning:100kg
•
•
•
•
•
Powdercoatedwithshelvesoflaminate
Height to top shelf 740 mm
Distance between shelves 370 mm
4 swivel castors, 2 with brakes, 100 mm
Capacity:100kg
2
• *Lådan passar alla vagnar - hyllor med
slät underdel
• *The box fits all trolleys - shelves with flat surface
KM 170 HELSVETSAD BORDSVAGN/ALL-WELDED SHELF TROLLEY
ART.NR.
Ram
Frame
Skiva
Top
KM170-1
KM170-6
Elz/El.galv Röd/Red
Elz/El.galv Vit/White
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
1000x580x850 19,5
1000x580x850 19,5
ART.NR.
Ram
Frame
Skiva
Top
KM170-1B Elz/El.galv Röd/Red
KM170-6B Elz/El.galv Vit/White
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
1000x580x850 1
9,5
1000x580x850 19,5
•
•
•
•
•
Elförzinkadmedhyllplanavlaminat
Höjdtillöverstahyllplan 850 mm
Avståndmellanhyllplan450mm
4länkhjul125mm
Belastning:150kg
•
•
•
•
•
Electro galvanised with laminate shelves
Heigth to top shelf 850 mm
Distance between shelves 450 mm
4 swivel castors 125 mm
Capacity:150kg
KM 171 HELSVETSAD BORDSVAGN/ALL-WELDED SHELF TROLLEY
6
ART.NR.
Ram
Frame
Skiva
Top
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
KM 171-1
KM 171-6
Vit/White
Vit/White
Röd/Red
Vit/White
1000 x 580 x 850 19,5
1000 x 580 x 850 19,5
ART.NR.
Ram
Frame
KM 171-1B Vit/White
KM 171-6B Vit/White
Skiva
Top
L x B x H (mm)
L x W x H (mm)
Röd/Red
Vit/White
1000 x 580 x 850 19,5
1000 x 580 x 850 19,5
•
•
•
•
•
Pulverlackeradmedlaminatskiva
Höjdtillöverstahyllplan 850 mm
Avståndmellanhyllplan450mm
4länkhjul125mm
Belastning:150kg
•
•
•
•
•
Powder coated with laminate shelves
Height to top shelf 850 mm
Distance between shelves 450 mm
4 swivel castors 125 mm
Capacity:150kg
Vikt (kg)
Weight
KM 1720 BORDSVAGN/SHELF TROLLEY
ART.NR.
Ram
Frame
Skiva
Top
L x B x H (mm) Vikt (kg)
L x W x H (mm) Weight
KM1720-1 Elz/El.galv Orange/Orange 850x435x950 16,5
KM1720-6 Elz/El.galv Vit/White
850 x 435 x 950 16,5
ART.NR.
Ram
Frame
Skiva
Top
L x B x H (mm) Vikt (kg)
L x W x H (mm) Weight
KM1720-1B Elz/El.galv Orange/Orange850x435x950 16,5
KM1720-6B Elz/El.galv Vit/White
850 x 435 x 950 16,5
•
•
•
•
•
•
Elförzinkadmedlaminatskiva
Höjdtillöverstahyllplan720mm
Avståndmellanhyllplan510mm
Plastatgreppvänligthandtag
4länkhjul100mm
Belastning:150kg
•
•
•
•
•
•
Electrogalvanisedwithlaminateshelves
Heighttotopshelf720mm
Distancebetweenshelves510mm
Plasticcoatedhandle
4swivelcastors100mm
Capacity:150kg
KM 1730/3730 BORDSVAGN/SHELF TROLLEY
ART.NR.
Ram
Frame
Skiva
Top
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
ART.NR.
Ram
Frame
KM 1730-6
KM 3730-6
Vit/White
Blå/Blue
Vit/White
Vit/White
850 x 435 x 950
850 x 435 x 950
16,5
16,5
KM 1730-6B Vit/White
KM 3730-6B Blå/Blue
Skiva
Top
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
Vit/White
Vit/White
850 x 435 x 950
850 x 435 x 950
16,5
16,5
•
•
•
•
•
•
Pulverlackeradmedlaminatskiva
Höjdtillöverstahyllplan720mm
Avståndmellanhyllplan510mm
Plastatgreppvänligthandtag
4länkhjul100mm
Belastning:150kg
•
•
•
•
•
•
Powdercoatedwithlaminateshelves
Heighttotopshelf720mm
Distancebetweenshelves510mm
Plasticcoatedhandle
4swivelcastors100mm
Capacity:150kg
KM 1720 BORDSVAGN/SHELF TROLLEY
ART.NR.
Ram
Frame
Skiva
Top
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
KM1720-BJ Elz/El.galv Björk/Birch 850x435x950 16,5
KM1720-BO Elz/El.galv Bok/Beech 850 x 435 x 950 16,5
ART.NR.
Ram
Frame
Skiva
Top
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
KM1720-BJB Elz/El.galv Björk/Birch 850x435x950 16,5
KM1720-BOBElz/El.galv Bok/Beech 850 x 435 x 950 16,5
•
•
•
•
•
•
Elförzinkadmedlaminatskiva
Höjdtillöverstahyllplan720mm
Avståndmellanhyllplan510mm
Plastatgreppvänligthandtag
4länkhjul100mm
Belastning:150kg
•
•
•
•
•
•
Electrogalvanisedwithlaminateshelves
Heighttotopshelf720mm
Distancebetweenshelves510mm
Plasticcoatedhandle
4swivelcastors100mm
Capacity:150kg
7
TILLBEHÖR/ACCESSORIES-TRÅDKORG/THREAD BASKET
ART.NR.
Ram
Frame
Vikt (kg)
Weight
KM1720-TS
Elz/El.galv
1,5
• ElförzinkadpassartillKM172,KM173,KM183,
KM 373, KM 1720, KM 3730, KM 872 och KM 873
• ElectrogalvanisedfitsKM172,KM173,KM183
KM 373, KM 1720, KM 3730, KM 872 and KM 873
KM 172 HELSVETSAD BORDSVAGN/ALL-WELDED SHELF TROLLEY
ART.NR.
Ram
Frame
Skiva
Top
KM 172-1
KM 172-6
Elz/El.galv Röd/Red
Elz/El.galv Vit/White
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
840 x 430 x 970 14
840x430x970 14
ART.NR.
Ram
Frame
Skiva
Top
KM 172-1B
KM 172-6B
Elz/El.galv Röd/Red
Elz/El.galv Vit/White
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
840 x 430 x 970 14
840x430x970 14
•
•
•
•
•
Elförzinkadmedlaminatskiva
Höjdtillöverstahyllplan720mm
Avståndmellanhyllplan515mm
4länkhjul100mm
Belastning:150kg
•
•
•
•
•
Electrogalvanisedwithlaminateshelves
Heighttotopshelf720mm
Distancebetweenshelves515mm
4swivelcastors100mm
Capacity:150kg
KM 173 HELSVETSAD BORDSVAGN/ALL-WELDED SHELF TROLLEY
8
ART.NR.
Ram
Frame
Skiva
Top
L x B x H (mm)
L x W x H (mm)
KM 173-1
KM 173-6
Vit/White
Vit/White
Röd/Red
Vit/White
840 x 430 x 970
840 x 430 x 970
Vikt (kg)
Weight
14
14
ART.NR.
Ram
Frame
Skiva
Top
L x B x H (mm)
L x W x H (mm)
KM 173-1B
KM 173-6B
Vit/White
Vit/White
Röd/Red
Vit/White
840 x 430 x 970
840 x 430 x 970
•
•
•
•
•
Pulverlackeradmedlaminatskiva
Höjdtillöverstahyllplan720mm
Avståndmellanhyllplan515mm
4länkhjul100mm
Belastning:150kg
•
•
•
•
•
Powdercoatedwithlaminateshelves
Heighttotopshelf720mm
Distancebetweenshelves515mm
4swivelcastors100mm
Capacity:150kg
Vikt (kg)
Weight
14
14
KM 183 HELSVETSAD BORDSVAGN/ALL-WELDED SHELF TROLLEY
ART.NR.
Ram
Frame
Skiva
Top
L x B x H mm)
L x W x H (mm)
KM 183-1
KM 183-6
Röd/Red
Röd/Red
Röd/Red
Vit/White
840 x 430 x 970
840 x 430 x 970
Vikt (kg)
Weight
14
14
ART.NR.
Ram
Frame
Skiva
Top
L x B x H mm)
L x W x H (mm)
KM 183-1B
KM 183-6B
Röd/Red
Röd/Red
Röd/Red
Vit/White
840 x 430 x 970
840 x 430 x 970
Vikt (kg)
Weight
•
•
•
•
•
Pulverlackeradmedlaminatskiva
Höjdtillöverstahyllplan720mm
Avståndmellanhyllplan515mm
4länkhjul100mm
Belastning:150kg
•
•
•
•
•
Powdercoatedwithlaminateshelves
Heighttotopshelf720mm
Distancebetweenshelves515mm
4swivelcastors100mm
Capacity:150kg
14
14
KM 373-6 HELSVETSAD BORDSVAGN/ALL-WELDED SHELF TROLLEY
ART.NR.
Ram
Frame
Skiva
Top
L x B x H (mm)
L x W x H (mm)
KM 373-6
Blå/Blue
Vit/White
840 x 430 x 970
Vikt (kg)
Weight
14
ART.NR.
Ram
Frame
Skiva
Top
L x B x H (mm) Vikt (kg)
L x W x H (mm) Weight
KM 373-6B
Blå/Blue
Vit/White
840 x 430 x 970
•
•
•
•
•
Pulverlackeradmedlaminatskiva
Höjdtillöverstahyllplan720mm
Avståndmellanhyllplan515mm
4länkhjul100mm
Belastning:150kg
•
•
•
•
•
Powdercoatedwithlaminateshelves
Heighttotopshelf720mm
Distancebetweenshelves515mm
4swivelcastors100mm
Capacity:150kg
14
KM 872 HELSVETSAD DESIGNVAGN/ALL-WELDED DESIGN TROLLEY
ART.NR.
Ram
Frame
Skiva
Top
L x B x H (mm) Vikt (kg)
L x W x H (mm) Weight
ART.NR.
Ram
Frame
Skiva
Top
L x B x H (mm) Vikt (kg)
L x W x H (mm) Weight
KM
KM
KM
KM
Svart/Black
Svart/Black
Svart/Black
Svart/Black
Björk/Birch
Bok/Beech
Körsbär/Cherry
Mahogny/Mahogany
840
840
840
840
KM
KM
KM
KM
Svart/Black
Svart/Black
Svart/Black
Svart/Black
Björk/Birch
Bok/Beech
Körsbär/Cherry
Mahogny/Mahogany
840
840
840
840
872-BJ
872-BO
872-KÖ
872-MA
KM 872-BJ
Björk/Birch
KM 872-BO
Bok/Beech
x
x
x
x
430
430
430
430
KM 872-KÖ
Körsbär/Cherry
x
x
x
x
970
970
970
970
14
14
14
14
872-BJB
872-BOB
872-KÖB
872-MAB
x
x
x
x
430
430
430
430
x
x
x
x
970
970
970
970
•
•
•
•
•
Pulverlackeradmedlaminatskiva
Höjdtillöverstahyllplan720mm
Avståndmellanhyllplan515mm
4länkhjul100mm
Belastning:150kg
•
•
•
•
•
Powdercoatedwithlaminateshelves
Heighttotopshelf720mm
Distancebetweenshelves515mm
4swivelcastors100mm
Capacity:150kg
14
14
14
14
KM 872-MA
Mahogny/Mahogany
9
KM 972 HELSVETSAD DESIGNVAGN/ALL-WELDED DESIGN TROLLEY
ART.NR.
Ram
Frame
Skiva
Top
L x B x H (mm) Vikt (kg)
L x W x H (mm) Weight
ART.NR.
KM
KM
KM
KM
Ant.grå/Ant.grey*
Ant.grå/Ant.grey*
Ant.grå/Ant.grey*
Ant.grå/Ant.grey*
Björk/Birch
Bok/Beech
Körsbär/Cherry
Mahogny/Mahogany
840
840
840
840
KM
KM
KM
KM
972-BJ
972-BO
972-KÖ
972-MA
x
x
x
x
430
430
430
430
x
x
x
x
970
970
970
970
14
14
14
14
Ram
Frame
L x B x H (mm) Vikt (kg)
L x W x H (mm) Weight
972-BJB Ant.grå/Ant.grey* Björk/Birch
840
972-BOB Ant.grå/Ant.grey* Bok/Beech
840
972-KÖB Ant.grå/Ant.grey* Körsbär/Cherry
840
972-MAB Ant.grå/Ant.grey* Mahogny/Mahogany 840
KM 972-BJ
Björk/Birch
KM 972-BO
Bok/Beech
KM 972-KÖ
Körsbär/Cherry
Skiva
Top
KM 972-MA
Mahogny/Mahogany
x
x
x
x
430
430
430
430
x
x
x
x
970
970
970
970
•
•
•
•
•
Pulverlackeradmedlaminatskiva
Höjdtillöverstahyllplan720mm
Avståndmellanhyllplan515mm
4länkhjul100mm
Belastning:150kg
•
•
•
•
•
Powdercoatedwithlaminateshelves
Heighttotopshelf720mm
Distancebetweenshelves515mm
4swivelcastors100mm
Capacity:150kg
14
14
14
14
*Antacitgrå/Anthracite grey
KM 873 HELSVETSAD DESIGNVAGN/ALL-WELDED DESIGN TROLLEY
ART.NR.
Ram
Frame
Skiva
Top
L x B x H (mm) Vikt (kg)
L x W x H (mm) Weight
ART.NR.
Ram
Frame
Skiva
Top
L x B x H (mm) Vikt (kg)
L x W x H (mm) Weight
KM
KM
KM
KM
Svart/Black
Svart/Black
Svart/Black
Svart/Black
Björk/Birch
Bok/Beech
Körsbär/Cherry
Mahogny/Mahogany
840
840
840
840
KM
KM
KM
KM
Svart/Black
Svart/Black
Svart/Black
Svart/Black
Björk/Birch
Bok/Beech
Körsbär/Cherry
Mahogny/Mahogany
840
840
840
840
873-BJ
873-BO
873-KÖ
873-MA
x
x
x
x
430
430
430
430
x
x
x
x
970
970
970
970
16
16
16
16
873-BJB
873-BOB
873-KÖB
873-MAB
KM 873-BJ
Björk/Birch
x
x
x
x
970
970
970
970
Pulverlackeradmedlaminatskiva
Höjdtillöverstahyllplan720mm
Avståndmellanhyllplan240mm
4länkhjul100mm
Belastning:150kg
•
•
•
•
•
Powdercoatedwithlaminateshelves
Heighttotopshelf720mm
Distancebetweenshelves240mm
4swivelcastors100mm
Capacity:150kg
ti Warrant
y
ran
KM 873-MA
Mahogny/Mahogany
aranti Wa
r
•G
TEE
AN
GUAR
5
• Garan
nty
t
ra
years
arranty • Ga
iW
10
430
430
430
430
•
•
•
•
•
KM 873-BO
Bok/Beech
KM 873-KÖ
Körsbär/Cherry
x
x
x
x
16
16
16
16
KM 973 HELSVETSAD DESIGNVAGN/ALL-WELDED DESIGN TROLLEY
ART.NR.
KM
KM
KM
KM
973-BJ
973-BO
973-KÖ
973-MA
Ram
Frame
Skiva
Top
Ant.grå/Ant.grey*
Ant.grå/Ant.grey*
Ant.grå/Ant.grey*
Ant.grå/Ant.grey*
Björk/Birch
Bok/Beech
Körsbär/Cherry
Mahogny/Mahogany
L x B x H (mm) Vikt (kg)
L x W x H (mm) Weight
ART.NR.
840
840
840
840
KM
KM
KM
KM
x
x
x
x
430
430
430
430
x
x
x
x
970
970
970
970
16
16
16
16
Ram
Frame
KM 973-MA
Mahogny/Mahogany
KM 973-KÖ
Körsbär/Cherry
L x B x H (mm) Vikt (kg)
L x W x H (mm) Weight
973-BJB Ant.grå/Ant.grey* Björk/Birch
840
973-BOB Ant.grå/Ant.grey* Bok/Beech
840
973-KÖB Ant.grå/Ant.grey* Körsbär/Cherry
840
973-MAB Ant.grå/Ant.grey* Mahogny/Mahogany 840
KM 973-BJ
Björk/Birch
KM 973-BO
Bok/Beech
Skiva
Top
x
x
x
x
430
430
430
430
x
x
x
x
970
970
970
970
16
16
16
16
•
•
•
•
•
Pulverlackeradmedlaminatskiva
Höjdtillöverstahyllplan 720 mm
Avståndmellanhyllplan240mm
4länkhjul100mm
Belastning:150kg
•
•
•
•
•
Powdercoatedwithlaminateshelves
Heighttotopshelf 720 mm
Distancebetweenshelves240mm
4swivelcastors100mm
Capacity:150kg
*Antacitgrå/Anthracite grey
KM 8112 DESIGNVAGN/DESIGN TROLLEY
ART.NR.
Ram
Frame
Skiva
Top
L x B x H (mm) Vikt (kg)
L x W x H (mm) Weight
ART.NR.
KM
KM
KM
KM
Svart/Black
Svart/Black
Svart/Black
Svart/Black
Björk/Birch
Bok/Beech
Körsbär/Cherry
Mahogny/Mahogany
1100
1100
1100
1100
KM
KM
KM
KM
8112-BJ
8112-BO
8112-KÖ
8112-MA
x
x
x
x
430
430
430
430
x
x
x
x
940
940
940
940
40
40
40
40
Ram
Frame
8112-BJB Svart/Black
8112-BOB Svart/Black
8112-KÖB Svart/Black
8112-MAB Svart/Black
KM 8112-BJ
Björk/Birch
KM 8112-BO
Bok/Beech
KM 8112-KÖ
Körsbär/Cherry
KM 8112-MA
Mahogny/Mahogany
Skiva
Top
L x B x H (mm) Vikt (kg)
L x W x H (mm) Weight
Björk/Birch
1100
Bok/Beech
1100
Körsbär/Cherry
1100
Mahogny/Mahogany 1100
x
x
x
x
430
430
430
430
x
x
x
x
940
940
940
940
40
40
40
40
•
•
•
•
•
•
Pulverlackeradmedlaminatskiva
Höjdtillöverstahyllplan 780 mm
Avståndmellanhyllplan545mm
Hyllplanet950x430mm
4länkhjul125mm
Belastning:250kg
•
•
•
•
•
•
Powder coated with laminate shelves
Heighttotopshelf 780 mm
Distancebetweenshelves545mm
Shelves 950 x 430 mm
4 swivel castors 125 mm
Capacity:250kg
11
KM 9112 DESIGNVAGN/DESIGN TROLLEY
ART.NR.
KM
KM
KM
KM
9112-BJ
9112-BO
9112-KÖ
9112-MA
Ram
Frame
Ant.grå/Ant.grey*
Ant.grå/Ant.grey*
Ant.grå/Ant.grey*
Ant.grå/Ant.grey*
Skiva
Top
Björk/Birch
Bok/Beech
Körsbär/Cherry
Mahogny/Mahogany
L x B x H (mm) Vikt (kg)
L x W x H (mm) Weight
ART.NR.
Ram
Frame
Skiva
Top
L x B x H (mm) Vikt (kg)
L x W x H (mm) Weight
1100
1100
1100
1100
KM 9112-BJB
KM 9112-BOB
KM 9112-KÖB
KM 9112-MAB
Ant.grå/Ant.grey*
Ant.grå/Ant.grey*
Ant.grå/Ant.grey*
Ant.grå/Ant.grey*
Björk/Birch
Bok/Beech
Körsbär/Cherry
Mahogny/Mahogany
1100
1100
1100
1100
x
x
x
x
430
430
430
430
x
x
x
x
940
940
940
940
40
40
40
40
KM 9112-BJ
Björk/Birch
x
x
x
x
430
430
430
430
x
x
x
x
940
940
940
940
40
40
40
40
•
•
•
•
•
•
Pulverlackeradmedlaminatskiva
Höjdtillöverstahyllplan 780 mm
Avståndmellanhyllplan545mm
Hyllplanet950x430mm
4länkhjul125mm
Belastning:250kg
•
•
•
•
•
•
Powder coated with laminate shelves
Heighttotopshelf 780 mm
Distance between shelves 545 mm
Shelves 950 x 430 mm
4 swivel castors 125 mm
Capacity:250kg
KM 9112-BO
Bok/Beech
KM 9112-KÖ
Körsbär/Cherry
*Antacitgrå/Anthracite grey
KM 9112-MA
Mahogny/Mahogany
KM 8113 DESIGNVAGN/DESIGN TROLLEY
ART.NR.
Ram
Frame
Skiva
Top
L x B x H (mm) Vikt (kg)
L x W x H (mm) Weight
ART.NR.
KM
KM
KM
KM
Svart/Black
Svart/Black
Svart/Black
Svart/Black
Björk/Birch
Bok/Beech
Körsbär/Cherry
Mahogny/Mahogany
1100
1100
1100
1100
KM
KM
KM
KM
8113-BJ
8113-BO
8113-KÖ
8113-MA
x
x
x
x
430
430
430
430
x
x
x
x
940
940
940
940
44
44
44
44
8113-BJB Svart/Black
8113-BOB Svart/Black
8113-KÖB Svart/Black
8113-MAB Svart/Black
KM 8113-BJ
Björk/Birch
KM 8113-BO
Bok/Beech
KM 8113-KÖ
Körsbär/Cherry
12
Ram
Frame
KM 8113-MA
Mahogny/Mahogany
Skiva
Top
L x B x H (mm) Vikt (kg)
L x W x H (mm) Weight
Björk/Birch
1100
Bok/Beech
1100
Körsbär/Cherry
1100
Mahogny/Mahogany 1100
x
x
x
x
430
430
430
430
x
x
x
x
940
940
940
940
44
44
44
44
•
•
•
•
•
•
Pulverlackeradmedlaminatskiva
Höjdtillöverstahyllplan 780 mm
Avståndmellanhyllplan260mm
Hyllplanet950x430mm
4länkhjul125mm
Belastning:250kg
•
•
•
•
•
•
Powder coated with laminate shelves
Heighttotopshelf 780 mm
Distancebetweenshelves260mm
Shelves 950 x 430 mm
4 swivel castors 125 mm
Capacity:250kg
KM 9113 DESIGNVAGN/DESIGN TROLLEY
ART.NR.
KM
KM
KM
KM
9113-BJ
9113-BO
9113-KÖ
9113-MA
Ram
Frame
Skiva
Top
Ant.grå/Ant.grey*
Ant.grå/Ant.grey*
Ant.grå/Ant.grey*
Ant.grå/Ant.grey*
KM 9113-BJ
Björk/Birch
Björk/Birch
Bok/Beech
Körsbär/Cherry
Mahogny/Mahogany
L x B x H (mm) Vikt (kg)
L x W x H (mm) Weight
ART.NR.
Ram
Frame
Skiva
Top
L x B x H (mm) Vikt (kg)
L x W x H (mm) Weight
1100
1100
1100
1100
KM 9113-BJB
KM 9113-BOB
KM 9113-KÖB
KM 9113-MAB
Ant.grå/Ant.grey*
Ant.grå/Ant.grey*
Ant.grå/Ant.grey*
Ant.grå/Ant.grey*
Björk/Birch
Bok/Beech
Körsbär/Cherry
Mahogny/Mahogany
1100
1100
1100
1100
x
x
x
x
430
430
430
430
x
x
x
x
940
940
940
940
44
44
44
44
x
x
x
x
430
430
430
430
x
x
x
x
940
940
940
940
44
44
44
44
•
•
•
•
•
•
Pulverlackeradmedlaminatskiva
Höjdtillöverstahyllplan 780 mm
Avståndmellanhyllplan260mm
Hyllplanet950x430mm
4länkhjul125mm
Belastning:250kg
•
•
•
•
•
•
Powder coated with laminate shelves
Heighttotopshelf 780 mm
Distancebetweenshelves260mm
Shelves 950 x 430 mm
4 swivel castors 125 mm
Capacity:250kg
KM 9113-BO
Bok/Beech
KM 9113-KÖ
Körsbär/Cherry
KM 9113-MA
Mahogny/Mahogany
*Antacitgrå/Anthracite grey
KM 30CR KROMAD SERVERINGSVAGN/CHROME SERVICE TROLLEY
ART.NR.
Skiva
Top
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
KM30CR
Bok/Birch
900 x 500 x 990
21
•
•
•
•
•
•
•
Kromadmedlaminatskiva
Höjdtillöverstahyllplan 810 mm
Avståndmellanhyllplan250mm
Hyllplanet 750 x 430 mm
Svartplastathandtag
4länkhjul2medbroms,125mm
Belastning:150kg
•
•
•
•
•
•
•
Chromewithlaminateshelves
Height to top shelf 810 mm
Distancebetweenshelves250mm
Shelves750x430mm
Black plastic coated handle
4swivelcastors2withbrakes,125mm
Capacity:150kg
KM 839 SKIVVAGN/BOARD TROLLEY
ART.NR.
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
KM 839
1000 x 700 x 690
27
• Pulverlackeradmedelförzinkadebyglaroch
vit laminatskiva
• Flakhöjd 190 mm
• Avståndmellanbyglar135mm
• 5byglaringår
• 4länkhjul2medbroms,125 mm
• Belastning:150kg
• Powdercoatedwithelectrogalvanisedbarsand
white laminate shelf
• Deckheight 190 mm
• Distancebetweenloadbars135mm
• 5 bars included
• 4 swivel castors 2 with brakes, 125 mm
• Capacity:150kg
13
ALLA PRODUKTER PÅ LAGER!
ALL PRODUCTS IN STOCK!
Our light Trolleys in metal or plastic material offer you a trolley that meets the functional
requirements that you have for modern trolleys in terms of finish and colour in a variety of
different usage areas.
T 018-18 68 80
E [email protected]
I www.ergoff.se
ti Warrant
y
ran
ÅTERFÖRSÄLJARE: ERGOFF MILJÖ AB
Hållnäsgatan 5
752 28 Uppsala
aranti Wa
r
•G
ANTEE
GUAR
5
years
arranty • Ga
iW
14
Våra lätta vagnar i metall eller plast erbjuder dig en vagn som motsvarar de funktionella krav
som man ställer på en modern vagn vad gäller ytbehandling och färg i en mängd olika användningområden.
• Garan
nty
t
ra
Lätta vagnar metall/plast
Light Trolleys Metal/Plastic
14-15
Symbolen/The symbol = Denna produkt
levereras i platt paket/This product will be
deliveredinflatpack
5-års garanti på alla våra vagnar/
5 years warranty for all of our Trolleys
2 bromsade hjul/2 wheels with
brakes EN 1757-3
KM 1620 SERVERINGSVAGN/SERVICE TROLLEY
ART.NR.
Ram
Frame
Brickor
Trays
L x B x H (mm) Vikt (kg)
L x W x H (mm) Weight
ART.NR.
Ram
Frame
Brickor
Trays
L x B x H (mm) Vikt (kg)
L x W x H (mm) Weight
KM
KM
KM
KM
KM
Ant.grå/Ant.grey*
Vit/White
Ant.grå/Ant.grey*
Vit/White
Blå/Blue
Ant.grå/Ant.grey*
Ant.grå/Ant.grey*
Vit/White
Röd/Red
Ant.grå/Ant.grey*
770
770
770
770
770
KM
KM
KM
KM
Blå/Blue
Blå/Blue
Ant.grå/Ant.grey*
Vit/White
Röd/Red
Vit/White
Röd/Red
Vit/White
770
770
770
770
1620-AA
1620-VA
1620-AV
1620-VR
1620-BA
•
•
•
•
•
•
x
x
x
x
x
495
495
495
495
495
x
x
x
x
x
960
960
960
960
960
15,5
15,5
15,5
15,5
15,5
1620-BR
1620-BV
1620-AR
1620-VV
Pulverlackeradmed3lösabrickor
Höjdtillöverstahyllplan 820 mm
Avståndmellanhyllplan290mm
Brickaiplast,600x450mm
4 länkhjul 2 med broms 125 mm
Belastning:150kg
•
•
•
•
•
•
x
x
x
x
495
495
495
495
x
x
x
x
960
960
960
960
15,5
15,5
15,5
15,5
Powdercoatedwith3removabletrays
Heighttotopshelf 820 mm
Distancebetweenshelves290mm
Plastic tray 600 x 450 mm
4 swivel castors 2 with brakes 125 mm
Capacity:150kg
*Antacitgrå/Anthracite grey
KM 1620-AA
Ant.grå/Ant.grey,* Ant.grå/Ant.grey*
KM 1620-BA
Blå/Blue, Ant.grå/Ant.grey*
KM 1620-VA
Vit/White,Ant.grå/Ant.grey*
KM 1620-BR
Blå/Blue, Röd/Red
KM 1620-VR
Vit/White, Röd/Red
KM 1620-AV
Ant.grå/Ant.grey*, Vit/White
KM 1620-BV
Blå/Blue, Vit/White
KM 1620-AR
Ant.grå/Ant.grey*, Röd/Red
KM 1620-VV
Vit/White, Vit/White
KM 60358/60359 PLASTVAGN/PLASTIC TROLLEY
ART.NR.
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
ART.NR.
KM 60358
810 x 470 x 945
10,5
KM 60359
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
1035 x 545 x 1010
15
• Plastvagnmedaluminiumdistanser
• 4länkhjul2medbroms100mm
• KM 60358
- Höjd till översta hyllplan 855 mm
- Avstånd mellan hyllplan 300 mm
- Belastning 50 kg
• KM 60359
- Höjd till översta hyllplan 890 mm
- Avstånd mellan hyllplan 315 mm
- Belastning 60 kg
aranti Wa
r
•G
TEE
AN
GUAR
5
• Garan
nty
t
ra
ti Warrant
y
ran
KM 60359
years
arranty • Ga
iW
KM 60358
• Plastictrolleywithsocketsofaluminium
• 4swivelcastors2withbrakes100mm
• KM 60358
- Height to top shelf 855 mm
- Distance between shelves 300 mm
-Capacity50kg
• KM 60359
- Height to top shelf 890 mm
- Distance between shelves 315 mm
-Capacity60kg
15
ALLA PRODUKTER PÅ LAGER!
ALL PRODUCTS IN STOCK!
These metal trolleys are available as all welded or flatpacked. You can choose model, size,
surface and colour that suits your needs.
T 018-18 68 80
E [email protected]
I www.ergoff.se
ti Warrant
y
ran
ÅTERFÖRSÄLJARE: ERGOFF MILJÖ AB
Hållnäsgatan 5
752 28 Uppsala
aranti Wa
r
•G
ANTEE
GUAR
5
years
arranty • Ga
iW
16
Dessa metallvagnar erbjuds i ett helsvetsat eller monteringsbart alternativ. Här kan du välja
din modell och storlek, ytbehandling och färg efter just dina behov.
• Garan
nty
t
ra
Lätta vagnar metall
Light Trolleys Metal
16-25
Symbolen/The symbol = Denna produkt
levereras i platt paket/This product will be
deliveredinflatpack
5-års garanti på alla våra vagnar/
5 years warranty for all of our Trolleys
2 bromsade hjul/2 wheels with
brakes EN 1757-3
KM 4147 HYLLVAGN/SHELF TROLLEY
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
ART.NR.
KM 4147
KM 4147-B
KM4147-E
Vit/White
Blå/Blue
Elz/El.galv
1070 x 585 x 940
1070 x 585 x 940
1070x585x940
26
26
26
KM 4147B
Vit/White
KM 4147-BB Blå/Blue
KM4147-EB Elz/El.galv
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
1070 x 585 x 940
1070 x 585 x 940
1070x585x940
26
26
26
•
•
•
•
•
•
•
Pulverlackeradellerelförzinkad
Höjdtillöverstahyllplan 760 mm
Avståndmellanhyllplan530mm
Kanmonterasmedhyllkantuppellerner
Hyllplan900x540mm
4länkhjul125mm
Belastning:250kg
•
•
•
•
•
•
•
Powder coated or electro galvanised
Heighttotopshelf 760 mm
Distancebetweenshelves530mm
Canbeassembledwithlipupordown
Shelf900x540mm
4swivelcastors125mm
Capacity:250kg
KM 4148 HYLLVAGN/SHELF TROLLEY
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
ART.NR.
KM 4148
KM 4148-B
KM4148-E
Vit/White
Blå/Blue
Elz/El.galv
1070 x 585 x 940
1070 x 585 x 940
1070x585x940
35
35
35
KM 4148B
Vit/White
KM 4148-BB Blå/Blue
KM4148-EB Elz/El.galv
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
1070 x 585 x 940
1070 x 585 x 940
1070x585x940
35
35
35
•
•
•
•
•
•
•
Pulverlackeradellerelförzinkad
Höjdtillöverstahyllplan 760 mm
Avståndmellanhyllplan250mm
Kanmonterasmedhyllkantuppellerner
Hyllplan900x540mm
4länkhjul125mm
Belastning:250kg
•
•
•
•
•
•
•
Powdercoatedorelectrogalvanised
Heigthtotopshelf 760 mm
Distancebetweenshelves250mm
Canbeassembledwithlipupordown
Shelf900x540mm
4swivelcastors125mm
Capacity:250kg
17
KM 4123 HYLLVAGN/SHELF TROLLEY
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
ART.NR.
KM 4123
KM 4123-B
KM4123-E
Vit/White
Blå/Blue
Elz/El.galv
980 x 585 x 1445
980 x 585 x 1445
980x585x1445
39
39
39
KM 4123B
Vit/White
KM 4123-BB Blå/Blue
KM4123-EB Elz/El.galv
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
980 x 585 x 1445
980 x 585 x 1445
980x585x1445
39
39
39
•
•
•
•
•
•
•
Pulverlackeradellerelförzinkad
Höjdtillöverstahyllplan 1340 mm
Avståndmellanhyllplan530mm
Kanmonterasmedhyllkantuppellerner
Hyllplan900x540mm
4länkhjul125mm
Belastning:250kg
•
•
•
•
•
•
•
Powdercoatedorelectrogalvanised
Heigttotopshelf 1340 mm
Distance between shelves 530 mm
Canbeassembledwithlipupordown
Shelf900x540mm
4swivelcastors125mm
Capacity:250kg
KM 4125 HYLLVAGN/SHELF TROLLEY
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
ART.NR.
KM 4125
KM 4125-B
KM4125-E
Vit/White
Blå/Blue
Elz/El.galv
980 x 585 x 1445
980 x 585 x 1445
980x585x1445
44,5
44,5
44,5
KM 4125B
Vit/White
KM 4125-BB Blå/Blue
KM4125-EB Elz/El.galv
NEW 2014
18
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
980 x 585 x 1445
980 x 585 x 1445
980x585x1445
44,5
44,5
44,5
•
•
•
•
•
•
•
Pulverlackeradellerelförzinkad
Höjdtillöverstahyllplan 1340 mm
Avståndmellanhyllplan340mm
Kanmonterasmedhyllkantuppellerner
Hyllplan900x540mm
4länkhjul125mm
Belastning:250kg
•
•
•
•
•
•
•
Powdercoatedorelectrogalvanised
Heighttotopshelf 1340 mm
Distancebetweenshelves340mm
Canbeassembledwithlipupordown
Shelves900x540m
4swivelcastors125mm
Capacity:250kg
KM 4124 HYLLVAGN/SHELF TROLLEY
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
ART.NR.
KM 4124
KM 4124-B
KM4124-E
Vit/White
Blå/Blue
Elz/El.galv
980 x 585 x 1445
980 x 585 x 1445
980x585x1445
59
59
59
KM 4124B
Vit/White
KM 4124-BB Blå/Blue
KM4124-EB Elz/El.galv
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
980 x 585 x 1445
980 x 585 x 1445
980x585x1445
59
59
59
•
•
•
•
•
•
•
Pulverlackeradellerelförzinkad
Höjdtillöverstahyllplan 1340 mm
Avståndmellanhyllplan250mm
Kanmonterasmedhyllkantuppellerner
Hyllplan900x540mm
4länkhjul125mm
Belastning:250kg
•
•
•
•
•
•
•
Powdercoatedorelectrogalvanised
Heighttotopshelf 1340 mm
Distancebetweenshelves250mm
Canbeassembledwithlipupordown
Shelf900x540mm
4swivelcastors125mm
Capacity:250kg
KM 4126, 4133 HELSVETSAD HYLLVAGN/ALL-WELDED SHELF TROLLEY
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Med kant Vikt (kg)
Withlip Weight
ART.NR.
Färg
Colour
KM 4126
KM 4126-B
KM4126-E
KM 4133
KM 4133-B
KM4133-E
Vit/White
Blå/Blue
Elz/El.galv
Vit/White
Blå/Blue
Elz/El.galv
1080 x 450 x 955
1080 x 450 x 955
1080x450x955
1080 x 450 x 955
1080 x 450 x 955
1080x450x955
Nej/No
Nej/No
Nej/No Ja/Yes
Ja/Yes
Ja/Yes KM 4126B
KM 4126-BB
KM4126-EB
KM 4133B
KM 4133-BB
KM4133-EB
Vit/White 1080 x 450 x 955
Blå/Blue 1080 x 450 x 955
Elz/El.galv1080x450x955
Vit/White 1080 x 450 x 955
Blå/Blue 1080 x 450 x 955
Elz/El.galv1080x450x955
25
25
25
25
25
25
L x B x H (mm)
LxWxH(mm)
Med kant Vikt (kg)
Withlip Weight
Nej/No
Nej/No
Nej/No Ja/Yes
Ja/Yes
Ja/Yes 25
25
25
25
25
25
•
•
•
•
•
Pulverlackeradellerelförzinkad
Höjdtillöverstahyllplan 780 mm
Avståndmellanhyllplan540mm
2fasta,2länkhjul160mm
Belastning:400kg
•
•
•
•
•
Powdercoatedorelectrogalvanised
Heigttotopshelf 780 mm
Distancebetweenshelves540mm
2fixed,2swivelcastors160mm
Capacity:400kg
19
KM 4127, 4134 HELSVETSAD HYLLVAGN/ALL-WELDED SHELF TROLLEY
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
KM 4127
KM 4127-B
KM4127-E
KM 4134
KM 4134-B
KM4134-E
Vit/White 1080 x 450 x 955
Blå/Blue
1080 x 450 x 955
Elz/El.galv 1080x450x955
Vit/White 1080 x 450 x 975
Blå/Blue
1080 x 450 x 975
Elz/El.galv 1080x450x975
Med kant Vikt (kg)
Withlip Weight
ART.NR.
Färg
Colour
Nej/No
Nej/No
Nej/No
Ja/Yes
Ja/Yes
Ja/Yes
KM 4127B
KM 4127-BB
KM4127-EB
KM 4134B
KM 4134-BB
KM4134-EB
Vit/White 1080 x 450 x 955
Blå/Blue
1080 x 450 x 955
Elz/El.galv 1080x450x955
Vit/White 1080 x 450 x 975
Blå/Blue
1080 x 450 x 975
Elz/El.galv 1080x450x975
31
31
31
31
31
31
L x B x H (mm)
LxWxH(mm)
Med kant Vikt (kg)
Withlip Weight
Nej/No
Nej/No
Nej/No
Ja/Yes
Ja/Yes
Ja/Yes
31
31
31
31
31
31
•
•
•
•
•
Pulverlackeradellerelförzinkad
Höjdtillöverstahyllplan 780 mm
Avståndmellanhyllplan260mm
2fasta2länkhjul160mm
Belastning:400kg
•
•
•
•
•
Powdercoatedorelectrogalvanised
Heighttotopshelf 780 mm
Distancebetweenshelves260mm
2fixed2swivelcastors160m
Capacity:400kg
KM 4168, 4175 HELSVETSAD HYLLVAGN/ALL-WELDED SHELF TROLLEY
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
KM 4168
KM 4168-B
KM4168-E
KM 4175
KM 4175-B
KM4175-E
Vit/White 1080 x 550 x 955
Blå/Blue 1080 x 550 x 955
Elz/El.galv1080x550x955
Vit/White 1080 x 550 x 975
Blå/Blue 1080 x 550 x 975
Elz/El.galv1080x550x975
Med kant Vikt (kg)
Withlip Weight
ART.NR.
Färg
Colour
Nej/No
Nej/No
Nej/No
Ja/Yes
Ja/Yes
Ja/Yes
KM 4168B
KM 4168-BB
KM4168-EB
KM 4175B
KM 4175-BB
KM4175-EB
Vit/White 1080 x 550 x 955
Nej/No
Blå/Blue 1080 x 550 x 955
Nej/No
Elz/El.galv1080x550x955 Nej/No Vit/White 1080 x 550 x 975
Ja/Yes
Blå/Blue 1080 x 550 x 975
Ja/Yes
Elz/El.galv1080x550x975 Ja/Yes 27,5
27,5
27,5
27,5
27,5
27,5
L x B x H (mm)
LxWxH(mm)
Med kant Vikt (kg)
Withlip Weight
27,5
27,5
27,5
27,5
27,5
27,5
•
•
•
•
•
Pulverlackeradellerelförzinkad
Höjdtillöverstahyllplan 780 mm
Avståndmellanhyllplan540mm
2fasta2länkhjul160mm
Belastning:400kg
•
•
•
•
•
Powdercoatedorelectrogalvanised
Heighttotopshelf 780 mm
Distancebetweenshelves540mm
2fixed2swivelcastors160mm
Capacity:400kg
KM 4169, 4176 HELSVETSAD HYLLVAGN/ALL-WELDED SHELF TROLLEY
KM 4169
KM 4169-B
KM4169-E
KM 4176
KM 4176-B
KM4176-E
Vit/White 1080 x 550 x 955
Blå/Blue 1080 x 550 x 955
Elz/El.galv1080x550x955
Vit/White 1080 x 550 x 975
Blå/Blue 1080 x 550 x 975
Elz/El.galv1080x550x975
Med kant Vikt (kg)
Withlip Weight
ART.NR.
Färg
Colour
Nej/No
Nej/No
Nej/No
Ja/Yes
Ja/Yes
Ja/Yes
KM 4169B
KM 4169-BB
KM4169-EB
KM 4176B
KM 4176-BB
KM4176-EB
Vit/White 1080 x 550 x 955 Nej/No
Blå/Blue 1080 x 550 x 955 Nej/No
Elz/El.galv1080x550x955 Nej/No
Vit/White 1080 x 550 x 975
Ja/Yes
Blå/Blue 1080 x 550 x 975
Ja/Yes
Elz/El.galv1080x550x975 Ja/Yes
34
34
34
34
34
34
L x B x H (mm)
LxWxH(mm)
Med kant Vikt (kg)
Withlip Weight
34
34
34
34
34
34
•
•
•
•
•
Pulverlackeradellerelförzinkad
Höjdtillöverstahyllplan 780 mm
Avståndmellanhyllplan260mm
2fasta,2länkhjul160mm
Belastning:400kg
•
•
•
•
•
Powdercoatedorelectrogalvanised
Heighttotopshelf 780 mm
Distancebetweenshelves260mm
2fixed,2swivelcastors160mm
Capacity:400kg
aranti Wa
r
•G
TEE
AN
GUAR
5
• Garan
nty
t
ra
20
L x B x H (mm)
LxWxH(mm)
ti Warrant
y
ran
Färg
Colour
years
arranty • Ga
iW
ART.NR.
KM 4144, 4149 HELSVETSAD HYLLVAGN/ALL-WELDED SHELF TROLLEY
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
KM 4144
KM 4144-B
KM4144-E
KM 4149
KM 4149-B
KM4149-E
Vit/White 975 x 550 x 1465
Blå/Blue 975 x 550 x 1465
Elz/El.galv975x550x1465
Vit/White 975 x 550 x 1485
Blå/Blue 975 x 550 x 1485
Elz/El.galv975x550x1485
Med kant Vikt (kg)
Withlip Weight
ART.NR.
Färg
Colour
Nej/No
Nej/No
Nej/No
Ja/Yes
Ja/Yes
Ja/Yes
KM 4144B
KM 4144-BB
KM4144-EB
KM 4149B
KM 4149-BB
KM 4149-EB
Vit/White 975 x 550 x 1465
Nej/No
36,5
Blå/Blue 975 x 550 x 1465
Nej/No
36,5
Elz/El.galv975x550x1465 Nej/No 36,5
Vit/White 975 x 550 x 1485
Ja/Yes
36,5
Blå/Blue 975 x 550 x 1485
Ja/Yes
36,5
Vit/White 975 x 550 x 1485
Ja/Yes
36,5
36,5
36,5
36,5
36,5
36,5
36,5
L x B x H (mm)
LxWxH(mm)
Med kant Vikt (kg)
Withlip Weight
•
•
•
•
•
Pulverlackeradellerelförzinkad
Höjdtillöverstahyllplan 1380 mm
Avståndmellanhyllplan550mm
2fasta2länkhjul160mm
Belastning:400kg
•
•
•
•
•
Powdercoatedorelectrogalvanised
Heighttotopshelf 1380 mm
Distancebetweenshelves550mm
2fixed2swivelcastors160mm
Capacity:400kg
KM 4145, 4150 HELSVETSAD HYLLVAGN/ALL-WELDED SHELF TROLLEY
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
KM 4145
KM 4145-B
KM4145-E
KM 4150
KM 4150-B
KM4150-E
Vit/White 975 x 550 x 1465
Blå/Blue 975 x 550 x 1465
Elz/El.galv975x550x1465
Vit/White 975 x 550 x 1485
Blå/Blue 975 x 550 x 1485
Elz/El.galv975x550x1485
Med kant Vikt (kg)
Withlip Weight
ART.NR.
Färg
Colour
Nej/No
Nej/No
Nej/No
Ja/Yes
Ja/Yes
Ja/Yes
KM 4145B
KM 4145-BB
KM4145-EB
KM 4150B
KM 4150-BB
KM4150-EB
Vit/White 975 x 550 x 1465
Nej/No
Blå/Blue 975 x 550 x 1465
Nej/No
Elz/El.galv975x550x1465 Nej/No Vit/White 975 x 550 x 1485
Ja/Yes
Blå/Blue 975 x 550 x 1485
Ja/Yes
Elz/El.galv975x550x1485 Ja/Yes 50
50
50
50
50
50
L x B x H (mm)
LxWxH(mm)
Med kant Vikt (kg)
Withlip Weight
50
50
50
50
50
50
•
•
•
•
•
Pulverlackeradellerelförzinkad
Höjdtillöverstahyllplan 1380 mm
Avståndmellanhyllplan260mm
2fasta2länkhjul160mm
Belastning:400kg
•
•
•
•
•
Powdercoatedorelectrogalvanised
Heighttotopshelf 1380 mm
Distancebetweenshelves260mm
2fixed2swivelcastors160mm
Capacity:400kg
21
KULÖRVAGN/COLOURED TROLLEY, 2 SHELVES
ART.NR.
Kulör
Colour
L x B x H (mm)
LxWxH(mm)
KM 1105
KM 2105
KM 3105
KM 4105
KM4105-E
KM 5105
KM 6105
KM 7105
Vinröd/Burgundy
Grön/Green
Blå/Blue
Vit/White
El.zink/El.galv
Gul/Yellow
Orange/Orange
Röd/Red
1080 x 480 x 940 23
1080 x 480 x 940 23
1080 x 480 x 940 23
1080 x 480 x 940 23
1080x480x940 23
1080 x 480 x 940 23
1080 x 480 x 940 23
1080 x 480 x 940 23
•
•
•
•
•
•
•
Vikt (kg)
Weight
ART.NR.
KM 1105B Vinröd/Burgundy
KM 2105B Grön/Green
KM 3105B Blå/Blue
KM 4105B Vit/White
KM4105-EB El.zink/El.galv
KM 5105B Gul/Yellow
KM 6105B Orange/Orange
KM 7105B Röd/Red
Pulverlackeradellerelförzinkad
Höjdtillöverstahyllplan 760 mm
Avståndmellanhyllplan530mm
Kanmonterasmedhyllkantuppellerner
Hyllplan900x440mm
4länkhjul125mm
Belastning:250kg
KM 1105
Vinröd/Burgundy
Kulör
Colour
•
•
•
•
•
•
•
22
Vikt (kg)
Weight
1080 x 480 x 940
1080 x 480 x 940
1080 x 480 x 940
1080 x 480 x 940
1080x480x940
1080 x 480 x 940
1080 x 480 x 940
1090 x 490 x 950
23
23
23
23
23
23
23
23
Powdercoatedorelectrogalvanised
Heighttotopshelf 760 mm
Distancebetweenshelves530mm
Canbeassembledwithshelflipupordown
Shelves900x440mm
4swivelcastors125mm
Capacity:250kg
KM 2105
Grön/Green
KM 3105
Blå/Blue
KM 4105-E
El.zink/El.galv
KM 4105
Vit/White
KM 5105
Gul/Yellow
L x B x H (mm)
LxWxH(mm)
KM 6105
Orange/Orange
KM 7105
Röd/Red
KULÖRVAGN/COULURED TROLLEY, 3 SHELVES
ART.NR.
Kulör
Colour
L x B x H (mm)
LxWxH(mm)
KM 1106
KM 2106
KM 3106
KM 4106
KM4106-E
KM 5106
KM 6106
KM 7106
Vinröd/Burgundy
Grön/Green
Blå/Blue
Vit/White
El.zink/El.galv
Gul/Yellow
Orange/Orange
Röd/Red
1080 x 480 x 940 30
1080 x 480 x 940 30
1080 x 480 x 940 30
1080 x 480 x 940 30
1080x480x940 30
1080 x 480 x 940 30
1080 x 480 x 940 30
1080 x 480 x 940 30
•
•
•
•
•
•
•
Pulverlackeradellerelförzinkad
Höjdtillöverstahyllplan 760 mm
Avståndmellanhyllplan250mm
Hyllplan900x440mm
Kanmonterasmedhyllkantuppellerner
4länkhjul125mm
Belastning:250kg
KM 1106
Vinröd/Burgundy
Vikt (kg)
Weight
ART.NR.
Kulör
Colour
KM 1106B Vinröd/Burgundy
KM 2106B Grön/Green
KM 3106B Blå/Blue
KM 4106B Vit/White
KM4106-EB El.zink/El.galv
KM 5106B Gul/Yellow
KM 6106B Orange/Orange
KM 7106B Röd/Red
•
•
•
•
•
•
•
Vikt (kg)
Weight
1080 x 480 x 940
30
1080 x 480 x 940
30
1080 x 480 x 940
30
1080 x 480 x 940
30
1080x480x940 30
1080 x 480 x 940
30
1080 x 480 x 940
30
1080 x 480 x 940
30
Powdercoatedorelectrogalvanised
Heighttotopshelf 760 mm
Distancebetweenshelves250mm
Shelves900x440mm
Canbeassembledwithshelflipupordown
4swivelcastors125mm
Capacity:250kg
KM 2106
Grön/Green
KM 4106
Vit/White
KM 5106
Gul/Yellow
L x B x H (mm)
LxWxH(mm)
KM 3106
Blå/Blue
KM 4106-E
El.zink/El.galv
KM 6106
Orange/Orange
KM 7106
Röd/Red
23
RULLBORD/TABLE TOP TROLLEY
ART.NR.
Kulör
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
ART.NR.
Kulör
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
KM
KM
KM
KM
KM
KM
Blå/Blue
Vit/White
El.zink/El.galv
Gul/Yellow
Röd/Red
Ant.grå/Ant.grey
690 x 430 x 750
690 x 430 x 750
690x430x750
690 x 430 x 750
690 x 430 x 750
690 x 430 x 750
15,5
15,5
15,5
15,5
15,5
15,5
KM
KM
KM
KM
KM
KM
Blå/Blue
Vit/White
El.zink/El.galv
Gul/Yellow
Röd/Red
Ant.grå/Ant.grey
690 x 430 x 750
690 x 430 x 750
690x430x750
690 x 430 x 750
690 x 430 x 750
690 x 430 x 750
15,5
15,5
15,5
15,5
15,5
15,5
•
•
•
•
•
•
3100
4100
4100-E
5100
7100
8100
3100B
4100B
4100-EB
5100B
7100B
8100B
•
•
•
•
•
•
Pulverlackeradellerelförzinkad
Höjdtillöverstahyllplan740 mm
Avståndmellanhyllplan480mm
Passarplastbackar600x400mm
4länkhjul100mm
Belastning:150kg
Powdercoatedorelectrogalvanised
Heighttotopshelf 740 mm
Distancebetweenshelves480mm
Suitableforplasticbins600x400mm
4swivelcastors100mm
Capacity:150kg
KM 4100
KM 3100
KM 5100
KM 4100-E
KM 7100
KM 8100
KM 120, 130 BORDSVAGN/TABLE TROLLEY
ART.NR.
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
KM 120-HL
810 x 490 x 870
18,5
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 130-HL
810 x 490 x 870
•
•
•
•
•
•
KM 120-HL
24
KM 130-HL
Vikt (kg)
Weight
24
Elförzinkadebyglarochpulverlackeradehyllplaninonslipyta
Höjdtillöverstahyllplan665mm
KM 120-HL
- Avstånd mellan hyllplan 490 mm
KM 130-HL
- Avstånd mellan hyllplan 240 mm
2fastaoch2länkhjul100mm
Belastning:170kg
• Electrogalvanisedhandleandpowdercoatedshelveswith
non slip surface
• Heigttotopshelf665mm
• KM 120-HL
- Distance between shelves 490 mm
• KM 130-HL
- Distance between shelves 240 mm
• 2 fixed and 2 swivel castors 100 mm
• Capacity:170kg
PLÅTVAGN MED SARG/IN STORE TROLLEY WITH BOARDER
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
KM 4200
KM 3200
KM 8200
KM4893-GB
Vit/White
Blå/Blue
Ant.grå/Ant.grey*
El.zink/El.galv
1130 x 550 x 940
1130 x 550 x 940
1130 x 550 x 940
1130x550x940
21,5
21,5
21,5
21,5
KM 4200B
KM 3200B
KM 8200B
KM4893-GBB
Vit/White
Blå/Blue
Ant.grå/Ant.grey*
El.zink/El.galv
1130 x 550 x 940
1130 x 550 x 940
1130 x 550 x 940
1130x550x940
21,5
21,5
21,5
21,5
KM 4200
KM 8200
KM 3200
KM 4893-GB
•
•
•
•
•
•
•
Pulverlackeradellerelförzinkad
Höjdtillöverstahyllplan705mm
90mmsarg
Avståndmellanhyllplan325mm
Hyllplan935x535
4länkhjul125mm
Belastning:250kg
•
•
•
•
•
•
•
Powdercoatedorelectrogalvanised
Heighttotopshelf705mm
Boarder90mm
Distancebetweenshelves325mm
Shelves 935 x 535
4 swivel castors 125 mm
Capacity:250kg
*Antacitgrå/Anthracite grey
KM 213 NÄTVAGN/MESH TROLLEY
ART.NR.
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
KM 213-HB
980 x 620 x 960
19
• Elförzinkadebyglarochnätsidormedpulverlackerad
botten i non slip yta
• Nätetsmaska,50x100mm
• 2fastaoch2länkhjulmedpolyuretanbana125mm
• Belastning:300kg
• Electrogalvanisedhandleandmeshsideswithpowder coated bottom with non slip surface
• Meshsize,50x100mm
• 2fixedand2swivelcastorspolyurthane125mm
• Capacity:300kg
25
ALLA PRODUKTER PÅ LAGER!
ALL PRODUCTS IN STOCK!
You will find all of our trolleys that are suitable for industries and warehouses in
this chapter. Choose the trolleys that best suits your needs.
ti Warrant
y
ran
ÅTERFÖRSÄLJARE: ERGOFF MILJÖ AB
Hållnäsgatan 5
752 28 Uppsala
T 018-18 68 80
E [email protected]
I www.ergoff.se
aranti Wa
r
•G
ANTEE
GUAR
5
years
arranty • Ga
iW
26
Här har vi samlat allt från den lättaste vagnen till de tunga vagnarna för industri
och lager. Välj själv vad som passar era behov.
• Garan
nty
t
ra
Platåvagnar
Platform Trolleys
26-28
Symbolen/The symbol = Denna produkt
levereras i platt paket/This product will be
deliveredinflatpack
5-års garanti på alla våra vagnar/
5 years warranty for all of our Trolleys
2 bromsade hjul/2 wheels with
brakes EN 1757-3
KM 180-250 SKYFFELVAGN/SHOVEL TRUCK
ART.NR.
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
KM 180-250
800 x 500 x 900
12,5
•
•
•
•
•
Elförzinkad
Höjdtilllastplan140mm
Lastplan800x500mm
2fastaoch2länkhjul100mm
Belastning:400kg
•
•
•
•
•
Electrogalvanised
Heigttoplatform140mm
Platformsize800 x 500 mm
2 fixed and 2 swivel castors 100 mm
Capacity:400kg
KM 191 PLATÅVAGN/PLATFORM TROLLEY
ART.NR.
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
KM 191
990 x 545 x 990
12
•
•
•
•
Elförzinkadmedlaminatskiva800x500mm
Höjdtilllastplan180mm
2fastaoch2länkhjul125mm
Belastning:250kg
•
•
•
•
Electro galvanised with laminate shelf 800 x 500 mm
Heigt to platform 180 mm
2 fixed and 2 swivel castors 125 mm
Capacity:250kg
KM 113227 VOLYMVAGN/VOLUME TROLLEY
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 113227
1170 x 700 x 980
Vikt (kg)
Weight
22
• Elförzinkadmedlackeradehandtag-stackningsbar
• 4länkhjul125mm
• Belastning:200kg
• Electro galvanised, with powder coated handels - stackable
• 4 swivel castors 125 mm
• Capacity:200kg
27
KM 192 PLATÅVAGN/PLATFORM TROLLEY
ART.NR.
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
KM 192
805 x 510 x 925
13,5
•
•
•
•
•
Elförzinkad
Höjdtilllastplan150mm
Lastplan805x510mm
2fastaoch2länkhjul100mm
Belastning:300kg
•
•
•
•
•
Electro galvanised
Heighttoplatform150mm
Platform805x510mm
2 fixed and 2 swivel castors 100 mm
Capacity:300kg
KM 110-HL PLATÅVAGN/PLATFORM TROLLEY
ART.NR.
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
KM 110-HL
750 x 490 x 875
12
•
•
•
•
Pulverlackeradochlastplanmednonslipyta
Höjdtilllastplan150mm
2fastaoch2länkhjul100mm
Belastning:170kg
•
•
•
•
Powdercoatedanddeckwithnonslipsurface
Height to platform 150 mm
2 fixed and 2 swivel castors 100 mm
Capacity:170kg
KM 210-HB PLATÅVAGN/PLATFORM TROLLEY
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 210-HB
920 x 620 x 870
28
Vikt (kg)
Weight
17,5
•
•
•
•
Pulverlackeradochlastplanmednonslipyta
Höjdtilllastplan180mm
2fastaoch2länkhjul125mm
Belastning:300kg
•
•
•
•
Powdercoatedanddeckwithnonslipsurface
Height to platform180 mm
2 fixed and 2 swivel castors 125 mm
Capacity:300kg
ALLA PRODUKTER PÅ LAGER!
ALL PRODUCTS IN STOCK!
Det rostfria vagnsortimentet från Konga Mekaniska innefattar en ekonomiversion
samt en mer exklusiv serie där även hjulen är rostfria. Den exklusiva serien lämpar
sig för områden där en hygienisk lättskött vagn efterfrågas.
In our stainless steel assortment you will find one economy version and one
exclusive serie which is equipped with stainless steel wheels. The trolleys in the
exclusive series are best suited when you are in an environment where the
hygienic standard is high.
T 018-18 68 80
E [email protected]
I www.ergoff.se
aranti Wa
r
•G
ANTEE
GUAR
5
• Garan
nty
t
ra
ti Warrant
y
ran
ÅTERFÖRSÄLJARE: ERGOFF MILJÖ AB
Hållnäsgatan 5
752 28 Uppsala
years
arranty • Ga
iW
Symbolen/The symbol = Denna produkt
levereras i platt paket/This product will be
deliveredinflatpack
5-års garanti på alla våra vagnar/
5 years warranty for all of our Trolleys
2 bromsade hjul/2 wheels with
brakes EN 1757-3
Rostfria vagnar
Stainless Steel Trolleys
29-34
29
KM 60350, 60354 ROSTFRIA 18/0/STAINLESS 18/0
ART.NR.
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
KM 60350
710 x 400 x 805
9
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 60354
910 x 590 x 940
Vikt (kg)
Weight
12
• KM 60350 - höjd övre hyllpan 680 mm
- avstånd mellan hyllplan 460 mm
- hyllplanets mått 685 x 380 mm
• KM 60354 - höjd övre hyllplan 810 mm
- avstånd mellan hyllplan 590 mm
- hyllplanets mått 825 x 500 mm
• 4länkhjul,2medbroms100mm
• Belastning:100kg
• KM 60350 - height to top shelf 680 mm
- distance between shelves 460 mm
-shelfsize685x380mm
• KM 60354 - height to top shelf 810 mm
- distance between shelves 590 mm
-shelfsize825x500mm
• 4 swivel castors 2 with brakes 100 mm
• Capacity:100kg
Förstärkta i hörnen
Reinforced in
the corners
KM 60350
KM 60354
KM 60351, 60355 ROSTFRIA 18/0/STAINLESS 18/0
ART.NR.
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
KM 60351
710 x 400 x 805
11,5
ART.NR.
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
KM 60355
910 x 590 x 940
15,5
• KM 60351 - höjd övre hyllpan 680 mm
- avstånd mellan hyllplan 200 mm
- hyllplanets mått 685 x 380 mm
• KM 60355 - höjd övre hyllplan 810 mm
- avstånd mellan hyllplan 280 mm
- hyllplanets mått 825 x 500 mm
• 4länkhjul,2medbroms100mm
• Belastning:100kg
Förstärkta i hörnen
Reinforced in
the corners
KM 60351
KM 60355
• KM 60351 - height to top shelf 680 mm
- distance between shelves 200 mm
-shelfsize685x380mm
• KM 60355 - height to top shelf 810 mm
- distance between shelves 280 mm
-shelfsize825x500mm
• 4 swivel castors 2 with brakes 100 mm
• Capacity:100kg
KM 60356 ROSTFRIA 18/0/STAINLESS 18/0
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 60356
910 x 590 x 1260
Förstärkta i hörnen
Reinforced in the corners
30
Vikt (kg)
Weight (kg)
21
•
•
•
•
•
Höjdtillövrehyllplan1125mm
Avståndmellanhyllplan280mm
Hyllplanetsmått825x500mm
4länkhjul,2medbroms100mm
Belastning:100kg
•
•
•
•
•
Height to top shelf 1125 mm
Distance between shelves 280 mm
Shelfsize825x500mm
4 swivel castors 2 with brakes 100 mm
Capacity:100kg
KM 60357 ROSTFRI 18/0/STAINLESS 18/0
ART.NR.
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
KM 60357
910 x 590 x 940
13
Förstärkta i hörnen
Reinforced in the corners
•
•
•
•
•
Höjdtillövrehyllplan695mm,sarg805mm
Avståndmellanhyllplan470mm
Hyllplanetsmått825x500mm
4länkhjul,2medbroms100mm
Belastning:100kg
•
•
•
•
•
Height to top shelf 695 mm, top boarder 805 mm
Distance between shelves 470 mm
Shelfsize825x500mm
4 swivel castors 2 with brakes 100 mm
Capacity:100kg
KM 60360 ROSTFRI 18/0/STAINLESS 18/0
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 60360
825 x 520 x 970
Vikt (kg)
Weight
11,5
•
•
•
•
Höjdtilllastplan180mm
Lastplan825x520mm
4länkhjul,2medbroms100mm
Belastning:100kg
•
•
•
•
Height to platform 180 mm
Platform825x520mm
4 swivel castors 2 with brakes 100 mm
Capacity:100kg
KM 60363 ROSTFRI 18/0/STAINLESS 18/0
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 60363
880 x 500 x 940
Vikt (kg)
Weight
10,5
•
•
•
•
Höjdtilllastplan470mm
Lastplan760x440mm
4länkhjul,2medbroms100mm
Belastning:150kg
•
•
•
•
Height to platform 470 mm
Shelf760x440mm
4 swivel castors 2 with brakes 100 mm
Capacity:150kg
31
KM 60354-S ROSTFRI 18/8/STAINLESS 18/8
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 60354-S
910 x 590 x 965
Förstärkta i hörnen
Reinforced in the corners
Vikt (kg)
Weight
14
•
•
•
•
•
Höjdtillövrehyllplan835mm
Avståndmellanhyllplan590mm
Hyllplanetsmått825x500mm
4länkhjul,2medbroms,precisionskullager125mm
Belastning:100kg
•
•
•
•
•
Height to top shelf 835 mm
Distance between shelves 590 mm
Shelfsize825x500mm
4 swivel castors 2 with brakes, precision ballbearings 125 mm
Capacity:100kg
• Helavagnenirostfritt-ävenhjulen
• All Stainless - even the castors
KM 60355-S ROSTFRI 18/8/STAINLESS 18/8
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 60355-S
910 x 590 x 965
Förstärkta i hörnen
Reinforced in the corners
Vikt (kg)
Weight
17,5
•
•
•
•
•
Höjdtillövrehyllplan835mm
Avståndmellanhyllplan280mm
Hyllplanetsmått825x500mm
4länkhjul,2medbroms,precisionskullager125mm
Belastning:100kg
•
•
•
•
•
Height to top shelf 835 mm
Distance between shelves 280 mm
Shelfsize825x500mm
4 swivel castors 2 with brakes, precision ballbearings 125 mm
Capacity:100kg
• Helavagnenirostfritt-ävenhjulen
• All Stainless - even the castors
KM 60363-S ROSTFRI 18/8/STAINLESS 18/8
ART.NR.
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
KM 60363-S
880 x 500 x 965
12,5
•
•
•
•
Höjdtilllastplan495mm
Lastplan760x440mm
4länkhjul,2medbroms,precisionskullager125mm
Belastning: 150 kg
•
•
•
•
Heighttoplatform495mm
Platform 760 x 440 mm
4swivelcastors2withbrakes,precisionballbearings125mm
Capacity:150kg
• Helavagnenirostfritt-ävenhjulen
• AllStainless-eventhecastors
32
KM 60364-D ROSTFRI 18/8/STAINLESS 18/8
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 60364-D
900 x 600 x 1000
Vikt (kg)
Weight
15,5
•
•
•
•
•
Höjdtillövrehyllplan850mm
Avståndmellanhyllplan590mm
Hyllplanetsmått835x515mm
4länkhjul,2medbroms,precisionskullager125mm
Belastning:100kg
•
•
•
•
•
Heighttotopshelf850mm
Distancebetweenshelves590mm
Shelfsize835x515mm
4swivelcastors2withbrakes,precisionballbearings125mm
Capacity:100kg
• Helavagnenirostfritt-ävenhjulen
• AllStainless-eventhecastors
KM 60365-D ROSTFRI 18/8/STAINLESS 18/8
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 60365-D
900 x 600 x 1000
Vikt (kg)
Weight
19
•
•
•
•
•
Höjdtillövrehyllplan850mm
Avståndmellanhyllplan280mm
Hyllplanetsmått835x515mm
4länkhjul,2medbroms,precisionskullager125mm
Belastning:100kg
•
•
•
•
•
Heighttotopshelf850mm
Distancebetweenshelves280mm
Shelfsize835x515mm
4swivelcastors2withbrakes,precisionballbearings125mm
Capacity:100kg
• Helavagnenirostfritt-ävenhjulen
• AllStainless-eventhecastors
33
KM 270 RULLBORD/TABLE TOP TROLLEY
ART.NR.
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
ART.NR.
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
KM 270
605 x 605 x 885
14,5
KM 270B
605 x 605 x 885
14,5
•
•
•
•
Elförzinkadmedhyllplan av spånskiva, klädd med 1 mm rostfri plåt
Höjdtillövrehyllplan885mm
4länkhjul100mm
Belastning:150kg
• Electrogalvanisedwith shelf of chipboard, covered with 1 mm
stainless steel sheet
• Height to top shelf 885 mm
• 4 swivel castors 100 mm
• Capacity:150kg
KM 271 BORDSVAGN/SHELF TROLLEY
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 271
1000 x 580 x 870
Vikt (kg)
Weight
ART.NR.
L x B x H (mm)
L x W x H (mm)
34,5
KM 271B
1000 x 580 x 870
•
•
•
•
•
Vikt (kg)
Weight
34,5
Elförzinkadmedhyllplan av spånskiva, klädd med 1 mm rostfri plåt
Höjdtillövrehyllplan870mm
Avståndmellanhyllplan450mm
4länkhjul125mm
Belastning:200kg
• Electrogalvanisedwith shelf of chipboard, covered with 1 mm
stainless steel sheet
• Height to top shelf 870 mm
• Distancebetweenshelves450mm
• 4 swivel castors 125 mm
• Capacity:200kg
KM 272 BORDSVAGN/SHELF TROLLEY
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 272
840 x 430 x 970
Vikt (kg)
Weight
21
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 272B
840 x 430 x 970
•
•
•
•
•
Vikt (kg)
Weight
21
Elförzinkadmedhyllplan av spånskiva, klädd med 1 mm rostfri plåt
Höjdtillövrehyllplan720mm
Avståndmellanhyllplan510mm
4länkhjul100mm
Belastning:150kg
• Electrogalvanisedwith shelf of chipboard, covered with 1 mm
stainless steel sheet
• Height to top shelf 720 mm
• Distancebetweenshelves510mm
• 4 swivel castors 100 mm
• Capacity:150kg
34
ALLA PRODUKTER PÅ LAGER!
ALL PRODUCTS IN STOCK!
Här finner du vagnar där hyllplanen enkelt justeras i höjdled för att tillgodose dina
transportbehov. Finns i en mängd olika modeller och storlekar.
These trolleys have shelves that are adjustable in different heights so it will suit your
transportation needs. They are available in a variety of models and sizes.
T 018-18 68 80
E [email protected]
I www.ergoff.se
aranti Wa
r
•G
ANTEE
GUAR
5
• Garan
nty
t
ra
ti Warrant
y
ran
ÅTERFÖRSÄLJARE: ERGOFF MILJÖ AB
Hållnäsgatan 5
752 28 Uppsala
years
arranty • Ga
iW
Symbolen/The symbol = Denna produkt
levereras i platt paket/This product will be
deliveredinflatpack
5-års garanti på alla våra vagnar/
5 years warranty for all of our Trolleys
2 bromsade hjul/2 wheels with
brakes EN 1757-3
Flexibla hyllvagnar
Flexible Shelf Trolleys
35-40
35
CENTRALLÅS FÖR 8000 CL/CENTRAL LOCKING FOR 8000 CL MODELS
Rikt spärr. Du låser de främre parens svängkrans, vagnen kör rakt.
The castors in the front are locked, the trolley goes straight.
Rikt spärr. Du låser de främre parens svängkrans, vagnen kör rakt.
The castors in the front are locked, the trolley goes straight.
Rikt spärr. Du låser de främre parens svängkrans, vagnen kör rakt.
The castors in the front are locked, the trolley goes straight.
Neutralt läge. Alla hjulen svänger, vagnen går att köra i alla riktningar.
Neutral, all castors turns, the trolley can go in any direction.
Neutralt läge. Alla hjulen svänger, vagnen går att köra i alla riktningar.
Neutral, all castors turns, the trolley can go in any direction.
Neutralt läge. Alla hjulen svänger, vagnen går att köra i alla riktningar.
Neutral, all castors turns, the trolley can go in any direction.
Låser alla hjulen samtidigt.
All castors are locked.
Låser alla hjulen samtidigt.
All castors are locked.
Låser alla hjulen samtidigt.
All castors are locked.
36
Passar för många olika användningsområden.
Suitable for several different areas.
Passar för många olika användningsområden.
Suitable for several different areas.
Passar för många olika användningsområden.
Suitable for several different areas.
KM 8000 - 2L, XL - CL CENTRALLÅSVAGN/TROLLEY WITH CENTRAL LOCKING
ART.NR.
KM8000-2L-CL
KM8000-2XL-CL
L x B x H (mm)
LxWxH(mm)
195x470x1120
1
1395x470x1120
Mått hyllplan LxB (mm)
SizeshelfLxW
Vikt (kg)
Weight
1000x425
1200x425
28,5
31
•
•
•
•
•
Elförzinkadmedlaminatskivor
Hyllplansteglöstställbaraihöjd
Justerbarthandtag
4centrallåshjulmedprecisionskullager125mm
Belastning:250kg
•
•
•
•
•
Electrogalvanisedwithshelvesinlaminate
Shelvesadjustableinheight
Adjustablehandle
4centrallockingcastors,precisionballbearing125mm
Capacity:250kg
KM 8000 - 3L, XL - CL CENTRALLÅSVAGN/TROLLEY WITH CENTRAL LOCKING
ART.NR.
KM8000-3L-CL
KM8000-3XL-CL
L x B x H (mm)
LxWxH(mm)
195x470x1120
1
1395x470x1120
Mått hyllplan LxB (mm)
SizeshelfLxW
Vikt (kg)
Weight
1000x425
1200x425
35
39
•
•
•
•
•
Elförzinkadmedlaminatskivor
Hyllplansteglöstställbaraihöjd
Justerbarthandtag
4centrallåshjulmedprecisionskullager125mm
Belastning:250kg
•
•
•
•
•
Electrogalvanisedwithshelvesinlaminate
Shelvesadjustableinheight
Adjustablehandle
4centrallockingcastors,precisionballbearing125mm
Capacity:250kg
KM 8000 - 4L, XL - CL CENTRALLÅSVAGN/TROLLEY WITH CENTRAL LOCKING
ART.NR.
KM8000-4L-CL
KM8000-4XL-CL
L x B x H (mm)
LxWxH(mm)
195x470x1590
1
1395x470x1590
Mått hyllplan LxB (mm)
SizeshelfLxW
Vikt (kg)
Weight
1000x425
1200x425
42,5
49,5
•
•
•
•
•
Elförzinkadmedlaminatskivor
Hyllplansteglöstställbaraihöjd
Justerbarthandtag
4centrallåshjulmedprecisionskullager125mm
Belastning:250kg
•
•
•
•
•
Electrogalvanisedwithshelvesinlaminate
Shelvesadjustableinheight
Adjustablehandle
4centrallockingcastors,precisionballbearing125mm
Capacity:250kg
37
KM 8000-2 FLEXIBEL HYLLVAGN/FLEXIBLE SHELF TROLLEY
ART.NR.
KM
KM
KM
KM
8000-2S
8000-2M
8000-2L
8000-2XL
L x B x H (mm)
LxWxH(mm)
815 x 470 x 1120
945 x 470 x 1120
1195 x 470 x 1120
1395 x 470 x 1120
Mått hyllplan LxB (mm)
SizeshelfLxW
620
750
1000
1200
x
x
x
x
425
425
425
425
Vikt (kg)
Weight
19,5
22,5
25,5
28
ART.NR.
L x B x H (mm)
LxWxH(mm)
815 x 470 x 1120
945 x 470 x 1120
1195 x 470 x 1120
1395 x 470 x 1120
Mått hyllplan LxB (mm)
SizeshelfLxW
KM
KM
KM
KM
8000-2SB
8000-2MB
8000-2LB
8000-2XLB
620
750
1000
1200
x
x
x
x
425
425
425
425
•
•
•
•
•
Elförzinkadmedlaminatskivor
Hyllplansteglöstställbaraihöjd
Justerbarthandtag
4länkhjul125mm
Belastning: 250 kg
•
•
•
•
•
Electrogalvanisedwithshelvesinlaminate
Shelvesadjustableinheight
Adjustablehandle
4swivelcastors125mm
Capacity:250kg
Vikt (kg)
Weight
19,5
22,5
25,5
28
KM 8000-3 FLEXIBEL HYLLVAGN/FLEXIBLE SHELF TROLLEY
ART.NR.
L x B x H (mm)
LxWxH(mm) KM
KM
KM
KM
815 x 470 x 1120
945 x 470 x 1120
1195 x 470 x 1120
1395 x 470 x 1120
8000-3S
8000-3M
8000-3L
8000-3XL
Mått hyllplan LxB (mm)
SizeshelfLxW
620
750
1000
1200
x
x
x
x
425
425
425
425
Vikt (kg)
Weight
24
27,5
32
36
ART.NR.
L x B x H (mm)
LxWxH(mm) KM
KM
KM
KM
8000-3SB
8000-3MB
8000-3LB
8000-3XLB
815 x 470 x 1120
945 x 470 x 1120
1195 x 470 x 1120
1395 x 470 x 1120
•
•
•
•
•
Elförzinkadmedlaminatskivor
Hyllplansteglöstställbaraihöjd
Justerbarthandtag
4länkhjul125mm
Belastning: 250 kg
•
•
•
•
•
Electrogalvanisedwithshelvesinlaminate
Shelvesadjustableinheight
Adjustablehandle
4swivelcastors125mm
Capacity:250kg
Mått hyllplan LxB (mm) Vikt (kg)
SizeshelfLxW
Weight
620
750
1000
1200
x
x
x
x
425
425
425
425
24
27,5
32
36
KM 8000-4 FLEXIBEL HYLLVAGN/FLEXIBLE SHELF TROLLEY
ART.NR.
KM
KM
KM
KM
38
8000-4S
8000-4M
8000-4L
8000-4XL
L x B x H (mm)
LxWxH(mm)
815 x 470 x 1590
945 x 470 x 1590
1195 x 470 x 1590
1395 x 470 x 1590
Mått hyllplan LxB (mm)
SizeshelfLxW
620
750
1000
1200
x
x
x
x
425
425
425
425
Vikt (kg)
Weight
32
35,5
39,5
46,5
ART.NR.
L x B x H (mm)
LxWxH(mm)
815 x 470 x
945 x 470 x
1195 x 470 x
1395 x 470 x
1590
1590
1590
1590
Mått hyllplan LxB (mm)
SizeshelfLxW
KM
KM
KM
KM
8000-4SB
8000-4MB
8000-4LB
8000-4XLB
620
750
1000
1200
x
x
x
x
•
•
•
•
•
Elförzinkadmedlaminatskivor
Hyllplansteglöstställbaraihöjd
Justerbarthandtag
4länkhjul125mm
Belastning: 250 kg
•
•
•
•
•
Electrogalvanisedwithshelvesinlaminate
Shelvesadjustableinheight
Adjustablehandle
4swivelcastors125mm
Capacity:250kg
425
425
425
425
Vikt (kg)
Weight
32
35,5
39,5
46,5
KM 8000, 8500 TILLBEHÖR/ ACCESSORIES
ART.NR.
Produkt
Product
Vikt (kg)
Weight
KM 07401
Stege/ladder
KM 145
Skrivpulpet/Writing tablet
KM 8000-T
1 st lutande hyllplan/1pcs sloping shelf
KM 8000-3LG
Grind (säljs i par)/Wicket (sold in pair)
KM 8000-4LG
Grind (säljs i par)/Wicket (sold in pair)
KM 8000-3XLG
Grind (säljs i par)/Wicket (sold in pair)
KM 8000-4XLG
Grind (säljs i par)/Wicket (sold in pair)
* Grindarna passar till de modeller med 3 och 4 plan i storlekarna L och XL
10
1,5
2
5
5
5
5
Mesh doors suits 3 and 4 shelves models, size L and XL.
KM 145
KM 8000-T
KM 07401
KM 8500 PLOCKVAGN/ORDER PICKING TROLLEY
ART.NR.
L x B x H (mm)
LxWxH(mm)
KM
KM
KM
KM
900 x 630 x 1100
900 x 630 x 1100
1300 x 630 x 1100
1300 x 630 x 1100
8500-2M
8500-3M
8500-2L
8500-3L
Mått hyllplan LxB (mm)
SizeshelfLxW
850
850
1250
1250
x
x
x
x
630
630
630
630
Hyllplan
Shelves
2
3
2
3
Vikt (kg)
Weight
30
35
32
38
• Elförzinkadmedlaminatskiva
• 2 plan
- Höjd övre hyllplan - 770 mm
- Avstånd mellan hyllplan 520 mm
• 3 plan
- Höjd övre hyllplan - 970 mm
- Avstånd mellan hyllplan övre 320 mm,
undre 370 mm
• Kanmonterasmed3eller4länkhjul
• 4länkhjul125mmoch2fasta200mm
• Belastning:300kg
• Electro galvanised with shelves in laminate
• 2 shelves
- Height to top shelf - 770 mm
- Distance between shelves 520 mm
• 3 shelves
- Height to top shelf - 970 mm
- Distance between shelves upper 320 mm,
lower 370 mm
• Canbemountedwith3or4swivelcastors
• 4 swivel castors 125 mm and 2 fixed 200 mm
• Capacity:300kg
*KM 07401
39
KM 9000 - 2 FLEXIBEL HYLLVAGN/FLEXIBLE SHELF TROLLEY
ART.NR.
KM
KM
KM
KM
9000-2S
9000-2M
9000-2L
9000-2XL
L x B x H (mm)
LxWxH(mm)
1190
1390
1590
1790
x
x
x
x
650
650
650
650
x
x
x
x
1025
1025
1025
1025
Mått hyllplan LxB (mm)
SizeshelfLxW
1000
1200
1400
1600
x
x
x
x
600
600
600
600
Vikt (kg)
Weight
39
41
43
45
ART.NR.
L x B x H (mm)
LxWxH(mm)
1190
1390
1590
1790
x
x
x
x
650
650
650
650
x
x
x
x
1025
1025
1025
1025
Mått hyllplan LxB (mm)
SizeshelfLxW
KM
KM
KM
KM
9000-2SB
9000-4MB
9000-4LB
9000-4XLB
1000
1200
1400
1600
x
x
x
x
600
600
600
600
•
•
•
•
•
Elförzinkadmedlaminatskivor
Hyllplansteglöstställbaraihöjd
Justerbarthandtag
2fasta2länkhjul160mm
Belastning: 300 kg
•
•
•
•
•
Electrogalvanisedwithshelvesinlaminate
Shelvesadjustableinheight
Adjustablehandle
2fixed2swivelcastors160mm
Capacity:300kg
Vikt (kg)
Weight
39
41
43
45
KM 9000 - 4 FLEXIBEL HYLLVAGN/FLEXIBLE SHELF TROLLEY
ART.NR.
KM
KM
KM
KM
40
9000-4S
9000-4M
9000-4L
9000-4XL
L x B x H (mm)
LxWxH(mm)
1190
1390
1590
1790
x
x
x
x
650
650
650
650
x
x
x
x
1695
1695
1695
1695
Mått hyllplan LxB (mm)
SizeshelfLxW
1000
1200
1400
1600
x
x
x
x
600
600
600
600
Vikt (kg)
Weight
56
62
66
70
ART.NR.
KM
KM
KM
KM
9000-2SB
9000-4MB
9000-4LB
9000-4XLB
L x B x H (mm)
LxWxH(mm)
1190
1390
1590
1790
x
x
x
x
650
650
650
650
x
x
x
x
1695
1695
1695
1695
Mått hyllplan LxB (mm)
SizeshelfLxW
1000
1200
1400
1600
x
x
x
x
600
600
600
600
•
•
•
•
•
Elförzinkadmedlaminatskivor
Hyllplansteglöstställbaraihöjd
Justerbarthandtag
2fasta2länkhjul160mm
Belastning: 300 kg
•
•
•
•
•
Electrogalvanisedwithshelvesinlaminate
Shelvesadjustableinheight
Adjustablehandle
2fixed2swivelcastors160mm
Capacity:300kg
Vikt (kg)
Weight
56
62
66
70
ALLA PRODUKTER PÅ LAGER!
ALL PRODUCTS IN STOCK!
Konga Mekaniskas trådvagnar är väl lämpade för miljöer där du ej vill att damm skall lägga sig på
hyllplanen. Här finner du ett heltäckande erbjudande vad gäller storlek och modell.
You will find that our Net/Mesh Trolleys are well suited in environments where it is a lot of dust and you
don’t want it to land on the shelves. You can find that our assortment is comprehensive in different sizes
and models.
T 018-18 68 80
E [email protected]
I www.ergoff.se
aranti Wa
r
•G
ANTEE
GUAR
5
• Garan
nty
t
ra
ti Warrant
y
ran
ÅTERFÖRSÄLJARE: ERGOFF MILJÖ AB
Hållnäsgatan 5
752 28 Uppsala
years
arranty • Ga
iW
Symbolen/The symbol = Denna produkt
levereras i platt paket/This product will be
deliveredinflatpack
5-års garanti på alla våra vagnar/
5 years warranty for all of our Trolleys
2 bromsade hjul/2 wheels with
brakes EN 1757-3
Trådvagnar
Net/Mesh Trolleys
41-47
41
KM 4202-E BUTIKSVAGN/IN STORE TROLLEY
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 4202-E
860 x 530 x 1010
Vikt (kg)
Weight
19,5
•
•
•
•
•
•
Elförzinkad,klarlackadochstackningsbar
Höjdtillövrehyllplan735mm
Avståndmellanhyllplan540mm
Belastningövrehyllplan100kg
4länkhjul125mm
Belastning:300kg
•
•
•
•
•
•
Electrogalvanised,clearcoatedandstackable
Heighttotopshelf735mm
Distancebetweenshelves540mm
Capacitytopshelf100kg
4swivelcastors125mm
Capacity:300kg
KM 4202-F BUTIKSVAGN/IN STORE TROLLEY
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 4202-F
960 x 525 x 1030
Vikt (kg)
Weight
35,5
• Elförzinkad,klarlackadochstackningsbar
• Högstahöjdövrehyllplan810,
lägsta höjd 390 mm
• Avståndmellanhyllplan610mm
• Fjädrandeöverhyllavidbelastningen0-100kg.
Vid 100 kg har hyllan nått sitt lägsta läge.
• 4länkhjul125mm
• Belastning:300kg
• Electrogalvanised,clearcoatedandstackable
• Highesthighttotopshelf810,lowest
height 390 mm
• Distancebetweenshelves610mm
• Thetopshelfisself leveling at 0-100 kg.
At 100 kg the top shelf has come to the
lowest position
• 4 swivel castors 125 mm
• Capacity:300kg
KM 4202-E3 BUTIKSVAGN/IN STORE TROLLEY
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 4202-E3
890 x 520 x 1000
42
Vikt (kg)
Weight
20
•
•
•
•
•
Elförzinkad,klarlackadochstackningsbar
Ställbarthyllplanpåhöjderna,460,580och710mm
Belastningövrehyllplan100kg
4länkhjul125mm
Belastning:300kg
•
•
•
•
•
Electrogalvanised,clearcoatedandstackable
Adjustableshelfinheights,460,580and710mm
Capacitytopshelf100kg
4 swivel castors 125 mm
Capacity:300kg
KM 4202-K BUTIKSVAGN/IN STORE TROLLEY
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 4202-K
870 x 530 x 1010
Vikt (kg)
Weight
20,5
•
•
•
•
•
•
Elförzinkad,klarlackadochstackningsbar
Avståndmellanhyllplan430mm
Invändigtmåttpåkorg:700x320x110mm
Belastningövrehyllplan100kg
4länkhjul125mm
Belastning:300kg
•
•
•
•
•
•
Electrogalvanised,clearcoatedandstackable
Distancebetweenshelves430mm
Insidedimensionsbasket:700x320x110mm
Capacitytopshelf:100kg
4 swivel castors 125 mm
Capacity:300kg
KM 4202-SERIEN TILLBEHÖR/ACCESSORIES
ART.NR.
Tillbehör
Accessories
Passar till modell
Suits model
L x B x H (mm)
L x B x H (mm)
KM 07401
KM 1800496221
Stege/ladder
Papperskorg/Waste basket
KM 4202-E, KM 4202-E3, KM 4202-K
KM 4202-E, KM 4202-K
540 x 480 x 670
270 x 560 x 680
Vikt (kg)
Weight
10
3
Stege
• Elförzinkad
• Stegmedhalkskydd
• Gasdämpareförsmidigochmjukhantering
• Belastning:130kg
Ladder
• Electrogalvanized
• Protectionsurfacethatpreventsslippering
• Gas absorber for soft and easy handling
• Capacity:130kg
KM 153-HT MINIVAGN/MINI TROLLEY
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 153-HT
660 x 385 x 1090
Vikt (kg)
Weight
12,5
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 153-HTB
660 x 385 x 1090
Vikt (kg)
Weight
12,5
• Elförzinkadmedlamineradehyllplan
•Enhyllaochentrådkorg,steglöstställbara
•Hyllansmått410x355
•Trådkorgensmått415x355x220mm
• 4länkhjul,100mm
• Belastning:35kg
•
•
•
•
•
•
Electrogalvanisedwithlaminateshelves
Oneshelfandonethreadbasket,adjustable
Sizeofshelf410x355
Sizeofthreadbasket415x355x220mm
4swivelcastors,100mm
Capacity:35kg
43
KM 153-TT MINIVAGN/MINI TROLLEY
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 153-TT
660 x 385 x 1090
Vikt (kg)
Weight
12,5
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 153-TTB
660 x 385 x 1090
Vikt (kg)
Weight
12,5
• Elförzinkad
•Tvåtrådkorgar,steglöstställbara
•Trådkorgensmått415x355x220mm
• 4länkhjul,100mm
• Belastning:35kg
•
•
•
•
•
Electrogalvanised
Twothreadbaskets,adjustable
Sizeofthreadbasket415x355x220mm
4swivelcastors,100mm
Capacity:35kg
KM 153-HH MINIVAGN/MINI TROLLEY
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 153-HH
660 x 385 x 1090
Vikt (kg)
Weight
13
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 153-HHB
660 x 385 x 1090
Vikt (kg)
Weight
13
• Elförzinkadmedlamineradehyllplan
•Tvåhyllplan,steglöstställbara
•Hyllplanetsmått410x355mm
• 4länkhjul,100mm
• Belastning:35kg
•
•
•
•
•
Electrogalvanisedwithlaminateshelves
Twoshelves,adjustable
Sizeofshelves410x355mm
4swivelcastors,100mm
Capacity:35kg
KM 153-H MINIVAGN/MINI TROLLEY
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 153-H
660 x 385 x 1090
Vikt (kg)
Weight
10
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 153-HB
660 x 385 x 1090
Vikt (kg)
Weight
10
• Elförzinkadmedlaminerathyllplan
•Hyllplan,steglöstställbart
•Hyllplanetsmått410x355mm
• 4länkhjul,100mm
• Belastning:35kg
•
•
•
•
•
44
Electrogalvanisedwithlaminateshelf
Shelf,adjustable
Sizeofshelf410x355mm
4swivelcastors100mm
Capacity:35kg
KM 153-T MINIVAGN/MINI TROLLEY
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 153-T
660 x 385 x 1090
Vikt (kg)
Weight
10
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 153-TB
660 x 385 x 1090
Vikt (kg)
Weight
10
• Elförzinkadmedtrådkorg
•Entrådkorg,steglöstställbar
•Trådkorgensmått415x355x220mm
• 4länkhjul,100mm
• Belastning:35kg
•
•
•
•
•
Electrogalvanisedwiththreadbasket
Onethreadbasket,adjustable
Sizeofthreadbasket415 x 355 x 220 mm
4swivelcastors100mm
Capacity:35kg
KM 4404-R NÄTVAGN/NET BASKET
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 4404-R
700 x 700 x 900
Vikt (kg)
Weight
9
•Elförzinkatutförande
• 3 länkhjul 100 mm
• Belastning:100kg
• Electro galvanised
• 3 swivel castors 100 mm
• Capacity:100kg
KM 4404-K, 4404-L NÄTVAGN/NET BASKET
ART.NR.
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
KM 4404-K
KM 4404-L(Lock/Lid)
835 x 625 x 740
830 x 620
12
2
•Elförzinkadochklarlackad
• 4 länkhjul, varav 2 med broms100 mm
• Belastning:100kg
• Electro galvanised and clear coated
• 4 swivel castors, 2 with brakes 100 mm
• Capacity:100kg
45
KM 4404-KP, 4404-L NÄTVAGN/NET BASKET
ART.NR.
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
KM 4404-KP
KM 4404-L (Lock/Lid)
835 x 625 x 740
830 x 620
15,5
2
•Elförzinkatutförande
• 4 länkhjul, varav 2 med broms100 mm
• Belastning:100kg
• Electro galvanised
• 4 swivel castors, 2 with brakes 100 mm
• Capacity:100kg
KM 197 NÄTVAGN/NET BASKET
ART.NR.
KM 197
Färg
Colour
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
Vit/White
800 x 600 x 915
9
•Pulverlackeradnätvagnmedlock
• Korgensmått770x570x430mm
• 4 länkhjul 100 mm
• Belastning:150kg
•
•
•
•
Powder coated net basket with lid
Sizeofbasket770x570x430mm
4 swivel castors 100 mm
Capacity:150kg
KM 198 NÄTVAGN/NET BASKET
ART.NR
KM 198
Färg
Colour
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
Blå/Blue
800 x 600 x 915
9
•Pulverlackeradnätvagnmedlock
• Korgensmått770x570x430mm
• 4 länkhjul 100 mm
• Belastning:150kg
•
•
•
•
46
Powder coated net basket with lid
Sizeofbasket770x570x430mm
4 swivel castors 100 mm
Capacity:150kg
KM 111013 BUTIKSVAGN/IN STORE TROLLEY
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 111013
560 x 260/415 x 975
Vikt (kg)
Weight
9
•Elförzinkadochklarlackad
• Levererasutankorgar
• 4 länkhjul 100 mm
• Belastning:60kg
•
•
•
•
Electro galvanised and clear coated
Deliveredwithoutbaskets
4 swivel castors 100 mm
Capacity:60kg
ART.NR.
Produkt
Product
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
KM 3261-R Kundkorg röd/ 475 x 325 x 250
Basket red
Volym: 27 l/Volume: 27 l
0,7
KM 4303-K ALLROUNDVAGN/ALLROUND TROLLEY
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 4303-K
690 x 410 x 950
Vikt (kg)
Weight
12,5
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 4303-KB
690 x 410 x 950
Vikt (kg)
Weight
12,5
• Elförzinkad
•Höjdtillövrekorgenskant925mm •Övrekorgensstorlek605x400,djup360mm
•Undrekorgensstorlek605x400,djup110mm
•Avståndmellankorgarna300mm
• 4länkhjul,100mm
• Belastning:100kg
•
•
•
•
•
•
•
Electrogalvanised
Heighttotopbasket925mm
Sizeoftopbasket605x400,depth360mm
Sizeoflowerbasket605x400,depth110mm
Distancebetweenbaskets300mm
4swivelcastors,100mm
Capacity:100kg
KM 203110 BUTIKSVAGN/IN STORE TROLLEY
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 203110
1320 x 430 x 1120
Vikt (kg)
Weight
23,5
•Elförzinkadochklarlackad
•Höjdtillövrehyllplan715mm
•Avståndmellanhyllplan475mm
•2fastaoch4länkhjul125mm
•Belastning:400kg
•
•
•
•
•
Electrogalvanisedandclearcoated
Height to top shelf 715 mm
Distancebetweenshelves475mm
2fixedand4swivelcastors125mm
Capacity:400kg
47
ALLA PRODUKTER PÅ LAGER!
ALL PRODUCTS IN STOCK!
For heavy and demanding transports we have the best solutions. Choose your trolley
amongst our wide assortment of sizes, colours and finish options.
T 018-18 68 80
E [email protected]
I www.ergoff.se
ti Warrant
y
ran
ÅTERFÖRSÄLJARE: ERGOFF MILJÖ AB
Hållnäsgatan 5
752 28 Uppsala
aranti Wa
r
•G
TEE
AN
GUAR
5
years
arranty • Ga
iW
48
För tunga krävande transporter har Konga Mekaniska lösningen. Välj bland olika storlekar,
färg och ytbehandlingsalternativ.
• Garan
nty
t
ra
Tunga vagnar
Heavy Duty Trolleys
48-69
Symbolen/The symbol = Denna produkt
levereras i platt paket/This product will be
deliveredinflatpack
5-års garanti på alla våra vagnar/
5 years warranty for all of our Trolleys
2 bromsade hjul/2 wheels with
brakes EN 1757-3
KM 439 MATERIAL, TRANSPORTVAGN/MATERIAL, TRANSPORT TROLLEY
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 439
1250 x 700 x 945
Vikt (kg)
Weight
ART.NR.
L x B x H (mm)
L x W x H (mm)
44
KM 439B
1250 x 700 x 945
Vikt (kg)
Weight
44
•Elförzinkadplåt
•Platsför7byglar
•Levererasmed2byglar
•Höjdtillplattform265mm
• Avståndmellanbyglar77mm
• 2fasta,2länkmassivagummihjul200x50mm
• Belastning:500kg
•
•
•
•
•
•
•
Electrogalvanisedsheetmetal
Spacefor7loadbars
Comeswith2loadbars
Heigttoplatform265mm
Distancebetweenloadbars77mm
2fixed2swivelcastorssolidrubber200x50mm
Capacity:500kg
KM 439 TILLBEHÖR/ACCESSORIES
ART.NR.
KM 439-L
KM 439-S
KM 139-33
Produkt
Product
L x B x H (mm)
L x W x H (mm)
Lådsats/Box
Vägg/Panel
Bygel/Loadbar
1200 x 275 x 50
1100 x 400
710 x 870
•3mmelförzinkadplåtinkl.4strör
•Höjdfrånflaktillovandellåda 650 mm
Vikt (kg)
Weight
14
3
3
•Material:Lamineradskiva
•1stgavelsidatillbefintligbygel
inkl. monteringsbeslag
• Material:Laminated shelf
• 1paneltoexistingloadbar,
including mounting brackets
• 3 mm electro galvanised steel
incl. 4 pipes
• Heightfromplatformtotopof
the box 650 mm
KM 539 SKIVVAGN/BOARD TROLLEY
ART.NR.
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
ART.NR.
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
KM 539
890 x 800 x 940
33
KM 539B
890 x 800 x 940
33
•Elförzinkadmedplattaavlaminat •Platsför9byglar
•Levererasmed2byglar
•Höjdtilllastplan390mm
• Avståndmellanbyglar64mm
• 2fasta,2länkmassivagummihjul200x50mm
• Belastning:500kg
•
•
•
•
•
•
•
Electrogalvanisedwithplatformoflaminate
Spacefor9loadbars
Comeswith2loadbars
Heighttoplatform390mm
Distancebetweenloadbars64mm
2fixed2swivelcastorssolidrubber200x50mm
Capacity:500kg
•
KM 539 TILLBEHÖR/ACCESSORIES
ART.NR.
Produkt
Product
B x H (mm)
W x H (mm)
KM 139-11
Bygel/Loadbar
710 x 870
Vikt (kg)
Weight
2
49
KM 130 PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 130-1
KM 130-2
KM 130-3
900 x 600 x 300
1000 x 700 x 300
1200 x 800 x 300
Vikt (kg)
Weight
ART.NR.
29,5
33,5
34
KM 130-1B
KM 130-2B
KM 130-3B
L x B x H (mm)
L x W x H (mm)
900 x 600 x 300
1000 x 700 x 300
1200 x 800 x 300
Vikt (kg)
Weight
29,5
33,5
34
•
•
•
•
Elförzinkadmedlaminatskiva
Höjdtilllastplan300mm
2fasta,2länkmassivagummihjul200x50mm
Belastning:800kg
•
•
•
•
Electrogalvanisedwithlaminateshelf
Heigttoplatform300mm
2fixed2swivelcastorssolidrubber200x50mm
Capacity:800kg
KM 132 PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 132-1
KM 132-2
KM 132-3
900 x 600 x 960
1000 x 700 x 960
1200 x 800 x 960
Vikt (kg)
Weight
32
37
41
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 132-1B
KM 132-2B
KM 132-3B
900 x 600 x 960
1000 x 700 x 960
1200 x 800 x 960
Vikt (kg)
Weight
32
37
41
•
•
•
•
•
•
Elförzinkadmedlaminatskiva
Höjdtilllastplan300mm
Gavelskiva i laminat, höjd 400 mm
Byglar30mmstålrör
2fasta,2länkmassivagummihjul200x50mm
Belastning:800kg
•
•
•
•
•
•
Electrogalvanisedwithlaminateshelf
Heighttoplatform300mm
End panel in laminate, height 400 mm
Handles30mmsteelpipe
2fixed2swivelcastorssolidrubber200x50mm
Capacity:800kg
KM 133 PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
KM 133-1
KM 133-2
KM 133-3
900 x 600 x 960
1000 x 700 x 960
1200 x 800 x 960
36
40
43
50
ART.NR.
KM 133-1B
KM 133-2B
KM 133-3B
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
900 x 600 x 960
1000 x 700 x 960
1200 x 800 x 960
36
40
43
•
•
•
•
•
•
Elförzinkadmedlaminatskiva
Höjdtilllastplan300mm
Gavelskivor i laminat, höjd 400 mm
Byglar30mmstålrör
2fasta,2länkmassivagummihjul200x50mm
Belastning:800kg
•
•
•
•
•
•
Electrogalvanisedwithlaminateshelf
Heighttoplatform300mm
End panels in laminate, height 400 mm
Handles30mmsteelpipe
2fixed2swivelcastorssolidrubber200x50mm
Capacity:800kg
KM 135 PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 135-1
KM 135-2
KM 135-3
900 x 600 x 960
1000 x 700 x 960
1200 x 800 x 960
Vikt (kg)
Weight
44,5
49
54
ART.NR.
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
KM 135-1B
KM 135-2B
KM 135-3B
900 x 600 x 960
1000 x 700 x 960
1200 x 800 x 960
44,5
49
54
•
•
•
•
•
•
Elförzinkadmedlaminatskivor
Höjdtilllastplan300mm
Gavelskivor i laminat, höjd 400 mm
Byglar30mmstålrör
2fasta,2länkmassivagummihjul200x50mm
Belastning:800kg
•
•
•
•
•
•
Electrogalvanisedwithlaminateshelf
Heighttoplatform300mm
End panels in laminate, height 400 mm
Handles30mmsteelpipe
2fixed2swivelcastorssolidrubber200x50mm
Capacity:800kg
KM 137 PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 137-1
KM 137-2
KM 137-3
1035 x 600 x 920
1135 x 700 x 920
1335 x 800 x 920
Vikt (kg)
Weight
49,5
56,5
65
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 137-1B
KM 137-2B
KM 137-3B
1035 x 600 x 920
1135 x 700 x 920
1335 x 800 x 920
Vikt (kg)
Weight
49,5
56,5
65
•
•
•
•
•
•
Elförzinkadmedlaminatskivor
Höjdtilllastplan300mm
Avståndmellanhyllplan520mm
Mellanrör30mmstålrör
2fasta,2länkmassivagummihjul200x50mm
Belastning:800kg
•
•
•
•
•
•
Electrogalvanisedwithlaminateshelves
Heighttoplatform300mm
Distancebetweenshelves520mm
Tubes30mmsteelpipe
2fixed2swivelcastorssolidrubber200x50mm
Capacity:800kg
KM 139 PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 139-1
KM 139-2
KM 139-3
900 x 600 x 960
1000 x 700 x 960
1200 x 800 x 960
Vikt (kg)
Weight
35
39
44,5
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 139-1B
KM 139-2B
KM 139-3B
900 x 600 x 920
1000 x 700 x 920
1200 x 800 x 920
Vikt (kg)
Weight
35
39
44,5
•
•
•
•
•
Elförzinkadmedlaminatskiva
Höjdtilllastplan300mm
Inkl.2byglar:30mmstålrör
2fasta,2länkmassivagummihjul200x50mm
Belastning:800kg
•
•
•
•
•
Electrogalvanisedwithlaminateshelf
Heighttoplatform300mm
Incl.2loadbars:30mmsteelpipe
2fixed2swivelcastorssolidrubber200x50mm
Capacity:800kg
KM 139 TILLBEHÖR/ACCESSORIES
ART.NR.
Produkt
Product
B x H (mm)
W x H (mm)
Avstånd mellan byglar
Distance between load bars
Vikt (kg)
KM 139-11
KM 139-22
KM 139-33
Bygel/Loadbar
Bygel/Loadbar
Bygel/Loadbar
710 x 870
710 x 970
710 x 1170
60 mm
76 mm
95 mm
2
2,5
3
Weight
51
ALLA PRODUKTER PÅ LAGER!
ALL PRODUCTS IN STOCK!
En serie stora vagnar för både inom och utomhusbruk.
A serie of large trolleys that you can use indoors and outdoors.
ti Warrant
y
ran
ÅTERFÖRSÄLJARE: ERGOFF MILJÖ AB
Hållnäsgatan 5
752 28 Uppsala
T 018-18 68 80
E [email protected]
I www.ergoff.se
aranti Wa
r
•G
ANTEE
GUAR
5
years
arranty • Ga
iW
70
Märkt
Marked
• Garan
nty
t
ra
Stora vagnar
Large Material Trolleys
70-73
Symbolen/The symbol = Denna produkt
levereras i platt paket/This product will be
deliveredinflatpack
5-års garanti på alla våra vagnar/
5 years warranty for all of our Trolleys
2 bromsade hjul/2 wheels with
brakes EN 1757-3
KM 230 PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
KM 232-2
KM 232-3
Blå/Blue
Blå/Blue
1000 x 700 x 1020
1200 x 800 x 1020
Vikt (kg)
Weight
29,5
34
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
KM 232-2B
KM 232-3B
Blå/Blue
Blå/Blue
1000 x 700 x 1020
1200 x 800 x 1020
Vikt (kg)
Weight
29,5
34
•Pulverlackeradmedlaminatskiva
• Höjdtilllastplan260mm
• Nätgavel - höjd 520 mm
• Byglar25mmstålrör
• 2fasta,2länkmassivagummihjul200x50mm
• Belastning:500kg
•
•
•
•
•
•
Powdercoatedwithlaminateshelf
Heighttoplatform260mm
Mesh side - height 520 mm
Handles25mmsteelpipe
2fixed2swivelcastorssolidrubber200x50mm
Capacity:500kg
KM 233 PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
L x W x H (mm)
KM 233-2
KM 233-3
Blå/Blue
Blå/Blue
1000 x 700 x 1020
1200 x 800 x 1020
Vikt (kg)
Weight
34,5
38,5
ART.NR.
Färg
Colour
L x B x H (mm)
L x W x H (mm)
KM 233-2B
KM 233-3B
Blå/Blue
Blå/Blue
1000 x 700 x 1020
1200 x 800 x 1020
Vikt (kg)
Weight
34,5
38,5
•Pulverlackeradmedlaminatskiva
• Höjdtilllastplan260mm
• Nätgavlar - höjd 520 mm
• Byglar25mmstålrör
• 2fasta,2länkmassivagummihjul200x50mm
• Belastning:500kg
•
•
•
•
•
•
Powdercoatedwithlaminateshelf
Heighttoplatform260mm
Mesh sides - height 520 mm
Handles25mmsteelpipe
2fixed2swivelcastorssolidrubber200x50mm
Capacity:500kg
KM 234 PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
L x W x H (mm)
KM 234-2
KM 234-3
Blå/Blue
Blå/Blue
1000 x 700 x 1020
1200 x 800 x 1020
Vikt (kg)
Weight
37,5
43
ART.NR.
Färg
Colour
L x B x H (mm)
L x W x H (mm)
KM 234-2B
KM 234-3B
Blå/Blue
Blå/Blue
1000 x 700 x 1020
1200 x 800 x 1020
Vikt (kg)
Weight
37,5
43
•Pulverlackeradmedlaminatskiva
• Höjdtilllastplan260mm
• Nätgavlar - höjd 520 mm
• Byglar25mmstålrör
• 2fasta,2länkmassivagummihjul200x50mm
• Belastning:500kg
•
•
•
•
•
•
Powdercoatedwithlaminateshelf
Heighttoplatform260mm
Mesh sides - height 520 mm
Handles25mmsteelpipe
2fixed2swivelcastorssolidrubber200x50mm
Capacity:500kg
53
KM 235 PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
L x W x H (mm)
KM 235-2
KM 235-3
Blå/Blue
Blå/Blue
1000 x 700 x 1020
1200 x 800 x 1020
Vikt (kg)
Weight
41,5
46,5
ART.NR.
Färg
Colour
L x B x H (mm)
L x W x H (mm)
KM 235-2B
KM 235-3B
Blå/Blue
Blå/Blue
1000 x 700 x 1020
1200 x 800 x 1020
Vikt (kg)
Weight
41,5
46,5
•Pulverlackeradmedlaminatskiva
• Höjdtilllastplan260mm
• Nätgavlar - höjd 520 mm
• Byglar25mmstålrör
• 2fasta,2länkmassivagummihjul200x50mm
• Belastning:500kg
•
•
•
•
•
•
Powdercoatedwithlaminateshelf
Heighttoplatform260mm
Mesh sides - height 520 mm
Handles25mmsteelpipe
2fixed2swivelcastorssolidrubber200x50mm
Capacity:500kg
KM 236 PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
L x W x H (mm)
KM 236-2
KM 236-3
Blå/Blue
Blå/Blue
1000 x 700 x 900
1200 x 800 x 900
Vikt (kg)
Weight
35,5
41,5
ART.NR.
Färg
Colour
L x B x H (mm)
L x W x H (mm)
KM 236-2B
KM 236-3B
Blå/Blue
Blå/Blue
1000 x 700 x 900
1200 x 800 x 900
Vikt (kg)
Weight
35,5
41,5
•Pulverlackeradmedlaminatskiva
• Höjdtilllastplan260mm
• Nätgavlar - höjd 520 mm
• Byglar25mmstålrör
• 2fasta,2länkmassivagummihjul200x50mm
• Belastning:500kg
•
•
•
•
•
•
Powdercoatedwithlaminateshelf
Heighttoplatform260mm
Mesh sides - height 520 mm
Handles25mmsteelpipe
2fixed2swivelcastorssolidrubber200x50mm
Capacity:500kg
KM 330 PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
L x W x H (mm)
KM 330-2
KM 330-3
Blå/Blue
Blå/Blue
1000 x 700 x 260
1200 x 800 x 260
Vikt (kg)
Weight
24,5
28,5
ART.NR.
Färg
Colour
L x B x H (mm)
L x W x H (mm)
KM 330-2B
KM 330-3B
Blå/Blue
Blå/Blue
1000 x 700 x 260
1200 x 800 x 260
Vikt (kg)
Weight
24,5
28,5
•Pulverlackeradmedlaminatskiva
• Höjdtilllastplan260mm
• 2fasta,2länk massiva gummihjul 200 x 50 mm
• Belastning:500kg
•
•
•
•
54
Powdercoatedwithlaminateshelf
Heighttoplatform260mm
2fixed2swivelcastorssolid rubber 200 x 50 mm
Capacity:500kg
KM 331 PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
L x W x H (mm)
KM 331-2
KM 331-3
Blå/Blue
Blå/Blue
1000 x 700 x 900
1200 x 800 x 900
Vikt (kg)
Weight
26,5
30
ART.NR.
Färg
Colour
L x B x H (mm)
L x W x H (mm)
KM 331-2B
KM 331-3B
Blå/Blue
Blå/Blue
1000 x 700 x 900
1200 x 800 x 900
Vikt (kg)
Weight
26,5
30
•Pulverlackeradmedlaminatskiva
• Höjdtilllastplan260mm
• Byglar25mmstålrör
• 2fasta,2länkmassivagummihjul200x50mm
• Belastning:500kg
•
•
•
•
•
Powdercoatedwithlaminateshelf
Heighttoplatform260mm
Handles25mmsteelpipe
2fixed2swivelcastorssolidrubber200x50mm
Capacity:500kg
KM 332 PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
L x W x H (mm)
KM 332-2
KM 332-3
Blå/Blue
Blå/Blue
1000 x 700 x 900
1200 x 800 x 900
Vikt (kg)
Weight
28,5
32,5
ART.NR.
Färg
Colour
L x B x H (mm)
L x W x H (mm)
KM 332-2B
KM 332-3B
Blå/Blue
Blå/Blue
1000 x 700 x 900
1200 x 800 x 900
Vikt (kg)
Weight
28,5
32,5
•Pulverlackeradmedlaminatskiva
• Höjdtilllastplan260mm
• Gavelskiva i laminat, höjd 400 mm
• Byglar25mmstålrör
• 2fasta,2länkmassivagummihjul200x50mm
• Belastning:500kg
•
•
•
•
•
•
Powdercoatedwithlaminateshelf
Heighttoplatform260mm
End panel in laminate, height 400 mm
Handles25mmsteelpipe
2fixed2swivelcastorssolidrubber200x50mm
Capacity:500kg
KM 333 PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
L x W x H (mm)
KM 333-2
KM 333-3
Blå/Blue
Blå/Blue
1000 x 700 x 900
1200 x 800 x 900
Vikt (kg)
Weight
32,5
37,5
ART.NR.
Färg
Colour
L x B x H (mm)
L x W x H (mm)
KM 333-2B
KM 333-3B
Blå/Blue
Blå/Blue
1000 x 700 x 900
1200 x 800 x 900
Vikt (kg)
Weight
32,5
37,5
•Pulverlackeradmedlaminatskiva
• Höjdtilllastplan260mm
• Gavelskivor i laminat, höjd 400 mm
• Byglar25mmstålrör
• 2fasta,2länkmassivagummihjul200x50mm
• Belastning:500kg
•
•
•
•
•
•
Powdercoatedwithlaminateshelf
Heighttoplatform260mm
End panels in laminate, height 400 mm
Handles25mmsteelpipe
2fixed2swivelcastorssolidrubber200x50mm
Capacity:500kg
55
KM 335L PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
KM 335-2L
KM 335-3L
Blå/Blue
Blå/Blue
1000 x 700 x 900
1200 x 800 x 900
33
37
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
KM 335-2LB
KM 335-3LB
Blå/Blue
Blå/Blue
1000 x 700 x 900
1200 x 800 x 900
33
37
•Pulverlackeradmedlaminatskivor
• Höjdtilllastplan260mm
• Gavelskivorilaminat,höjd200mm
• Byglar25mmstålrör
• 2fasta,2länkmassivagummihjul200x50mm
• Belastning:500kg
•
•
•
•
•
•
Powdercoatedwithlaminateshelf
Height to platform 260 mm
End panels in laminate, height 200 mm
Handles25mmsteelpipe
2fixed2swivelcastorssolidrubber200x50mm
Capacity:500kg
KM 335H PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
KM 335-2H
KM 335-3H
Blå/Blue
Blå/Blue
1000 x 700 x 900
1200 x 800 x 900
Vikt (kg)
Weight
38
44
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
KM 335-2HB
KM 335-3HB
Blå/Blue
Blå/Blue
1000 x 700 x 900
1200 x 800 x 900
38
44
•Pulverlackeradmedlaminatskivor
• Höjdtilllastplan260mm
• Gavelskivor i laminat höjd 400 mm
• Byglar25mmstålrör
• 2fasta,2länkmassivagummihjul200x50mm
• Belastning:500kg
•
•
•
•
•
•
Powdercoatedwithlaminateshelfs
Height to platform 260 mm
Endpanels in laminate, height 400 mm
Handles25mmsteelpipe
2fixed2swivelcastorssolidrubber200x50mm
Capacity:500kg
KM 336 PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
KM 336-2
KM 336-3
Blå/Blue
Blå/Blue
1000 x 700 x 900
1200 x 800 x 900
Vikt (kg)
Weight
34,5
40
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
KM 336-2B
KM 336-3B
Blå/Blue
Blå/Blue
1000 x 700 x 900
1200 x 800 x 900
34,5
40
•Pulverlackeradmedlaminatskivor
• Höjdtilllastplan260mm
• Gavelskivor i laminat, höjd 400 mm
• Byglar25mmstålrör
• 2fasta,2länkmassivagummihjul200x50mm
• Belastning:500kg
•
•
•
•
•
•
56
Powdercoatedwithlaminateshelfs
Height to platform 260 mm
End panels in laminate, height 400 mm
Handles25mmsteelpipe
2fixed2swivelcastorssolidrubber200x50mm
Capacity:500kg
KM 337 PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
KM 337-2
KM 337-3
Blå/Blue
Blå/Blue
1100 x 700 x 870
1300 x 800 x 870
39
46
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
KM 337-2B
KM 337-3B
Blå/Blue
Blå/Blue
1100 x 700 x 870
1300 x 800 x 870
Vikt (kg)
Weight
39
46
•Pulverlackeradmedlaminatskivor
• Avståndmellanhyllplan580mm
• Mellanrör25mmstålrör
• 2fasta,2länkmassivagummihjul200x50mm
• Belastning:500kg
•
•
•
•
•
Powdercoatedwithlaminateshelfs
Distancebetweenshelves580mm
Tubes25mmsteelpipe
2fixed2swivelcastorssolidrubber200x50mm
Capacity:500kg
KM 338 PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
KM 338-2
KM 338-3
Blå/Blue
Blå/Blue
1000 x 700 x 1820
1200 x 800 x 1820
Vikt (kg)
Weight
70
88,5
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
KM 338-2B
KM 338-3B
Blå/Blue
Blå/Blue
1000 x 700 x 1820
1200 x 800 x 1820
Vikt (kg)
Weight
70
88,5
•Pulverlackeradmedlaminatskivor
• Levererasmed4sthyllplan
• Fasthandtagpåhöjd1040mm
• Avståndfrånbottenplattatillförstagejdern300mm
• 300mmmellangejdrarna
• 2fasta,2länkmassivagummihjul200x50mm
• Belastning:100 kg/hylla
• Belastning:500kg
•
•
•
•
•
•
•
•
Powdercoatedwithlaminateshelfs
Comeswith4shelves
Fixedhandleatheightof1040mm
Distancefrombottomtofirstrail300mm
300mmbetweenrails
2fixed2swivelcastorssolidrubber200x50mm
Capacity:100kg/shelf
Capacity:500kg
KM 430 PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
KM 430-2
KM 430-3
Blå/Blue
Blå/Blue
1000 x 700 x 260
1200 x 800 x 260
34
41,5
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
KM 430-2B
KM 430-3B
Blå/Blue
Blå/Blue
1000 x 700 x 260
1200 x 800 x 260
34
41,5
•Pulverlackeradmedlaminatskiva
• Höjdtilllastplan260mm
• Bottenmed2mmgalvaniseradstålplåt
• 2fasta,2länkmassivagummihjul200x50mm
• Belastning:500kg
•
•
•
•
•
Powder coated with laminate shelf
Height to platform 260 mm
Bottomwith2mmgalvanisedsteel
2fixed2swivelcastorssolidrubber200x50mm
Capacity:500kg
57
KM 431 PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
KM 431-2
KM 431-3
Blå/Blue
Blå/Blue
1000 x 700 x 900
1200 x 800 x 900
36
43,5
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
KM 431-2B
KM 431-3B
Blå/Blue
Blå/Blue
1000 x 700 x 900
1200 x 800 x 900
36
43,5
•Pulverlackeradmedlaminatskiva
• Höjdtilllastplan260mm
• Bottenmed2mmgalvaniseradstålplåt
• Byglar25mmstålrör
• 2fasta,2länkmassivagummihjul200x50mm
• Belastning:500kg
•
•
•
•
•
•
Powder coated with laminate shelf
Height to platform 260 mm
Bottomwith2mmgalvanisedsteel
Handles25mmsteelpipe
2fixed2swivelcastorssolidrubber200x50mm
Capacity:500kg
KM 432 PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
KM 432-2
KM 432-3
Blå/Blue
Blå/Blue
1000 x 700 x 900
1200 x 800 x 900
38
46,5
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
KM 432-2B
KM 432-3B
Blå/Blue
Blå/Blue
1000 x 700 x 900
1200 x 800 x 900
38
46,5
•Pulverlackeradmedlaminatskiva
• Höjdtilllastplan260mm
• Bottenmed2mmgalvaniseradstålplåt
• Gavelskivailaminat,höjd400mm
• Byglar25mmstålrör
• 2fasta,2länkmassivagummihjul200x50mm
• Belastning:500kg
•
•
•
•
•
•
•
Powder coated with laminate shelf
Height to platform 260 mm
Bottomwith2mmgalvanisedsteel
Endpanelinlaminate,height400mm
Handles25mmsteelpipe
2fixed2swivelcastorssolidrubber200x50mm
Capacity:500kg
KM 433 PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
KM 433-2
KM 433-3
Blå/Blue
Blå/Blue
1000 x 700 x 900
1200 x 800 x 900
42
50,5
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
KM 433-2B
KM 433-3B
Blå/Blue
Blå/Blue
1000 x 700 x 900
1200 x 800 x 900
42
50,5
•Pulverlackeradmedlaminatskiva
• Höjdtilllastplan260mm
• Bottenmed2mmgalvaniseradstålplåt
• Gavelskivorilaminat,höjd400mm
• Byglar25mmstålrör
• 2fasta,2länkmassivagummihjul200x50mm
• Belastning:500kg
•
•
•
•
•
•
•
58
Powder coated with laminate shelf
Height to platform 260 mm
Bottomwith2mmgalvanisedsteel
Endpanelsinlaminate,height400mm
Handles25mmsteelpipe
2fixed2swivelcastorssolidrubber200x50mm
Capacity:500kg
KM 435L PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
KM 435-2L
KM 435-3L
Blå/Blue
Blå/Blue
1000 x 700 x 900
1200 x 800 x 900
42
50,5
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
KM 435-2LB
KM 435-3LB
Blå/Blue
Blå/Blue
1000 x 700 x 900
1200 x 800 x 900
42
50,5
•Pulverlackerad med laminatskiva
• Höjdtilllastplan260mm
•Botten med 2 mm galvaniserad stålplåt
• Gavelskivorilaminat,höjd200mm
• Byglar25mmstålrör
• 2fasta,2länkmassivagummihjul200x50mm
• Belastning:500kg
•
•
•
•
•
•
•
Powder coated with laminate shelf
Height to platform 260 mm
Bottom with 2 mm galvanised steel
Panels in laminate, height 200 mm
Handles25mmsteelpipe
2fixed2swivelcastorssolidrubber200x50mm
Capacity:500kg
KM 435H PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
KM 435-2H
KM 435-3H
Blå/Blue
Blå/Blue
1000 x 700 x 900
1200 x 800 x 900
Vikt (kg)
Weight
48
57,5
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
KM 435-2HB
KM 435-3HB
Blå/Blue
Blå/Blue
1000 x 700 x 900
1200 x 800 x 900
48
57,5
•Pulverlackerad med laminatskiva
• Höjdtilllastplan260mm
•Botten med 2 mm galvaniserad stålplåt
• Gavelskivorilaminat,höjd400mm
• Byglar25mmstålrör
• 2fasta,2länkmassivagummihjul200x50mm
• Belastning:500kg
•
•
•
•
•
•
•
Powder coated with laminate shelf
Height to platform 260 mm
Bottom with 2 mm galvanised steel
Panels in laminate, height 400 mm
Handles25mmsteelpipe
2fixed2swivelcastorssolidrubber200x50mm
Capacity:500kg
KM 436 PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
KM 436-2
KM 436-3
Blå/Blue
Blå/Blue
1000 x 700 x 900
1200 x 800 x 900
44
53,5
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
KM 436-2B
KM 436-3B
Blå/Blue
Blå/Blue
1000 x 700 x 900
1200 x 800 x 900
44
53,5
•Pulverlackerad med laminatskiva
• Höjdtilllastplan260mm
•Botten med 2 mm galvaniserad stålplåt
• Gavelskivor i laminat, höjd 400 mm
• Byglar25mmstålrör
• 2fasta,2länkmassivagummihjul200x50mm
• Belastning:500kg
•
•
•
•
•
•
•
Powder coated with laminate shelf
Height to platform 260 mm
Bottom with 2 mm galvanised steel
Endpanels in laminate, height 400 mm
Handles25mmsteelpipe
2fixed2swivelcastorssolidrubber200x50mm
Capacity:500kg
59
KM 437 PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
KM 437-2
KM 437-3
Blå/Blue
Blå/Blue
1100 x 700 x 870
1300 x 800 x 870
59
73
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
KM 437-2B
KM 437-3B
Blå/Blue
Blå/Blue
1100 x 700 x 870
1300 x 800 x 870
59
73
•Pulverlackerad med laminatskivor
•Skivormed2mmgalvaniseradstålplåt
• Avståndmellanhyllplan580mm
• Mellanrör25mmstålrör
• 2fasta,2länkmassivagummihjul200x50mm
• Belastning:500kg
•
•
•
•
•
•
Powder coated with laminate shelves
Shelveswith2mmgalvanisedsteel
Distance between shelves 580 mm
Tubes25mmsteelpipe
2fixed2swivelcastorssolidrubber200x50mm
Capacity:500kg
KM 530 PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 530-2
KM 530-3
1000 x 700 x 260
1200 x 800 x 260
Vikt (kg)
Weight
24,5
28,5
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 530-2B
KM 530-3B
1000 x 700 x 260
1200 x 800 x 260
Vikt (kg)
Weight
24,5
28,5
•Elförzinkadmedlaminatskiva
• Höjdtilllastplan260mm
• 2fasta,2länkmassivagummihjul200x50mm
• Belastning:500kg
•
•
•
•
Electro galvanised with laminate shelf
Height to platform 260 mm
2 fixed 2 swivel castors solid rubber 200 x 50 mm
Capacity:500kg
KM 531 PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 531-2
KM 531-3
1000 x 700 x 900
1200 x 800 x 900
Vikt (kg)
Weight
26,5
30
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 531-2B
KM 531-3B
1000 x 700 x 900
1200 x 800 x 900
Vikt (kg)
Weight
26,5
30
•Elförzinkadmedlaminatskiva
• Höjdtilllastplan260mm
• Byglar25mmstålrör
• 2fasta,2länkmassivagummihjul200x50mm
• Belastning:500kg
•
•
•
•
•
60
Electro galvanised with laminate shelf
Height to platform 260 mm
Handles25mmsteelpipe
2 fixed 2 swivel castors solid rubber 200 x 50 mm
Capacity:500kg
KM 532 PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 532-2
KM 532-3
1000 x 700 x 900
1200 x 800 x 900
Vikt (kg)
Weight
28,5
32,5
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 532-2B
KM 532-3B
1000 x 700 x 900
1200 x 800 x 900
Vikt (kg)
Weight
28,5
32,5
•Elförzinkadmed laminatskivor
• Höjdtilllastplan260mm
• Gavelskiva i laminat, höjd 400 mm
• Byglar25mmstålrör
• 2fasta,2länkmassivagummihjul200x50mm
• Belastning:500kg
•
•
•
•
•
•
Electro galvanised with laminate shelves
Height to platform 260 mm
End panel in laminate, height 400 mm
Handles25mmsteelpipe
2 fixed 2 swivel castors solid rubber 200 x 50 mm
Capacity:500kg
KM 533 PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 533-2
KM 533-3
1000 x 700 x 900
1200 x 800 x 900
Vikt (kg)
Weight
32,5
37,5
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 533-2B
KM 533-3B
1000 x 700 x 900
1200 x 800 x 900
Vikt (kg)
Weight
32,5
37,5
•Elförzinkadmed laminatskivor
• Höjdtilllastplan260mm
• Gavelskivor i laminat, höjd 400 mm
• Byglar25mmstålrör
• 2fasta,2länkmassivagummihjul200x50mm
• Belastning:500kg
•
•
•
•
•
•
Electro galvanised with laminate shelves
Height to platform 260 mm
End panels in laminate, height 400 mm
Handles25mmsteelpipe
2 fixed 2 swivel castors solid rubber 200 x 50 mm
Capacity:500kg
KM 535L PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 535-2L
KM 535-3L
1000 x 700 x 900
1200 x 800 x 900
Vikt (kg)
Weight
33
37
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 535-2LB
KM 535-3LB
1000 x 700 x 900
1200 x 800 x 900
Vikt (kg)
Weight
33
37
•Elförzinkadmed laminatskivor
• Höjdtilllastplan260mm
• Gavelskivor i laminat, höjd 200 mm
• Byglar25mmstålrör
• 2fasta,2länkmassivagummihjul200x50mm
• Belastning:500kg
•
•
•
•
•
•
Electro galvanised with laminate shelves
Height to platform 260 mm
End panels in laminate, height 200 mm
Handles25mmsteelpipe
2 fixed 2 swivel castors solid rubber 200 x 50 mm
Capacity:500kg
61
KM 535H PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 535-2H
KM 535-3H
1000 x 700 x 900
1200 x 800 x 900
Vikt (kg)
Weight
38
44
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 535-2HB
KM 535-3HB
1000 x 700 x 900
1200 x 800 x 900
Vikt (kg)
Weight
38
44
•Elförzinkadmed laminatskivor
• Höjdtilllastplan260mm
• Gavelskivor i laminat, höjd 400 mm
• Byglar25mmstålrör
• 2fasta,2länkmassivagummihjul200x50mm
• Belastning:500kg
•
•
•
•
•
•
Electro galvanised with laminate shelves
Height to platform 260 mm
End panels in laminate, height 400 mm
Handles25mmsteelpipe
2 fixed 2 swivel castors solid rubber 200 x 50 mm
Capacity:500kg
KM 536 PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 536-2
KM 536-3
1000 x 700 x 900
1200 x 800 x 900
Vikt (kg)
Weight
39,5
40
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 536-2B
KM 536-3B
1000 x 700 x 900
1200 x 800 x 900
Vikt (kg)
Weight
39,5
40
•Elförzinkadmed laminatskivor
• Höjdtilllastplan260mm
• Gavelskivor i laminat, height 400 mm
• Byglar25mmstålrör
• 2fasta,2länkmassivagummihjul200x50mm
• Belastning:500kg
•
•
•
•
•
•
Electro galvanised with laminate shelves
Height to platform 260 mm
End panels in laminate, height 400 mm
Handles25mmsteelpipe
2 fixed 2 swivel castors solid rubber 200 x 50 mm
Capacity:500kg
KM 537 PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 537-2
KM 537-3
1100 x 700 x 870
1300 x 800 x 870
Vikt (kg)
Weight
39
46
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 537-2B
KM 537-3B
1100 x 700 x 870
1300 x 800 x 870
Vikt (kg)
Weight
39
46
•Elförzinkadmed laminatskivor
• Höjdtilllastplan260mm
• Avståndmellanhyllplan580mm
• Mellanrör25mmstålrör
• 2fasta,2länkmassivagummihjul200x50mm
• Belastning:500kg
•
•
•
•
•
•
62
Electro galvanised with laminate shelves
Height to platform 260 mm
Distance between shelves 580 mm
Tubes25mmsteelpipe
2 fixed 2 swivel castors solid rubber 200 x 50 mm
Capacity:500kg
KM 538 PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 538-2
KM 538-3
1000 x 700 x 1800
1200 x 800 x 1800
Vikt (kg)
Weight
70
88,5
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 538-2B
KM 538-3B
1000 x 700 x 1800
1200 x 800 x 1800
Vikt (kg)
Weight
70
88,5
•Elförzinkadmed laminatskivor
• Levererasmed4sthyllplan
• Fasthandtagpåhöjd1040mm
• Avståndfrånbottenplattatillförstagejdern300mm
• 300mmmellanhyllplanen
• 2fasta,2länkmassivagummihjul200x50mm
• Belastning:100kg/hylla
• Belastning:500kg
•
•
•
•
•
•
•
•
Electro galvanised with laminate shelves
Comeswith4shelves
Fixed handle at height of 1040 mm
Distancefrombottomtofirstrail300mm
300mmbetweenrails
2fixed2swivelcastorssolidrubber200x50mm
Capacity:100kg/shelf
Capacity:500kg
KM 630 PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 630-2
KM 630-3
1000 x 700 x 260
1200 x 800 x 260
Vikt (kg)
Weight
34
41,5
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 630-2B
KM 630-3B
1000 x 700 x 260
1200 x 800 x 260
Vikt (kg)
Weight
34
41,5
•Elförzinkadmedlaminatskiva
• Höjdtilllastplan260mm
•Bottenmed2mmgalvaniseradstålplåt
• 2fasta,2länkmassivagummihjul200x50mm
• Belastning:500kg
•
•
•
•
•
Electro galvanised with laminate shelf
Height to platform 260 mm
Bottom with 2 mm galvanised steel
2fixed2swivelcastorssolidrubber200x50mm
Capacity:500kg
KM 631 PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 631-2
KM 631-3
1000 x 700 x 900
1200 x 800 x 900
Vikt (kg)
Weight
36
43,5
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 631-2B
KM 631-3B
1000 x 700 x 900
1200 x 800 x 900
Vikt (kg)
Weight
36
43,5
•Elförzinkadmedlaminatskiva
• Höjdtilllastplan260mm
•Bottenmed2mmgalvaniseradstålplåt
• Bygel25mmstålrör
• 2fasta,2länkmassivagummihjul200x50mm
• Belastning:500kg
•
•
•
•
•
•
Electro galvanised with laminate shelf
Height to platform 260 mm
Bottom with 2 mm galvanised steel
Handle25mmsteelpipe
2fixed2swivelcastorssolidrubber200x50mm
Capacity:500kg
63
KM 632 PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 632-2
KM 632-3
1000 x 700 x 900
1200 x 800 x 900
Vikt (kg)
Weight
38
46,5
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 632-2B
KM 632-3B
1000 x 700 x 900
1200 x 800 x 900
Vikt (kg)
Weight
38
46,5
•Elförzinkadmedlaminatskiva
• Höjdtilllastplan260mm
•Bottenmed2mmgalvaniseradstålplåt
• Gavelskivailaminat,höjd400mm
• Byglar25mmstålrör
• 2fasta,2länkmassivagummihjul200x50mm
• Belastning:500kg
•
•
•
•
•
•
•
Electro galvanised with laminate shelf
Height to platform 260 mm
Bottom with 2 mm galvanised steel
Endpanelinlaminate,height400mm
Handles25mmsteelpipe
2fixed2swivelcastorssolidrubber200x50mm
Capacity:500kg
KM 633 PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 633-2
KM 633-3
1000 x 700 x 900
1200 x 800 x 900
Vikt (kg)
Weight
42
50,5
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 633-2B
KM 633-3B
1000 x 700 x 900
1200 x 800 x 900
Vikt (kg)
Weight
42
50,5
•Elförzinkadmedlaminatskivor
• Höjdtilllastplan260mm
•Bottenmed2mmgalvaniseradstålplåt
•Gavelskivorilaminat,höjd400mm
• Byglar25mmstålrör
• 2fasta,2länkmassivagummihjul200x50mm
• Belastning:500kg
•
•
•
•
•
•
•
Electro galvanised with laminate shelf
Height to platform 260 mm
Bottom with 2 mm galvanised steel
Endpanelsinlaminate,height400mm
Handles25mmsteelpipe
2fixed2swivelcastorssolidrubber200x50mm
Capacity:500kg
KM 635L PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 635-2L
KM 635-3L
1000 x 700 x 900
1200 x 800 x 900
Vikt (kg)
Weight
42
50,5
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 635-2LB
KM 635-3LB
1000 x 700 x 900
1200 x 800 x 900
Vikt (kg)
Weight
42
50,5
•Elförzinkadmedlaminatskivor
• Höjdtilllastplan260mm
•Bottenmed2mmgalvaniseradstålplåt
• Gavelskivorilaminat,höjd200mm
• Byglar25mmstålrör
• 2fasta,2länkmassivagummihjul200x50mm
• Belastning:500kg
•
•
•
•
•
•
•
64
Electro galvanised with laminate shelf
Height to platform 260 mm
Bottom with 2 mm galvanised steel
Endpanelsinlaminate,height200mm
Handles25mmsteelpipe
2fixed2swivelcastorssolidrubber200x50mm
Capacity:500kg
KM 635H PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 635-2H
KM 635-3H
1000 x 700 x 900
1200 x 800 x 900
Vikt (kg)
Weight
48
57,5
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 635-2HB
KM 635-3HB
1000 x 700 x 900
1200 x 800 x 900
Vikt (kg)
Weight
48
57,5
•Elförzinkadmedlaminatskivor
• Höjdtilllastplan260mm
•Bottenmed2mmgalvaniseradstålplåt
• Gavelskivor i laminat, höjd 400 mm
• Byglar25mmstålrör
• 2fasta,2länkmassivagummihjul200x50mm
• Belastning:500kg
•
•
•
•
•
•
•
Electro galvanised with laminate shelf
Height to platform 260 mm
Bottom with 2 mm galvanised steel
Endpanelsinlamintae,height200mm
Handles25mmsteelpipe
2fixed2swivelcastorssolidrubber200x50mm
Capacity:500kg
KM 636 PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 636-2
KM 636-3
1000 x 700 x 900
1200 x 800 x 900
Vikt (kg)
Weight
44
53,5
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 636-2B
KM 636-3B
1000 x 700 x 900
1200 x 800 x 900
Vikt (kg)
Weight
44
53,5
•Elförzinkadmedlaminatskivor
• Höjdtilllastplan260mm
•Bottenmed2mmgalvaniseradstålplåt
• Gavelskivor i laminat, höjd 400 mm
• Byglar25mmstålrör
• 2fasta,2länkmassivagummihjul200x50mm
• Belastning:500kg
•
•
•
•
•
•
•
Electro galvanised with laminate shelf
Height to platform 260 mm
Bottom with 2 mm galvanised steel
Endpanelsinlaminate,height400mm
Handles25mmsteelpipe
2fixed2swivelcastorssolidrubber200x50mm
Capacity:500kg
KM 637 PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 637-2
KM 637-3
1100 x 700 x 870
1300 x 800 x 870
Vikt (kg)
Weight
59
73
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 637-2B
KM 637-3B
1100 x 700 x 870
1300 x 800 x 870
Vikt (kg)
Weight
59
73
•Elförzinkadmedlaminatskivor
•Skivormed2mmgalvaniseradstålplåt
• Avståndmellanhyllplan580mm
• Mellanrör25mmstålrör
• 2fasta,2länkmassivagummihjul200x50mm
• Belastning:500kg
•
•
•
•
•
•
Electro galvanised with laminate shelf
Shelves with 2 mm galvanised steel
Distance between shelves 580 mm
Tubes25mmsteelpipe
2fixed2swivelcastorssolidrubber200x50mm
Capacity:500kg
65
230, 330, 430, 530, 630 TILLBEHÖR/ACCESSORIES
ART.NR.
B (mm)
W (mm)
Vikt (kg)
Weight
KM 07100
KM 07110
700
800
3
3,5
•Justerbartergonomiskthandtag/
Adjustable ergonomic handle
•Elförzinkatstålmedgreppavtermoplast/
Electro galvanised steel with plastic grip
KM 10000 PAKETVAGN/PARCEL TROLLEY
ART.NR.
Mått hyllplan
Shelfsize
L x B x H (mm)
LxWxH(mm)
KM 10000-S
KM 10000-M
KM 10000-L
1000 x 600
1200 x 600
1400 x 600
1190 x 650 x 1025
1390 x 650 x 1025
1590 x 650 x 1025
Vikt (kg)
Weight
35,5
37
38
ART.NR.
Mått hyllplan
Shelfsize
L x B x H (mm)
LxWxH(mm)
KM 10000-SB
KM 10000-MB
KM 10000-LB
1000 x 600
1200 x 600
1400 x 600
1190 x 650 x 1025
1390 x 650 x 1025
1590 x 650 x 1025
•
•
•
•
•
Vikt (kg)
Weight
35,5
37
38
Elförzinkadpaketvagnmedvitlaminatbotten
Lätt avtagbara sidogaller
Grålackerat handtag kan fästas på önskad höjd
2fasta,2länkmassivagummihjul160mm
Belastning:300kg
• Electro galvanised parcel trolley with
white laminate bottom
• The side bars are easy to remove
• Adjustablehandleingreypowdercoating
• 2 fixed, 2 swivel castors solid rubber 160 mm
• Capacity:300kg
KM 730 PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
L x W x H (mm)
KM 731-4
KM 731-5
Röd/Red
Röd/Red
1000 x 600 x 1000
1200 x 700 x 1000
Vikt (kg)
Weight
26,5
31
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
KM 731-4B
KM 731-5B
Röd/Red
Röd/Red
1000 x 600 x 1000
1200 x 700 x 1000
Vikt (kg)
Weight
26,5
31
•Pulverlackeradmedlaminatskiva
• Höjdtilllastplan260mm
• Byglar25mmstålrör,
levereras med 1 bygel
• 2fasta,2länkmassivagummihjul
200 x 50 mm
• Belastning:500kg
Gavelskiva - 400 mm
End Panel - 400 mm
• Powder coated with laminate shelf
• Heighttoplatform260mm
• Handles25mmsteelpipe,willbe delivered with 1 handle
• 2fixed2swivelcastorssolid
rubber 200 x 50 mm
• Capacity:500kg
Plattformsvagn med
två handtagsbyglar/
Platformtruck with
two handles
Plattformsvagn med två
handtagsbyglar och bordsskiva/
Platform truck with two handles
and top shelf.
Höjd till översta hyllplan 865 mm/
Height to top shelf 865 mm
Avstånd mellan hyllplan 570 mm/
Distance between shelves 570 mm
66
KM 730 TILLBEHÖR/ACCESSORIES
ART.NR.
KM
KM
KM
KM
731-44
731-55
731-64
731-75
Produkt
Product
Färg
Handtagsbyglar/Handles
Handtagsbyglar/Handles
Överdel/Top shelf
Överdel/Top shelf
Röd/Red
Röd/Red
Röd/Red
Röd/Red
B (mm)
W (mm)
Colour
L x B (mm)
L x B (mm)
Vikt (kg)
Weight
600
700
3
4
14
18
1000 x 600
1200 x 700
Handtagsbyglar/Handles
Överdel/Top
KM 7731 PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
KM 7731-4
KM 7731-5
Grå/Grey
Grå/Grey
1000 x 600 x 1000
1200 x 700 x 1000
Vikt (kg)
Weight
26,5
31
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
KM 7731-4B
KM 7731-5B
Grå/Grey
Grå/Grey
1000 x 600 x 1000
1200 x 700 x 1000
• Pulverlackeradmedlaminatskiva
• Höjdtilllastplan260mm
• Byglar25mmstålrör,
levereras med 1 bygel
• 2fasta,2länkmassivagummihjul
200 x 50 mm
• Belastning:500kg
velskiva - 400 mm
End Panel - 400 mm
Vikt (kg)
Weight
26,5
31
• Powder coated with laminate shelf
• Heighttoplatform260mm
• Handles25mmsteelpipe,willbe delivered with 1 handle
• 2fixed2swivelcastorssolid
rubber 200 x 50 mm
• Capacity:500kg
Plattformsvagn med två
handtagsbyglar och bordsskiva/
Platform truck with two handles
and top shelf
Plattformsvagn med
två handtagsbyglar/
Platformtruck with
two handles
Höjd till översta hyllplan 865 mm/
Height to top shelf 865 mm
Avstånd mellan hyllplan 570 mm/
Distance between shelves 570 mm
KM 7731 TILLBEHÖR/ACCESSORIES
ART.NR.
KM
KM
KM
KM
7731-44
7731-55
7731-64
7731-75
Produkt
Product
Färg
Handtagsbyglar/Handles
Handtagsbyglar/Handles
Överdel/Top shelf
Överdel/Top shelf
Grå/Grey
Grå/Grey
Grå/Grey
Grå/Grey
Handtagsbyglar/Handles
Colour
B (mm)
W (mm)
L x B (mm)
L x B (mm)
600
700
1000 x 600
1200 x 700
Vikt (kg)
Weight
3
4
14
18
Överdel/Top
67
KM 144450 PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
L x W x H (mm)
KM 144450
Gul/Yellow
750 x 500 x 1090
Vikt (kg)
Weight
28
•Pulverlackerad med laminatskiva
• Höjdtilllastplan365mm
• Byglar25mmstålrör
• 2fasta,2luftgummihjul260x85mm
• Belastning:400kg
•
•
•
•
•
Powder coated with laminate shelf
Heighttoplatform365mm
Handles25mmsteelpipe
2fixed2swivelpneumaticcastors260x85mm
Capacity:400kg
KM 144550 PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
KM 144550
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Gul/Yellow
1000 x 600 x 1090
Vikt (kg)
Weight
32,5
•Pulverlackerad med laminatskiva
• Höjdtilllastplan365mm
• Byglar25mmstålrör
• 2fasta,2luftgummihjul260x85mm
• Belastning:400kg
•
•
•
•
•
Powder coated with laminate shelf
Heighttoplatform365mm
Handles25mmsteelpipe
2fixed2swivelpneumaticcastors260x85mm
Capacity:400kg
KM 144650 PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
KM 144650
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Gul/Yellow
1250 x 650 x 1090
Vikt (kg)
Weight
36
•Pulverlackerad med laminatskiva
• Höjdtilllastplan365mm
• Byglar25mmstålrör
• 2fasta,2luftgummihjul260x85mm
• Belastning:400kg
•
•
•
•
•
68
Powder coated with laminate shelf
Heightofplatform365mm
Handles25mmsteelpipe
2fixed2swivelpneumaticcastors260x85mm
Capacity:400kg
KM 144400 PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
KM 144400
Gul/Yellow
750 x 500 x 1020
25
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
KM 144400B
Gul/Yellow
750 x 500 x 1020
Vikt (kg)
Weight
25
•Pulverlackerad med laminatskiva
• Höjdtilllastplan280mm
• Byglar25mmstålrör
• 2fasta,2länkmassivagummihjul200x50mm
• Belastning:400kg
•
•
•
•
•
Powder coated with laminate shelf
Heightofplatform280mm
Handles25mmsteelpipe
2fixed2swivelcastorssolidrubber200x50mm
Capacity:400kg
KM 144500 PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
KM 144500
Gul/Yellow
1000 x 600 x 1020
Vikt (kg)
Weight
29,5
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
KM 144500B
Gul/Yellow
1000 x 600 x 1020
29,5
•Pulverlackerad med laminatskiva
• Höjdtilllastplan280mm
• Byglar25mmstålrör
• 2fasta,2länkmassivagummihjul200x50mm
• Belastning:400kg
•
•
•
•
•
Powder coated with laminate shelf
Heightofplatform280mm
Handles25mmsteelpipe
2fixed2swivelcastorssolidrubber200x50mm
Capacity:400kg
KM 144600 PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
KM 144600
Gul/Yellow
1250 x 650 x 1020
Vikt (kg)
Weight
33
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
KM 144600B
Gul/Yellow
1250 x 650 x 1020
Vikt (kg)
Weight
33
•Pulverlackerad med laminatskiva
• Höjdtilllastplan280mm
• Byglar25mmstålrör
• 2fasta,2länkmassivagummihjul200x50mm
• Belastning:400kg
•
•
•
•
•
Powder coated with laminate shelf
Heightofplatform280mm
Handles25mmsteelpipe
2fixed2swivelcastorssolidrubber200x50mm
Capacity:400kg
KM 144 SERIEN/SERIES TILLBEHÖR/ACCESSORIES
ART.NR.
Produkt
Product
KM 640103
KM 640104
KM 640105
Handtagsbygel/Handles
Handtagsbygel/Handles
Handtagsbygel/Handles
B (mm)
W (mm)
Vikt (kg)
Weight
500
600
650
3,9
4,4
5,0
ART.NR.
Produkt
Product
KM 614473
KM 614474
KM 614475
Överdel/Top Shelf
Överdel/Top Shelf
Överdel/Top Shelf
B (mm)
W (mm)
Vikt (kg)
Weight
500
600
650
5
8
10
69
ALLA PRODUKTER PÅ LAGER!
ALL PRODUCTS IN STOCK!
En serie stora vagnar för både inom och utomhusbruk.
A serie of large trolleys that you can use indoors and outdoors.
ti Warrant
y
ran
ÅTERFÖRSÄLJARE: ERGOFF MILJÖ AB
Hållnäsgatan 5
752 28 Uppsala
T 018-18 68 80
E [email protected]
I www.ergoff.se
aranti Wa
r
•G
ANTEE
GUAR
5
years
arranty • Ga
iW
70
Märkt
Marked
• Garan
nty
t
ra
Stora vagnar
Large Material Trolleys
70-73
Symbolen/The symbol = Denna produkt
levereras i platt paket/This product will be
deliveredinflatpack
5-års garanti på alla våra vagnar/
5 years warranty for all of our Trolleys
2 bromsade hjul/2 wheels with
brakes EN 1757-3
KM 330150 FLAKVAGN/HEAVY DUTY TROLLEY
ART.NR.
Färg
Colour
L x B x H (mm)
L x W x H (mm)
KM 330150
Blå/Blue
1500 x 700 x 460
Vikt(kg)
Weight
58
• Pulverlackeradmedlastplanavplywood
•Svetsadrörram
• Medparkeringsbromsochdraghandtag
• Handtagmedöglaförtruckkoppling
• Ögla:24mm,diam
• 400mmluftgummihjulmedplåtfälg
• Belastning:750kgdynamisklast
• Belastning:1500kgstatisklast
•
•
•
•
•
•
•
Powdercoatedwithplywooddeck
Weldedtubularframe
Fittedwithparkingbrakeandhandle
Handlewithloopfortruck,loopdiam24mm
Pneumaticrubberwheelswithsteelrim400mm
Capacity:750kgdynamicload
Capacity:1500kgstaticload
*Bromssystem se sid 72/Brake system see page 72
KM 330200 FLAKVAGN/HEAVY DUTY TROLLEY
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
KM 330200
Blå/Blue
2000 x 1000 x 460
Vikt(kg)
Weight
71,5
• Pulverlackeradmedlastplanavplywood
•Svetsadrörram
• Medparkeringsbromsochdraghandtag
• Handtagmedöglaförtruckkoppling
• Ögla:24mm,diam
• 400mmluftgummihjulmedplåtfälg
• Belastning:750kgdynamisklast
• Belastning:1500kgstatisklast
• Powdercoatedwithplywooddeck
• Weldedtubularframe
• Fittedwithparkingbrakeandhandle
• Handlewithloopfortruck,loopdiam24mm
• Pneumaticrubberwheelswithsteelrim400mm
• Capacity:750kgdynamicload
• Capacity:1500kgstaticload
*Bromssystem se sid 72/Brake system see page 72
KM 330250 FLAKVAGN/HEAVY DUTY TROLLEY
ART.NR.
KM 330250
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Blå/Blue
2500 x 1000 x 460
Vikt(kg)
Weight
77
• Pulverlackeradmedlastplanavplywood
•Svetsadrörram
• Medparkeringsbromsochdraghandtag
• Handtagmedöglaförtruckkoppling
• Ögla:24mm,diam
• 400mmluftgummihjulmedplåtfälg
• Belastning:750kgdynamisklast
• Belastning:1500kgstatisklast
• Powdercoatedwithplywooddeck
• Weldedtubularframe
• Fittedwithbrakeandhandle
• Handlewithloopfortruck,loopdiam24mm
• Pneumaticrubberwheelswithsteelrim400mm
• Capacity:750kgdynamicload
• Capacity:1500kgstaticload
*Bromssystem se sid 72/Brake system see page 72
71
330150, 200, 250 TILLBEHÖR/ACCESSORIES
ART.NR.
Produkt
Product
B x H (mm)
W x H (mm)
Vikt(kg)
Weight
KM 2000RL
KM 1500L
KM 2000L
KM 2500L
KM330000H
Nätsida/Mesh sides, 2000 modeller/2000 models
Sidor/Gavlar - Sides/end walls 1500 modeller/models
Sidor/Gavlar - Sides/end walls 2000 modeller/models
Sidor/Gavlar - Sides/end walls 2000 modeller/models
Hörnstolpar/styck-Cornerposts/unit430mm
2000
1500
2000
2500
42,5
19,5
25
27
0,84
x
x
x
x
800
1000
1000
1000
Totalhöjden på flakvagnen med nätsidor blir 1270 mm
Total height of the heavy duty trolley
with mesh sides is 1270 mm
När handtaget är i uppfällt läge är
vagnen bromsad/säkrad
When the handle is in upright
position the trolley is braked/
secured
MEGA HEAVY PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
L x W x H (mm)
KM 20080H
Blå/Blue
2150 x 1000 x 1120
Vikt(kg)
Weight
50
•Pulverlackeradmedlastplanavplywood
• Höjdtilllastplan340mm
• Flaketsstorlek2000x1000mm
• 2fastaoch2länkhjul,260mmluftgummihjul
• Belastning:500kg
•
•
•
•
•
Powdercoatedwithplywooddeck
Heightofplatform340mm
Platformsize:2000x1000mm
2fixedand2swivel,260 mm pneumatic castors
Capacity:500kg
MEGA LIGHT PLATTFORMSVAGN/PLATFORM TRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
L x W x H (mm)
Vikt(kg)
Weight
KM 20080L
Blå/Blue
2150 x 1000 x 970
41,5
•Pulverlackeradmedlastplanavplywood
• Höjdtilllastplan190mm
• Flaketsstorlek2000x1000mm
• 2fastaoch2länkhjulnylon125mm
• Belastning:500kg
•
•
•
•
•
72
Powdercoatedwithplywooddeck
Heightofplatform190mm
Platformsize:2000x1000mm
2fixed2swivelcastorsnylon125mm
Capacity:500kg
KM 831 PLATTFORMSVAGN/PLATFORM TRUCK - TILLBEHÖR/ACCESSORIES
ART.NR.
Färg
Colour
L x B x H (mm)
L x W x H (mm)
KM 831
Röd/Red
1550 x 760 x 1050
Vikt(kg)
Weight
57
ART.NR.
B x H (mm)
W x H (mm)
KM 831-Bygel/Handle
730 x 900
Vikt(kg)
Weight
3
•Rödlackerad
• Höjdtilllastplan340mm
• Flaketsstorlek1400x760mm
• 2fastaoch2länkhjul,260mm
luftgummihjul
• Belastning:1200kg
KM 831
KM 831-Bygel/Handle
•
•
•
•
Red powder coating
Heightofplatform340mm
Platformsize:1400x760mm
2 fixed 2 swivel, 260 mm
pneumatic castors
• Capacity:1200kg
Välj själv hur du vill montera hjulen
Mount the castors as you prefer
KM 125 MATERIAL-TRANSPORTVAGN/MATERIALS HANDLING TRUCK
ART.NR.
KM 125
Färg
Colour
Blå/Blue
Märkt
Marked
Vikt(kg)
Weight
155
• Maxlängdmellanaxlar:4000mm
• Inställbaralängder:2500mm,
3500 mm, 4000 mm
• Dragstångmedtruckögla
• Levererasmed4lösahörnstolpar
/1000 mm
• Höjdtilllastplan:640mm
• Måttmellanhörnstolpar:1160mm
• Dragstångslängd:1210mm
• Bredd:1270mm
• HjulØ:540mm,Bredd:160mm
• Belastning:3500kg
Långgodsvagn packad för
leverans. Packas med ett
hjul omonterat.
• Max.lengthbetweenaxles:4000mm
• Adjustablelengths:2500mm,
3500 mm, 4000 mm
• Towbarwitheyebolt
• Comeswith4separatecornerposts
• Heighttoplatform:640mm
• Distancebetweencornerposts:
1160 mm
• Towbarlength:1210mm
• Width:1270mm
• Wheels,diameter:540mm,
Width: 160 mm
• Capacity:3500kg
Truck packed and ready for
delivery. Packed with one
wheel dismounted.
73
ALLA PRODUKTER PÅ LAGER!
ALL PRODUCTS IN STOCK!
High, low, full or half pallets. You will find everything you need when it comes to
transporting pallets in a safe manner.
T 018-18 68 80
E [email protected]
I www.ergoff.se
ti Warrant
y
ran
ÅTERFÖRSÄLJARE: ERGOFF MILJÖ AB
Hållnäsgatan 5
752 28 Uppsala
aranti Wa
r
•G
ANTEE
GUAR
5
years
arranty • Ga
iW
74
Låga, höga, hel eller halvpall. Här hittar du allt som du behöver för att transportera
pallar på ett säkert och rationellt sätt.
• Garan
nty
t
ra
Pallvagnar
Pallet Trucks
74-78
Symbolen/The symbol = Denna produkt
levereras i platt paket/This product will be
deliveredinflatpack
5-års garanti på alla våra vagnar/
5 years warranty for all of our Trolleys
2 bromsade hjul/2 wheels with
brakes EN 1757-3
KM 224 PALLKRAGSVAGN/PALLET FRAME TROLLEY
ART.NR.
Färg
Colour
L x B x H (mm)
L x W x H (mm)
KM 224
Röd/Red
800 x 600 x 1215
Vikt(kg)
Weight
44
• Pulverlackeradmedelförzinkadestolpar
• Helsvetsad
• Maxantalpallkragar36st
•Defastahjulenmonteraspålångsidan
för smidig hantering
• Stolparnaslängd900mm
• 2fasta,2länkmassiva
gummihjul 200 x 50 mm
• Belastning:300kg
• Powdercoatedandpostsof
electro glavanised steel
• All-welded
• Maximumpalletframes,36pcs
• Thefixedcastorsshallbemountedon
the long side for easy movement
• Lengthoftheposts900mm
• 2fixed,2swiwelcastorssolid
rubber 200 x 50 mm
• Capacity:300kg
KM 250 PALLRULLARE/PALLET ROLLER
ART.NR.
Färg
Colour
KM250
Elförzinkad/Electrogalvanised
L x B x H (mm)
LxWxH(mm)
Vikt(kg)
Weight
575x160x150
6
•
•
•
•
•
•
Aluzinkbehandlad2mmstålplåt
UtformadförEUR-pall
Praktisktbärhandtag
Frigångshöjden är 40 mm
100mmtunglasthjul
Maxlastpåpallen2000kg
•
•
•
•
•
•
Aluzink2mmsheetsteel
DesignedtosuitEURpallet
Easy-to-usecarryinghandle
Groundclearance40mm
100mmheavyloadcastors
Max.loadonpallet2000kg
75
KM 217-H HALVPALLVAGN/HALF PALLET TRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
L x W x H (mm)
KM 217-H
KM 217-BH
Röd/Red
Blå/Blue
800 x 600 x 270
800 x 600 x 270
Vikt (kg)
Weight
17,5
17,5
ART.NR.
Färg
Colour
L x B x H (mm)
L x W x H (mm)
KM 217-HB
KM 217-BHB
Röd/Red
Blå/Blue
800 x 600 x 270
800 x 600 x 270
•
•
•
•
17,5
17,5
Pulverlackeradochhelsvetsad
Anpassadtillhalvpall800x600mm
2fastaoch2länkmassivagummihjul200x50mm
Belastning800kg
• Powdercoatedandall-welded
• Suitedtohalfpallet800x600mm
• 2fixedand2swivelcastorsof
solid rubber 200 x 50 mm
• Capacity800kg
KM 217-BH
KM 217-H
Vikt (kg)
Weight
KM 221-H HALVPALLVAGN/HALF PALLET TRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
KM 221-H
KM 221-BH
Röd/Red
Blå/Blue
800 x 600 x 650
800 x 600 x 650
26
26
ART.NR.
Färg
Colour
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
KM 221-HB
KM 221-BHB
Röd/Red
Blå/Blue
800 x 600 x 650
800 x 600 x 650
26
26
•
•
•
•
KM 221-H
KM 221-BH
Pulverlackeradochhelsvetsad
Anpassadtillhalvpall800x600mm
2fastaoch2länkmassivagummihjul200x50mm
Belastning:800kg
• Powdercoatedandall-welded
• Suitedtohalfpallet800x600mm
• 2fixedand2swivelcastorsofsolid
rubber 200 x 50 mm
• Capacity:800kg
KM 217 PALLVAGN/PALLET TRUCK
ART.NR.
Färg
Colour
KM 217
KM 217-B
Röd/Red
Blå/Blue
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
1200 x 800 x 305
1200 x 800 x 305
25
25
ART.NR.
Färg
Colour
L x B x H (mm)
L x W x H (mm)
KM 217B
KM 217-BB
Röd/Red
Blå/Blue
1200 x 800 x 305
1200 x 800 x 305
•
•
•
•
KM 217
KM 217-B
Vikt (kg)
Weight
25
25
Pulverlackeradochhelsvetsad
AnpassadtillEUR-pall1200x800mm
2fastaoch2länkmassivagummihjul200x50mm
Belastning:800kg
• Powdercoatedandall-welded
• SuitedtoEURpallet1200x800mm
• 2fixedand2swivelcastors
of solid rubber 200 x 50 mm
• Capacity:800kg
KM 221 PALLVAGN/PALLET TRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
L x W x H (mm)
KM 222
KM 221-BH
Röd/Red
Blå/Blue
1200 x 800 x 650
1200 x 800 x 650
Vikt (kg)
Weight
39
39
ART.NR.
Färg
Colour
L x B x H (mm)
L x W x H (mm)
KM 222B
KM 221-BHB
Röd/Red
Blå/Blue
1200 x 800 x 650
1200 x 800 x 650
•
•
•
•
Vikt (kg)
Weight
39
39
Pulverlackeradochhelsvetsad
AnpassadtillEUR-pall1200x800mm
2fastaoch2länkmassivagummihjul200x50mm
Belastning800kg
• Powdercoatedandall-welded
• SuitedtoEURpallet1200x800mm
• 2fixedand2swivelcastorsof
solid rubber 200 x 50 mm
• Capacity800kg Garant
76
KM 221B
KM 222 PALLVAGN/PALLET TRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
L x W x H (mm)
KM 222
KM 222-B
Röd/Red
Blå/Blue
1200 x 800 x 655
1200 x 800 x 655
Vikt (kg)
Weight
40
40
ART.NR.
Färg
Colour
L x B x H (mm)
L x W x H (mm)
KM 222B
KM 222-BB
Röd/Red
Blå/Blue
1200 x 800 x 655
1200 x 800 x 655
Vikt (kg)
Weight
40
40
•
•
•
•
•
•
Pulverlackeradochhelsvetsad
AnpassadtillEUR-pall1200x800mm
Justerbarihöjd
Maxhöjd830mm
2fastaoch2länkmassivagummihjul200x50mm
Belastning:800kg
•
•
•
•
•
•
Powdercoatedandall-welded
SuitedtoEURpallet1200x800mm
Adjustableinheight
Maxheight830mm
2fixedand2swivelcastorsofsolidrubber200x50mm
Capacity:800kg
TILLBEHÖR/ACCESSORIES
ART.NR.
KM 08500 - Pallstyrning till pallvagnar, 4 st i en förpackning/Pallet holder for pallet trucks, 4 pcs/package
KM 223 PALLVAGN/PALLETTRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
L x W x H (mm)
KM 223
Blå/Blue
1200 x 870 x 150
Vikt (kg)
Weight
29
• Avseddförtransportavplockpallarinochutipallagrets
nedersta rad
• 5fastanylonhjul,80mm
• Belastning1000kg
• Intendedforsimpletransportationofpickingpalletsinand
out of the bottom row in pallets store
• 5fixednyloncastors,80mm
• Capacity1000kg
77
KM 217-F PALLVAGN/PALLET TRUCK
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 217F
1220 x 820 x 185
NEW 2014
Vikt (kg)
Weight
25
•
•
•
•
Aluzinkbehandladstålplåt
AnpassadtillEUR-pall1200x800mm
4länkhjul,2medbroms,125mm
Belastning:150kg
•
•
•
•
Aluzinksteelsheet
SuitedtoEURpallet1200x800mm
4swivelcastors,2withbrakes125mm
Capacity:150kg
KM 217-EP PALLVAGN/PALLET TRUCK
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 217-EP
1244 x 844 x 355
Vikt (kg)
Weight
26
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 217-EPB
1244 x 844 x 355
•
•
•
•
•
Vikt (kg)
Weight
26
Elförzinkadochhelsvetsadmedpallstyrning
AnpassadtillEUR-pall1200x800mm
Höjdtilllastplan305mm
2fastaoch2länkmassivagummihjul200x50mm
Belastning:800kg
•
•
•
•
Electrogalvanisedandallweldedwithpalletholder
SuitedtoEURpallet1200x800mm
Heighttoplatform305mm
2fixedand2swivelcastorsof
solid rubber 200 x 50 mm
• Capacity:800kg
NEW 2014
KM 221-EP PALLVAGN/PALLET TRUCK
ART.NR.
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 221-EP
1244 x 844 x 700
40
KM 221-EPB
1244 x 844 x 700
•
•
•
•
•
Vikt (kg)
Weight
40
Elförzinkadochhelsvetsadmedpallstyrning
AnpassadtillEUR-pall1200x800mm
Höjdtilllastplan650mm
2fastaoch2länkmassivagummihjul200x50mm
Belastning:800kg
•
•
•
•
Electrogalvanisedandallweldedwithpalletholder
SuitedtoEURpallet1200x800mm
Heighttoplatform650mm
2fixedand2swivelcastorsof
solid rubber 200 x 50 mm
• Capacity:800kg
NEW 2014
KM 222-EP PALLVAGN/PALLET TRUCK
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 222-EP
1244 x 844 x 705
Vikt (kg)
Weight
41,5
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 222-EPB
1244 x 844 x 705
•
•
•
•
•
•
•
•
•
NEW 2014
78
Vikt (kg)
Weight
41,5
Elförzinkadochhelsvetsadmedpallstyrning
AnpassadtillEUR-pall1200x800mm
Höjdtilllastplan655-835mm,justerbart
2fastaoch2länkmassivagummihjul200x50mm
Belastning:800kg
Electrogalvanisedandallweldedwithpalletholder
SuitedtoEURpallet1200x800mm
Heighttoplatform655-835mm,adjustable
2fixedand2swivelcastorsof
solid rubber 200 x 50 mm
• Capacity:800kg
ALLA PRODUKTER PÅ LAGER!
ALL PRODUCTS IN STOCK!
Konga Mekaniska erbjuder ett brett utbud av rullcontainers för all slags
hantering. Välj mellan nätvagnar, ramcontainers med eller utan hyllplan,
stackningsbara eller rullcontainers med öppningsbara dörrar.
Konga Mekaniska offers a wide assortment of roll containers. See what
you need. You can find net trolleys, frame containers with or without
shelves, stackable or roll containers with opening doors.
T 018-18 68 80
E [email protected]
I www.ergoff.se
aranti Wa
r
•G
ANTEE
GUAR
5
• Garan
nty
t
ra
ti Warrant
y
ran
ÅTERFÖRSÄLJARE: ERGOFF MILJÖ AB
Hållnäsgatan 5
752 28 Uppsala
years
arranty • Ga
iW
Symbolen/The symbol = Denna produkt
levereras i platt paket/This product will be
deliveredinflatpack
5-års garanti på alla våra vagnar/
5 years warranty for all of our Trolleys
2 bromsade hjul/2 wheels with
brakes EN 1757-3
Rullcontainers
Roll Containers
74-78
79-89
79
KM 72801802 RULLCONTAINER 2 SIDOR/ROLL CONTAINER 2 SIDES
ART.NR.
Mått
Dimension
KM72801802
Utvändigt/Outside 720x800x1800
Invändigt/Inside
660x800x1640
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
ART.NR.
Mått
Dimension
KM72801802B
Utvändigt/Outside 720x800x1800
Invändigt/Inside
660x800x1640
26
L x B x H (mm)
L x W x H (mm)
•
•
•
•
•
•
Elförzinkad
Nätets maska 105 x 350 mm
Monterasutanverktyg
Öppningpå720mmsidan
2 fasta och 2 länkhjul, 100 mm
Belastning: 400 kg
•
•
•
•
•
•
Electrogalvanised
Netstitch:105x350mm
Assembledwithoutanytools
Openingonthe720mmside
2fixedand2swivelcastors,100mm
Capacity:400kg
Vikt (kg)
Weight
26
KM 72801803 RULLCONTAINER 3 SIDOR/ROLL CONTAINER 3 SIDES
ART.NR.
Mått
Dimension
KM72801803
Utvändigt/Outside 720x800x1800
Invändigt/Inside
660x800x1640
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
ART.NR.
Mått
Dimension
KM72801803B
Utvändigt/Outside 720x800x1800
Invändigt/Inside
660x800x1640
31
L x B x H (mm)
L x W x H (mm)
•
•
•
•
•
•
Elförzinkad
Nätets maska 105 x 350 mm
Monterasutanverktyg
Öppningpå720mmsidan
2 fasta och 2 länkhjul, 100 mm
Belastning: 400 kg
•
•
•
•
•
•
Electrogalvanised
Netstitch:105x350mm
Assembledwithoutanytools
Openingonthe720mmside
2fixedand2swivelcastors,100mm
Capacity:400kg
Vikt (kg)
Weight
31
KM 72801804 RULLCONTAINER 4 SIDOR/ROLL CONTAINER 4 SIDES
ART.NR.
Mått
Dimension
KM72801804
Utvändigt/Outside 720x800x1800
Invändigt/Inside
660x800x1640
80
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
ART.NR.
Mått
Dimension
KM72801804B
Utvändigt/Outside 720x800x1800
Invändigt/Inside
660x800x1640
37
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
•
•
•
•
•
•
Elförzinkad
Nätets maska 105 x 350 mm
Monterasutanverktyg
Inkl.1halvhängdgrindpå720mmsidan
2 fasta och 2 länkhjul, 100 mm
Belastning: 400 kg
•
•
•
•
•
•
Electrogalvanised
Netstitch:105x350mm
Assembledwithoutanytools
1halfhanggateonthe720mmside
2fixedand2swivelcastors,100mm
Capacity:400kg
37
KM 72801802, 72801803, 72801804 TILLBEHÖR/ACCESSORIES
ART.NR.
Beskrivning
Description
KM 072080Z
Extra hylla - 100 kg belastning, 720 x 800 mm
Extrashelf-Capacity100kg,720x800mm OBS! Max 3 hyllor
NOTE! Max 3 shelves
Vikt (kg)
Weight
3
3
ART.NR.
Beskrivning
Description
KM R1
Säkerhetsband rött - spännband, 900 mm
Safety strap red - strapping band, 900 mm
Säkerhetsband svart - elastiskt band, 550 mm
Safety strap black - elastic band, 550 mm
KM S1
KM S1
Säkerhetsband svart - elastiskt band, 550 mm
Safety strap black - elastic band, 550 mm
KM R1
Extra hylla - 100 kg belastning, 720 x 800 mm
Extra shelf - capacity 100 kg, 720 x 800 mm
Säkerhetsband rött - spännband, 900 mm
Safety strap red - strapping band, 900 mm
KM 120801803 RULLCONTAINER 3 SIDOR/ROLL CONTAINER 3 SIDES
ART.NR.
Mått
Dimension
KM120801803
Utvändigt/Outside 1200x800x1800
Invändigt/Inside
1140x760x1640
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
ART.NR.
KM120801803B Utvändigt/Outside 1200x800x1800
Invändigt/Inside
1140x760x1640
39
Mått
Dimension
L x B x H (mm)
L x W x H (mm)
•
•
•
•
•
•
Elförzinkad
Nätets maska 105 x 350 mm
Monterasutanverktyg
Öppningpå1200mmsidan
2 fasta och 2 länkhjul, 100 mm
Belastning: 400 kg
•
•
•
•
•
•
Electrogalvanised
Netstitch:105x350mm
Assembledwithoutanytools
Openingonthe1200mmside
2fixedand2swivelcastors,100mm
Capacity:400kg
Vikt (kg)
Weight
39
KM 120801804 RULLCONTAINER 4 SIDOR/ROLL CONTAINER 4 SIDES
ART.NR.
Mått
Dimension
KM120801804
Utvändigt/Outside 1200x800x1800
Invändigt/Inside
1140x760x1640
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
ART.NR.
KM120801804B Utvändigt/Outside 1200x800x1800
Invändigt/Inside
1140x760x1640
47
Mått
Dimension
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
47
•
•
•
•
•
•
Elförzinkad
Nätets maska 105 x 350 mm
Monterasutanverktyg
Inkl.1halvhängdgrindpå1200mmsidan
2 fasta och 2 länkhjul, 100 mm
Belastning: 400 kg
•
•
•
•
•
•
Electrogalvanised
Netstitch:105x350mm
Assembledwithoutanytools
1halfhanggateonthe1200mmside
2fixedand2swivelcastors
Capacity:400kg
81
KM 0170H4M10 RULLCONTAINER 4 SIDOR/ROLL CONTAINER 4 SIDES
ART.NR.
Mått
Dimension
KM0170H4M10
Utvändigt/Outside 1200x800x1835
Invändigt/Inside
1140x460x1640
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
ART.NR.
KM0170H4M10B Utvändigt/Outside 1200x800x1835
Invändigt/Inside
1140x460x1640
58
Mått
Dimension
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
58
•
•
•
•
•
•
Elförzinkad
Nätets maska 50 x 50 mm
Monterasutanverktyg
Inkl.1halvhängdgrindpå1200mmsidan
2 fasta och 2 länkhjul, 100 mm
Belastning: 400 kg
•
•
•
•
•
•
Electrogalvanised
Netstitch:50x50mm
Assembledwithoutanytools
1halfhanggateonthe1200mmside
2fixedand2swivelcastors,100mm
Capacity:400kg
KM 120801803, 120801804, 0170H4M10 TILLBEHÖR/ACCESSORIES
ART.NR.
Beskrivning
Description
KM 120080ZP
Extra hylla - 150 kg belastning. 1200 x 800 mm
Extra shelf - capacity 150 kg, 1200 x 800 mm
OBS! Max 3 hyllor
NOTE! Max 3 shelves
Vikt (kg)
Weight
7
7
KM 200801804 RULLCONTAINER 4 SIDOR/ROLL CONTAINER 4 SIDES
ART.NR.
Mått
Dimension
KM200801804
Utvändigt/Outside 2000x800x1800
Invändigt/Inside
1940x740x1640
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
ART.NR.
KM200801804B Utvändigt/Outside 2000x800x1800
Invändigt/Inside
1940x740x1640
70
Mått
Dimension
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
70
•
•
•
•
•
•
Elförzinkad
Nätets maska 105 x 350 mm
Monterasutanverktyg
Inkl.1halvhängdgrindpå2000mmsidan
2 fasta och 2 länkhjul, 100 mm
Belastning: 400 kg
•
•
•
•
•
•
Electrogalvanised
Netstitch:105 x 350 mm
Assembledwithoutanytools
1halfhanggateonthe2000mmside
2fixedand2swivelcastors,100mm
Capacity:400kg
KM 200801804 TILLBEHÖR/ACCESSORIES
ART.NR.
Beskrivning
Description
KM 200801804
Extra hylla - 100 kg belastning
Extra shelf - capacity 100 kg
OBS! Max 3 hyllor
NOTE! Max 3 shelves
Vikt (kg)
Weight
Extra hylla - 100 kg belastning
Extra shelf - capacity 100 kg
82
12
12
KM 2000 RULLCONTAINER 1 HYLLA/ROLL CONTAINER 1 SHELF
ART.NR.
Mått
Dimension
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
KM2000
Utvändigt/Outside
Invändigt/Inside
800x810x1910
670x780x1600
•
•
•
•
•
•
•
•
Elförzinkad
Nätets maska 105 x 395 mm
Öppningpå800mmsidan
Monterasutanverktyg
Stackningsbar
1hylla
2 fasta och 2 länkhjul, 100 mm
Belastning: 400 kg
•
•
•
•
•
•
•
•
Electrogalvanised
Netstitch:105x395mm
Openingonthe800mmside
Assembledwithoutanytools
Canbestacked
1shelf
2fixedand2swivelcastors,100mm
Capacity:400kg
31
KM 2010 RULLCONTAINER 4 SIDOR/ROLL CONTAINER 4 SIDES
ART.NR.
Mått
Dimension
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
KM2010
Utvändigt/Outside
Invändigt/Inside
820x730x1770
660x790x1500
•
•
•
•
•
•
•
•
Elförzinkad
Nätets maska 50 x 50 mm
Öppningpå820mmsidan
Monterasutanverktyg
Stackningsbar
1hylla,inkl.tak
2 fasta och 2 länkhjul, 100 mm
Belastning: 400 kg
•
•
•
•
•
•
•
•
Electrogalvanised
Netstitch:50x50mm
Openingonthe820mmside
Assembledwithoutanytools
Canbestacked
1shelfincl.top
2fixedand2swivelcastors,100mm
Capacity:400kg
72
KM 2000-S RULLCONTAINER/ROLL CONTAINER
ART.NR.
Mått
Dimension
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
KM2000-S
Utvändigt/Outside
Invändigt/Inside
700x800x1570
660x800x1400
•
•
•
•
•
•
•
Elförzinkad
Nätets maska 125 x 300 mm
Öppningpå700mmsidan
Bottengårattvikaupp
Stackningsbar
2 fasta och 2 länkhjul 100 mm
Belastning: 400 kg
•
•
•
•
•
•
•
Electrogalvanised
Netstitch:125 x 300 mm
Openingonthe700mmside
Canbestacked
Bottomcanbefoldedup
2fixedand2swivelcastors,100mm
Capacity:400kg
22
83
KM 2000-3 RULLCONTAINER/ROLL CONTAINER
ART.NR.
Mått
Dimension
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
KM2000-3
Utvändigt/Outside
Invändigt/Inside
720x860x1740
660x810x1520
46
•
•
•
•
•
•
•
•
Elförzinkad
Nätets maska 130 x 260 mm
Öppningpå720mmsidan
Avståndmellanbottenochhyllplan750mm
Bottenochhyllplangårattvikaupp
Stackningsbar
2 fasta och 2 länkhjul 100 mm
Belastning: 400 kg
•
•
•
•
•
•
•
•
Electrogalvanised
Netstitch:130 x 260 mm
Distancebetweenbottomandshelf750mm
Openingonthe700mmside
Canbestacked
Bottomandshelfcanbefoldedup
2fixedand2swivelcastors,100mm
Capacity:400kg
KM 2000-4 RULLCONTAINER/ROLL CONTAINER
ART.NR.
Mått
Dimension
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
KM2000-4
Utvändigt/Outside
Invändigt/Inside
720x860x1740
660x790x1520
48
•
•
•
•
•
•
•
•
Elförzinkad
Öppningpå720mmsidan
Nätetsmaska130x260mm
Avståndmellanbottenochhyllplan750mm
Bottenochhyllplangårattvikaupp
Stackningsbar
2fasta,2länkhjul100mm
Belastning: 400 kg
•
•
•
•
•
•
•
•
Electrogalvanised
Openingonthe720mmside
Netstitch130x260mm
Distancebetweenbottomandshelf750mm
Canbestacked
Bottomandshelfcanbefoldedupp
2fixed,2swivelcastors,100mm
Capacity:400kg
KM 2000, 2010, 2000-S, 2000-3, 2000-4 TILLBEHÖR/ACCESSORIES
ART.NR.
Beskrivning
Description
KM 072080Z
Extra hylla - 100 kg belastning. 720 x 800 mm
Extra shelf - capacity 100 kg, 720 x 800 mm
KM R1
Säkerhetsband rött - spännband, 900 mm
Safety strap red - strapping band, 900 mm
KM S1
Säkerhetsband svart - elastiskt band, 550 mm
Safety strap black - elastic band band, 550 mm
KMFACK-4
A4fack,passartillallarullcontainers
A4Compartmentfitsallrollcontainers
Vikt (kg)
Weight
3
3
1
1
KM S1
Säkerhetsband svart
Safety strap black
KM Fack-4
Skyddshuv kan specialbeställas
Covercanbeorderedspecial
84
KM R1
Säkerhetsband rött
Safety strap red
KM 1091 NÄTVAGN/NET TROLLEY
ART.NR.
Mått
Dimension
KM1091
Utvändigt/Outside 1150x665x1790
Invändigt/Inside
1100x620x1635
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
ART.NR.
Mått
Dimension
KM1091B
Utvändigt/Outside 1150x665x1790
Invändigt/Inside
1100x620x1635
38
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
38
•
•
•
•
•
•
Elförzinkad
Nätetsmaska50x50mm
Monterasutanverktyg
Hyllplankanmonteraslutande
2fastaoch2länkhjul,100mm
Belastning:400kg
•
•
•
•
•
•
Electrogalvanized
Netstitch50x50mm
Assembledwithoutanytools
Shelvescanbemountedinclined
2fixedand2swivelcastors,100mm
Capacity:400kg
KM 1091 TILLBEHÖR/ACCESSORIES
ART.NR.
Beskrivning
Description
KM 1091-H
Extra hylla - 100 kg belastning. 1085 x 605 mm
Extra shelf - capacity 100 kg, 1085 x 605 mm
Vikt (kg)
Weight
8
8
KM 1200 SÄKERHETSCONTAINER/SAFETY CONTAINER
ART.NR.
Mått
Dimension
KM1200
Utvändigt/Outside 720x830x1840
Invändigt/Inside
660x740x1640
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
ART.NR.
Mått
Dimension
KM1200B
Utvändigt/Outside 720x830x1840
Invändigt/Inside
660x740x1640
51
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
51
•
•
•
•
•
•
•
Elförzinkad
Öppningpå720mmsidan
Nätetsmaska50x50mm
Monterasutanverktyg
Inkl.tak
2fastaoch2länkhjul,100mm
Belastning:400kg
•
•
•
•
•
•
•
Electrogalvanised
Openingonthe720mmside
Netstich50x50mm
Assembledwithoutanytools
Incl.top
2fixedand2swivelcastors,100mm
Capacity:400kg
85
KM 120510 SÄKERHETSCONTAINER/SAFETY CONTAINER
ART.NR.
Mått
Dimension
KM120510
Utvändigt/Outside 1200x800x1870
Invändigt/Inside
1140x740x1640
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
ART.NR.
Mått
Dimension
KM120510B
Utvändigt/Outside 1200x800x1870
Invändigt/Inside
1140x740x1640
69
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
69
• Elförzinkad
•Öppningpå1200mmsidan
• Monterasutanverktyg
• Nätetsmaska50x50mm
•2 fasta och 2 länkhjul, 125 mm
•Belastning:600kg
• Electrogalvanised
•Openingonthe1200mmside
• Assembledwithoutanytools
• Netstich50x50mm
•2fixedand2swivelcastors,125mm
•Capacity:600kg
KM 1200, 120510 TILLBEHÖR/ACCESSORIES
ART.NR.
Beskrivning
Description
KM 072080Z (KM 1200)
Extra hylla - 100 kg belastning. 720 x 800 mm
Extra shelf - capacity 100 kg 720 x 800 mm
3
3
KM 120080ZP (KM 120510)
Extra hylla - 150 kg belastning. 1200 x 800 mm
Extra shelf - capacity 100 kg 150 kg 1200 x 800 mm
7
7
Vikt (kg)
Weight
KM 072080Z (KM 1200)
KM 120080ZP (KM 120510)
KM 1210 SÄKERHETSCONTAINER/SAFETY CONTAINER
ART.NR.
Mått
Dimension
KM1210
Utvändigt/Outside 720x830x1000
Invändigt/Inside
660x740x820 86
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
ART.NR.
Mått
Dimension
KM1210B
Utvändigt/Outside 720x830x1000
Invändigt/Inside
660x740x820
34
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
34
•
•
•
•
•
•
Elförzinkad
Öppningpå720mmsidan
Nätetsmaska50x50mm
Monterasutanverktyg
2fastaoch2länkhjul,100mm
Belastning:400kg
•
•
•
•
•
•
Electrogalvanised
Openingonthe720mmside
Netstich50x50mm
Assembledwithoutanytools
2fixedand2swivelcastors,100mm
Capacity:400kg
KM 801201802 RULLCONTAINER/ROLL CONTAINER
ART.NR.
Mått
Dimension
KM801201802
Utvändigt/Outside 1200x800x1800
Invändigt/Inside
1140x740x1640
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
ART.NR.
KM801201802B Utvändigt/Outside 1200x800x1800
Invändigt/Inside
1140x740x1640
44
Mått
Dimension
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
44
•
•
•
•
•
Elförzinkad
Öppning2dörrarpå800mmsidan
Nätetsmaska105x350mm
2fastaoch2länkhjul,125mm
Belastning:600kg
•
•
•
•
•
Electrogalvanised
Opening2gatesonthe800mmside
Netstich105x305mm
2swiveland2fixedcastors,125mm
Capacity:600kg
KM 72801804-D RULLCONTAINER/ROLL CONTAINER
ART.NR.
Mått
Dimension
KM72801804-D
Utvändigt/Outside 720x800x1800
Invändigt/Inside
660x740x1640
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
ART.NR.
KM72801804-DB Utvändigt/Outside 720x800x1800
Invändigt/Inside
660x740x1640
38
Mått
Dimension
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
38
•
•
•
•
•
•
Elförzinkad
Öppning2dörrarpå720mmsidan
Monterasutanverktyg
Nätetsmaska105x365mm
2svängbaraoch2fastahjul,100mm
Belastning:400kg
•
•
•
•
•
•
Electrogalvanised
Opening2gatesonthe720mmside
Assembledwithoutanytools
Netstich105x365mm
2fixedand2swivelcastors,100mm
Capacity:400kg
KM 801201802, 72801804-D TILLBEHÖR/ACCESSORIES
ART.NR.
Beskrivning
Description
KM 801201802-H
KM 072080Z
Extra hylla - belastning 150 kg/Extra shelf - capacity 150 kg
Extra hylla - belastning 100 kg, /Extra shelf - capacity 100 kg
L x B x H (mm)
L x W x H (mm)
1200 x 800
720 x 800
Vikt (kg)
Weight
6
3
87
KM 80-S PAKETVAGN/POST CAGE
ART.NR.
Mått
Dimension
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
KM80-S
Utvändigt/Outside
Invändigt/Inside
1200x750x1695
1150x700x1500
88
•
•
•
•
•
•
Elförzinkad
2dörrarpå750mmsidan
Nätetsmaska65x65mm
Centralbroms
2fastaoch2länkhjul,125mm
Belastning:800kg
•
•
•
•
•
•
Electrogalvanised
Opening2gatesonthe750mmside
Netstich65x65mm
Centralfootbrake
2fixedand2swivelcastors,125mm
Capacity:800kg
KM 80 RULLCONTAINER/ROLL CONTAINER
ART.NR.
Mått
Dimension
KM80
Utvändigt/Outside 1200x750x1700
Invändigt/Inside
1150x700x1500
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
ART.NR.
Mått
Dimension
73,5
KM80B
Utvändigt/Outside 1200x750x1700
Invändigt/Inside
1150x700x1500
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
73,5
•
•
•
•
•
Elförzinkadmedträbotten
2dörrarpå750mmsidan
Nätetsmaska65x65mm
2fastaoch2länkhjul,125mm
Belastning:800kg
•
•
•
•
•
Electrogalvanisedwithbaseofwood
Opening2gatesonthe750mmside
Netstich65x65mm
2fixedand2swivelcastors,125mm
Capacity:800kg
KM 80-H Extra hylla MDF - belastning 100 kg. Vikt 8 kg
KM 80-H Extra shelf MDF - capacity 100 kg. Weight 8 kg
KM 86 RULLCONTAINER/ROLL CONTAINER
ART.NR.
KM86
Mått
Dimension
L x B x H (mm)
L x W x H (mm)
Utvändigt/Outside 1200x750x1700
Invändigt/Inside
1150x700x1500
Vikt (kg)
Weight
ART.NR.
60,5
KM86B
Mått
Dimension
L x B x H (mm)
L x W x H (mm)
Utvändigt/Outside 1200x750x1700
Invändigt/Inside
1150x700x1500
Vikt (kg)
Weight
60,5
•
•
•
•
•
Elförzinkadmedträbotten
2dörrarpå750mmsidan
Nätetsmaska100x380mm
2fastaoch2länkhjul,125mm
Belastning:800kg
•
•
•
•
•
Electrogalvanisedwithbaseofwood
Opening2gatesonthe750mmside
Netstich100x380mm
2fixedand2swivelcastors,125mm
Capacity:800kg
KM 86-H Extra hylla MDF - belastning 100 kg. Vikt 8 kg
KM 86-H Extra shelf MDF - capacity 100 kg. Weight 8 kg
88
KM 84 RULLCONTAINER/ROLL CONTAINER
ART.NR.
Mått
Dimension
KM84
Utvändigt/Outside 800x710x1600
Invändigt/Inside
800x680x1400
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
ART.NR.
Mått
Dimension
KM84B
Utvändigt/Outside 800x710x1600
Invändigt/Inside
800x680x1400
28
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
•
•
•
•
Elförzinkadmedträbotten
Nätetsmaska150x320mm
2fastaoch2länkhjul,125mm
Belastning:400kg
•
•
•
•
Electrogalvanisedwithbaseofwood
Netstich150x320mm
2fixedand2swivelcastors,125mm
Capacity:400kg
28
KM 84-H Extra hylla, MDF - belastning 100 kg. Vikt 8 kg
KM R1 Säkerhetsband rött - spännband, 900 mm
KM S1 Säkerhetband svart - elastiskt band 550 mm
KM 84-H Extra shelf, MDF - capacity 100 kg. Weight 8 kg
KM R1 Safety strap red - Strapping band, 900 mm
KM S1 Safety strap black - Elastic band, 550 mm
KM 88 RULLCONTAINER/ROLL CONTAINER
ART.NR.
Mått
Dimension
KM88
Utvändigt/Outside 845x630x1390
Invändigt/Inside
820x600x1190
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
ART.NR.
Mått
Dimension
KM88B
Utvändigt/Outside 845x630x1390
Invändigt/Inside
820x600x1190
33
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
•
•
•
•
•
Elförzinkadmedträbotten
1halvhängdgrindpå845mmsidan
Nätetsmaska90x370mm
2fastaoch2länkhjul,125mm
Belastning:500kg
•
•
•
•
•
Electrogalvanisedwithbaseofwood
1halfhanggateonthe845mmside
Netstich90x370mm
2fixedand2swivelcastors,125mm
Capacity:500kg
33
KM 88-H Extra hylla MDF - belastning 100 kg. Vikt 8 kg
KM 88-H Extra shelf MDF - capacity 100 kg. Weight 8 kg
KM 89 RULLCONTAINER/ROLL CONTAINER
ART.NR.
Mått
Dimension
KM89
Utvändigt/Outside 1200x800x1420
Invändigt/Inside
1160x760x1200
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
ART.NR.
Mått
Dimension
49,7
KM89B
Utvändigt/Outside 1200x800x1420
Invändigt/Inside
1160x760x1200
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
49,7
•
•
•
•
•
Elförzinkadmedträbotten
1halvhängdgrindpå1200mmsidan
Nätetsmaska110x530mm
2fastaoch2länkhjul,125mm
Belastning:500kg
•
•
•
•
•
Electrogalvanisedwithbaseofwood
1halfhanggateonthe1200mmside
Netstich110x530mm
2fixedand2swivelcastors,125mm
Capacity:500kg
89
ALLA PRODUKTER PÅ LAGER!
ALL PRODUCTS IN STOCK!
Our pallet frames and containers are electro galvanised, stackable and
fits on EUR-pallets
ti Warrant
y
ran
ÅTERFÖRSÄLJARE: ERGOFF MILJÖ AB
Hållnäsgatan 5
752 28 Uppsala
T 018-18 68 80
E [email protected]
I www.ergoff.se
aranti Wa
r
•G
TEE
AN
GUAR
5
years
arranty • Ga
iW
90
Våra pallramar, trådburar är elförzinkade, staplingsbara och passar till
EUR-pall.
• Garan
nty
t
ra
Pallramar/trådburar
Pallet Frames/Pallet Containers
90-94
Symbolen/The symbol = Denna produkt
levereras i platt paket/This product will be
deliveredinflatpack
5-års garanti på alla våra vagnar/
5 years warranty for all of our Trolleys
2 bromsade hjul/2 wheels with
brakes EN 1757-3
KM 901000 PALLCONTAINER/PALLET CONTAINER
ART.NR.
LxBxH(mm)
LxWxH(mm)
KM 901000
1200 x 800 x 1000
Invändigamått(mm) Insidedimension(mm)
Vikt(kg)
Weight
1160 x 760
21
•
•
•
•
Elförzinkad
1halvhängdgrindpå1200mmsidan
FörEUR-pallar1200x800mm
Invändigtmått1160x760mm
•
•
•
•
Electrogalvanised
1halfhanggateonthe1200mmside
TobemountedonEUR-pallets1200x800mm
Insidedimensions1160x760mm
KM 901500 PALLCONTAINER/PALLET CONTAINER
ART.NR.
LxBxH(mm)
LxWxH(mm)
KM 901500
1200 x 800 x 1500
Invändigamått(mm)
Insidedimension(mm)
Vikt(kg)
Weight
1160 x 760
33
•
•
•
•
Elförzinkad
1halvhängdgrindpå1200mmsidan
FörEUR-pallar1200x800mm
Invändigtmått1160x760mm
•
•
•
•
Electrogalvanised
1halfhanggateonthe1200 mm sidan
TobemountedonEUR-pallets1200x800mm
Insidedimensions1160x760mm
KM 901800 PALLCONTAINER/PALLET CONTAINER
ART.NR.
LxBxH(mm)
LxWxH(mm)
Invändigamått(mm) Insidedimension(mm)
KM 901800
1200 x 800 x 1800
1160 x 760
ikt(kg)
V
Weight
47
•
•
•
•
Elförzinkad
1halvhängdgrindpå1200mmsidan
FörEUR-pallar1200x800mm
Invändigtmått1160x760mm
•
•
•
•
Electrogalvanised
1halfhanggateonthe1200mmside
TobemountedonEUR-pallets1200x800mm
Insidedimensions1160x760mm
91
KM 901800-K PALLCONTAINER/PALLET CONTAINER
ART.NR.
LxBxH(mm)
LxWxH(mm)
KM 901800-K
1200 x 800 x 1800
Invändigtmått(mm)
Insidedimensions(mm) Vikt(kg)
Weight
1160 x 760
45
• Elförzinkad
• 1halvhängdgrindpå800mmsidan
• FörEUR-pallar1200x800mm
• Electrogalvanised
• 1halfhanggateonthe800mmside
• TobemountedonEUR-pallets1200x800mm
KM 080040 PALLRAM/PALLET FRAME
ART.NR.
Mått
Dimension
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
KM080040
Utvändigt/Outside
Invändigt/Inside
1220x820x420
1150x740x400
18
•
•
•
•
Elförzinkad
Nätetsmaska65x120mm
FörEUR-pallar1200x800mm
Staplingsbarmedbelastningupptill800kg
•
•
•
•
Electrogalvanised
Netstich65x120mm
TobemountedonEUR-pallets1200x800mm
Canbestackedwithacapacityof800kg
KM 080062, 080062A1 PALLRAM/PALLET FRAME
ART.NR.
Öppning
Opening
Mått
Dimension
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
KM080062
KM080062A1
Långsides/Longside
Korsides/Shortside
Utvändigt/Outside
Invändigt/Inside
Utvändigt/Outside
Invändigt/Inside
1220x820x640
1150x740x620
1220x820x640
1150x740x620
24
24
•
•
•
•
Elförzinkad
Nätetsmaska65x120mm
FörEUR-pallar1200x800mm
Staplingsbarmedbelastningupptill800kg
•
•
•
•
Electrogalvanised
Netstich65x120mm
TobemountedonEUR-pallets1200x800mm
Canbestackedwithacapacityof800kg
KM 080085 , 080085A1 PALLRAM/PALLET FRAME
ART.NR.
Öppning
Opening
Mått
Dimension
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
KM080085
KM080085A1
Långsides/Longside
Korsides/Shortside
Utvändigt/Outside
Invändigt/Inside
Utvändigt/Outside
Invändigt/Inside
1220x820x870
1150x740x850
1220x820x870
1150x740x850
27
Elförzinkad
Nätetsmaska65x120mm
FörEUR-pallar1200x800mm
Staplingsbarmedbelastningupptill800kg
•
•
•
•
Electrogalvanised
Netstich65x120mm
TobemountedonEUR-pallets1200x800mm
Canbestackedwithacapacityof800kg
ti Warrant
y
ran
•
•
•
•
aranti Wa
r
•G
TEE
AN
GUAR
5
• Garan
nty
t
ra
years
arranty • Ga
iW
92
27
KM 080100 PALLRAM/PALLET FRAME
ART.NR.
Öppning
Opening
Mått
Dimension
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
KM080100
Långsides/Longside
Utvändigt/Outside
Invändigt/Inside
1220x820x1020
1150x740x1000
32
•
•
•
•
Elförzinkad
Nätetsmaska65x120mm
FörEUR-pallar1200x800mm
Staplingsbarmedbelastningupptill800kg
•
•
•
•
Electrogalvanised
Netstich65x120mm
TobemountedonEUR-pallets1200x800mm
Canbestackedwithacapacityof800kg
KM 080062, 080085, 080100 TILLBEHÖR/ACCESSORIES
ART.NR.
Beskrivning
Description
KM 080040L
Lock till pallramar/Lid for pallet frames
Vikt (kg)
Weight
4
OBS! Locket passar endast pallramar med öppning på långsidan
NOTE! The lid only fits pallets frames with the opening on the long side
• Pallramarnaärstaplingsbara
• Samtligapallramarpassartillvåra
vagnar med mått 1200 x 800 mm
• Thepalletframesarestackable
• Allpalletframesfitsour1200x820mm
platform trucks
Staplingsvikt
Stacking weight
800 kg
800 kg
800 kg
= max 2400
KM 0550085 TRÅDKORG/THREAD BASKET
ART.NR.
Mått
Dimension
L x B x H (mm)
L x W x H (mm)
KM0550085
Utvändigt/Outside
Invändigt/Inside
Nedmonterat/Collapsed
860x580x680
790x520x510
860x580x240
Vikt (kg)
Weight
•
•
•
•
•
Elförzinkad
1halvhängdgrindpå860mmsidan
Nätetsmaska50x100mm
Monterasutanverktyg
Belastning:300kg
•
•
•
•
•
Electrogalvanised
1halfhanggateonthe860mmside
Netstich50x100mm
Assembled without any tools
Capacity:300kg
18
93
KM 079119 TRÅDKORG/THREAD BASKET
ART.NR.
Mått
Dimension
L x B x H (mm)
L x W x H (mm)
KM079119
Utvändigt/Outside
Invändigt/Inside
Nedmonterat/Collapsed
1200x800x980
1120x730x810
1200x800x330
Vikt (kg)
Weight
44
•
•
•
•
•
Elförzinkad
1halvhängdgrindpå1200mmsidan
Nätetsmaska65x120mm
Monterasutanverktyg
Belastning:1000kg
•
•
•
•
•
Electrogalvanised
1halfhanggateonthe1200mmside
Netstich65x120mm
Assembled without any tools
Capacity:1000kg
KM 09911911 TRÅDKORG/THREAD BASKET
ART.NR.
Mått
Dimension
L x B x H (mm)
L x W x H (mm)
KM09911911
Utvändigt/Outside
Invändigt/Inside
Nedmonterat/Collapsed
1200x1000x1180
1120x930x1000
1200x1000x330
Vikt (kg)
Weight
54
•
•
•
•
•
Elförzinkad
1halvhängdgrindpå1långsida
Nätetsmaska65x120mm
Monterasutanverktyg
Belastning:1000kg
•
•
•
•
•
Electrogalvanised
1halfhanggateonthelongside
Netstich65x120mm
Assembled without any tools
Capacity:1000kg
Staplingsvikt
Stacking weight
1000 kg
1000 kg
1000 kg
= max 3000
Trådkorg nedmonterad
Collapsedthreadbasket
aranti Wa
r
•G
ANTEE
GUAR
5
• Garan
nty
t
ra
years
arranty • Ga
iW
94
ti Warrant
y
ran
Trådkorgarna är staplingsbara
The thread baskets are stackable
ALLA PRODUKTER PÅ LAGER!
ALL PRODUCTS IN STOCK!
Våra populära back och brickvagnar hittar du i många utföranden och
modeller. Välj de som passar dig bäst.
Our Tray and Bin trolleys are very popular. You will find them in a lot of
sizes and models. Choose the ones that suits you best.
T 018-18 68 80
E [email protected]
I www.ergoff.se
aranti Wa
r
•G
ANTEE
GUAR
5
• Garan
nty
t
ra
ti Warrant
y
ran
ÅTERFÖRSÄLJARE: ERGOFF MILJÖ AB
Hållnäsgatan 5
752 28 Uppsala
years
arranty • Ga
iW
Symbolen/The symbol = Denna produkt
levereras i platt paket/This product will be
deliveredinflatpack
5-års garanti på alla våra vagnar/
5 years warranty for all of our Trolleys
2 bromsade hjul/2 wheels with
brakes EN 1757-3
Brick och backvagnar
Tray and Bin Trolleys
95-100
95
KM 675, 676, 679, 680 TRALLA/DOLLY
ART.NR.
L x B x H (mm)
L x W x H (mm)
Med gummimatta
With glued rubber mat
KM
KM
KM
KM
600
600
600
600
Nej/No
Nej/No
Ja/Yes
Ja/Yes
675
676
679
680
x
x
x
x
400
600
400
600
x
x
x
x
140
140
145
145
Vikt (kg)
Weight
6
7,5
6
7,5
• 18mmplywood
• 4länkhjul,100mm
• Belastning:300kg
• 18mmplywood
• 4swivelcastors,100mm
• Capacity300kg
KM 670S, 673 TRALLA OCH STATIV/DOLLY AND STAND
ART.NR.
Produkt
Product
L x B x H (mm)
L x W x H (mm)
KM 670S
KM 673
Stativ/Stand
Tralla/Dolly
730 x 530 x 1740
600 x 400 x 160
Vikt (kg)
Weight
10
7,5
• Elförzinkad
• 4länkhjul,100mm
• Electrogalvanised
• 4swivelcastors,100mm
•
•
•
•
Elförzinkad
Platsför10trallor
PassartillKM673,675och679
4länkhjul,100mm
•
•
•
•
Electrogalvanised
Roomfor10dollys
Canbeusedwithdollys:KM673,675och679
4swivelcastors,100mm
KM 673
KM 670S
KM 167-3E BACKVAGN/TRAY AND BIN TROLLEY
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
KM 167-3E
Blå/Blue
800 x 415 x 1100
96
Vikt (kg)
Weight
22
•
•
•
•
•
•
Pulverlackeradmedelförzinkadehyllor
Maxhöjdpånedreback340mm
Tvåtiltbarahyllor(åtbådahåll)
Passartill600x400mmbackar
2fastaoch2länkhjulmedbroms100mm
Belastning150kg
•
•
•
•
•
•
Powdercoatedwithelectrogalvanisedshelves
Maximumheightofboxonbottomshelf340mm
Thetwotopshelfsareadjustabletobothsides
Forplasticbins600x400mm
2fixed-2swivelcastorswithbrakes100mm
Capacity150kg
KM 160 BRICKVAGN/TRAY TROLLEY
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 160
600 x 440 x 1880
Vikt (kg)
Weight
ART.NR.
L x B x H (mm)
L x W x H (mm)
25
KM 160B
600 x 440 x 1880
•
•
•
•
•
•
Elförzinkadmed25mmstålrör
Avståndmellangejdrarna90mm
Förplåt:540x440mm
Platsför18plåtar
4länkhjul,100mm
Belastning:150kg
•
•
•
•
•
•
Electrogalvanised25mmtubes
Distancebetweenrails90mm
Fortrays:540x440mm
For18trays
4swivelcastors,100mm
Capacity:150kg
ART.NR.
Vikt (kg)
Weight
25
Produkt
Product
Vikt (kg)
Weight
KM 160-P Plåt till backställ/Electro galvanised tray
1
KM 161 BRICKVAGN/TRAY TROLLEY
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 161
600 x 440 x 1880
Vikt (kg)
Weight
29,5
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 161B
600 x 440 x 1880
•
•
•
•
•
•
Elförzinkadmed25mmstålrör
Avståndmellangejdrarna45mm
Förplåt:540x440mm
Platsför36plåtar
4länkhjul,100mm
Belastning:150kg
•
•
•
•
•
•
Electrogalvanised25mmtubes
Distancebetweenrails45mm
Fortrays:540x440mm
For36trays
4swivelcastors,100mm
Capacity:150kg
ART.NR.
Vikt (kg)
Weight
29,5
Produkt
Product
Vikt (kg)
Weight
KM 160-P Plåt till backställ/Electro galvanised tray
1
KM 882-14 BRICKVAGN/TRAY TROLLEY
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
KM 882-14
Vit/White
720 x 430 x 1095
Vikt (kg)
Weight
23,5
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
KM 882-14B
Vit/White
720 x 430 x 1095
•
•
•
•
•
•
Pulverlackerad
Avståndmellangejdrarna120mm
Förbrickor:400x300mm
Platsför14brickor
4länkhjul,2medbroms,125mm
Belastning:150kg
•
•
•
•
•
•
Powdercoated
Distancebetweenrails120mm
Fortrays:400x300mm
For14trays
4swivelcastors,2withbrakes,125mm
Capacity:150kg
ART.NR.
Produkt
Product
Vikt (kg)
Weight
23,5
Vikt (kg)
Weight
KM 882-B Bricka till brickställ KM882-14, 400 x 300 mm 0,3
Tray for Tray Trolley KM882-14 400 x 300 mm 0,3
97
KM 154 BACKVAGN/BIN TROLLEY
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
KM 154
Vit/White
950 x 420 x 1205
Vikt (kg)
Weight
31,5
•
•
•
•
Pulverlackerad
Levererasutanlådorochlock
4länkhjulvarav2medbroms,100mm
Belastning150kg
•
•
•
•
Powdercoated
Traysandbinsaresoldasaccessories
4greyswivelcastors,2withbrakes,100mm
Capacity150kg
KM 154 TILLBEHÖR/ACCESSORIES
ART.NR.
Produkt
Product
KM
KM
KM
KM
Plastlåda/Plastic bin
Plastlåda/Plastic bin
Lock till plastlåda/Lid for plastic bin
Lock till plastlåda/Lid for plastic bin
Locket kan användas som bricka/The lid can be used as a
154-R1
154-V1
154-R2
154-V2
Färg
Colour
L x B x H (mm)
Vikt (kg)
LxWxH(mm) Weight
Röd/Red
Vit/White
Röd/Red
Vit/White
tray
420
420
420
420
x
x
x
x
260
260
260
260
x105 mm
x 105 mm
mm
mm
0,65
0,65
0,5
0,5
KM 162 BACKVAGN/BIN TROLLEY
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 162
460 x 590 x 1880
98
Vikt (kg)
Weight
25,5
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 162B
460 x 590 x 1880
•
•
•
•
•
•
Elförzinkadmed25mmstålrör
Avståndmellangejdrarna150mm
Förplastbackar:600x400mm
Platsför11backar
4länkhjul,100mm
Belastning:150kg
•
•
•
•
•
•
Electrogalvanised25mmtubes
Distancebetweenrails150mm
Fortrays:600x400mm
For11bins
4swivelcastors,100mm
Capacity:150kg
Vikt (kg)
Weight
25,5
KM 164 BACKVAGN/BIN TROLLEY
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 164
460 x 590 x 1880
Vikt (kg)
Weight
ART.NR.
L x B x H (mm)
L x W x H (mm)
22
KM 162B
460 x 590 x 1880
•
•
•
•
•
•
Elförzinkadmed25mmstålrör
Avståndmellangejdrarna210mm
Förplastbackar:600x400mm
Platsför8backar
4länkhjul,100mm
Belastning:150kg
•
•
•
•
•
•
Electrogalvanised25mmtubes
Distancebetweenrails210mm
Fortrays:600x400mm
For8bins
4swivelcastors,100mm
Capacity:150kg
Vikt (kg)
Weight
22
KM 166 BACKVAGN/BIN TROLLEY
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 166
660 x 410 x 1850
Vikt (kg)
Weight
17,5
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 166B
660 x 410 x 1850
•
•
•
•
•
•
•
Elförzinkadmed25mmstålrör
Avståndmellangejdrarna195mm
Lutandegejdrar
Förplastbackar:600x400mm
Platsför7backar
4länkhjul,100mm
Belastning:150kg
•
•
•
•
•
•
•
Electrogalvanised25mmtubes
Distancebetweenrails195mm
Leaningrails
Fortrays:600x400mm
For7bins
4swivelcastors,100mm
Capacity:150kg
Vikt (kg)
Weight
17,5
KM 165S, 165DK BACKVAGN/BIN TROLLEY
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 165S
KM 165DK
410 x 585 x 1880
435 x 585 x 1880
Vikt (kg)
Weight
26
26
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 165SB
KM 165DKB
410 x 585 x 1880
435 x 585 x 1880
•
•
•
•
•
Elförzinkadmed25mmstålrör
Justerbaragejdrar/gårattmonteraraka
Platsför4backar
4länkhjul,100mm
Belastning:150kg
•
•
•
•
•
Electrogalvanised25mmtubes
Adjustablerails/mountablestraight
For4bins
4swivelcastors,100mm
Capacity:150kg
Vikt (kg)
Weight
26
26
99
KM 167 FLEXIBEL BACKVAGN/FLEXIBLE BIN TROLLEY
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 167
470 x 585 x 1880
100
Vikt (kg)
Weight
ART.NR.
L x B x H (mm)
L x W x H (mm)
20
KM 167B
470 x 585 x 1880
Vikt (kg)
Weight
20
•
•
•
•
•
•
•
Elförzinkadmed25mmstålrör
Väljtillgejdrarochhyllplan
Dukanmonteragejdrar/hyllorhorisontellt16°,30°och40°
Förplatsbackar:600x400mm
Antalhål:63st,cc:25mm
4länkhjul,100mm
Belastning:150kg
•
•
•
•
•
•
•
Electrogalvanised25mmtubes
Withoutshelvesandrails
Forplasticbins:600x400mm
Youcanmountrails/shelveshorizontal16°,30°and40°
Numberofholes:63st,cc:25mm
4swivelcastors,100mm
Capacity:150kg
ART.NR.
Produkt
Product
KM 167-G
KM 167-H
Gejder/par - Rails/Pair
Hyllplan/st - Shelves/pce
Vikt (kg)
Weight
1,5
4
ALLA PRODUKTER PÅ LAGER!
ALL PRODUCTS IN STOCK!
Konga Mekaniskas avfallsvagnar är rymliga och lätthanterliga med
minimal svängradie. Du hittar även ett stort urval av säckställningar.
You will find that our waste trolleys are spacious and easy to work with.
You will also find a large assortment of sack trolleys.
T 018-18 68 80
E [email protected]
I www.ergoff.se
aranti Wa
r
•G
ANTEE
GUAR
5
• Garan
nty
t
ra
ti Warrant
y
ran
ÅTERFÖRSÄLJARE: ERGOFF MILJÖ AB
Hållnäsgatan 5
752 28 Uppsala
years
arranty • Ga
iW
Symbolen/The symbol = Denna produkt
levereras i platt paket/This product will be
deliveredinflatpack
5-års garanti på alla våra vagnar/
5 years warranty for all of our Trolleys
2 bromsade hjul/2 wheels with
brakes EN 1757-3
Avfallsvagnar
Waste Trolleys
101-106
101
KM 143025, 143125, 143225 AVFALLSVAGN/WASTE TROLLEY
ART.NR.
Färg
Colour
KM 143025 Gul/Yellow
KM 143125 Gul/Yellow
KM 143225 Gul/Yellow
ART.NR.
L x B x H (mm)
L x W x H (mm)
Liter
Liter
Vikt (kg)
Weight
1220 x 580 x 760
1150 x 730 x 850
1390 x 740 x 860
200
300
400
38
43
52
KM 143025-L
KM 143125-L
KM 143225-L
*L= Vagn med
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Gul/Yellow
1220
Gul/Yellow
1150
Gul/Yellow
1390
lyftöglor/Trolley with
Liter
Liter
x 580 x 790
200
x 730 x 860
300
x 740 x 870
400
hoisting brackets
Vikt (kg)
Weight
38
43
52
Märkt
Marked
•
•
•
•
•
Pulverlackerad
Medellerutanlyftöglor
Väljomduvillmontera3eller4hjul
2fastaoch2länkmassivagummihjul200x50mm
Belastning400kg
•
•
•
•
Powdercoated
Withorwithouthoistingbrackets
Youcanthenchooseifyouwillmount3or4castors
2fixedand2swivelcastorsof
solid rubber 200 x 50 mm
• Capacity:400kg
KM 143075, 143175, 143275 AVFALLSVAGN/WASTE TROLLEY
ART.NR.
Färg
Colour
KM 143075 Gul/Yellow
KM 143175 Gul/Yellow
KM 143275 Gul/Yellow
L x B x H (mm)
LxWxH(mm)
1220 x 580 x 820
1150 x 730 x 910
1390 x 740 x 920
Liter
Liter
200
300
400
ART.NR.
Vikt (kg)
Weight
41
46
55
KM 143075-L
KM 143175-L
KM 143275-L
*L= Vagn med
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Gul/Yellow
1220
Gul/Yellow
1150
Gul/Yellow
1390
lyftöglor/Trolley with
Liter
Liter
x 580 x 850
200
x 730 x 920
300
x 740 x 930
400
hoisting brackets
Vikt (kg)
Weight
41
46
55
Märkt
Marked
•
•
•
•
•
•
•
•
•
Pulverlackerad
Medellerutanlyftöglor
Väljomduvillmontera3eller4hjul
2fastaoch2länkluftgummihjul260x85mm
Belastning400kg
Powdercoated
Withorwithouthoistingbrackets
Youcanthenchooseifyouwillmount3or4castors
2fixedand2swivelpneumatic
castors 260 x 85 mm
• Capacity:400kg
102
KM 3028, 3029, 3030 SÄCKSTÄLLNING/SACK TROLLEY
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm) Liter
Liter
Vikt (kg)
Weight
KM 3028
KM 3029
KM 3030
Vit/White
Vit/White
Vit/White
450 x 380 x 1130
345 x 380 x 690
450 x 380 x 900
240
60
125
7,5
5,5
6,5
• Pulverlackadmedhelbottenplatta
• 4stlänkhjul50mm
• Belastning:30kg
• Powdercoatedwithsolidbase
• 4swivelcastors50mm
• Capacity:30kg
ART.NR.
Produkt
Product
Färg
Color
KM 3030-1
KM 3029-1
Lock/Lid
Lock/Lid
Vit/White 125/240
Vit/White 60
Liter
Liter
Vikt (kg)
Weight
1,5
1,5
KM 3029-E, 3030-E SÄCKSTÄLLNING/SACK TROLLEY
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Liter
Liter
Vikt (kg)
Weight
KM3029-E
KM3030-E
Elz/Electrogalv
Elz/Electrogalv
345x380x690
450x380x900
60
125
5
6
• Elförzinkadmedhelbottenplatta
• 4stlänkhjul50mm
• Belastning:30kg
• Electrogalvanisedwithsolidbase
• 4swivelcastors50mm
• Capacity:30kg
ART.NR.
Produkt
Product
Färg
Color
KM 3030-1
KM 3029-1
Lock/Lid
Lock/Lid
Vit/White 125/240
Vit/White 60
Liter
Liter
Vikt (kg)
Weight
1,5
1,5
KM 3027 SÄCKSTÄLLNING/SACK TROLLEY
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Liter
Liter
KM 3027
Vit/White
820 x 450 x 900
2 x 125
Vikt (kg)
Weight
12,5
• Pulverlackadmedhelbottenplatta
• 4stlänkhjul50mm
• Belastning:50kg
• Powdercoatedwithsolidbase
• 4swivelcastors50mm
• Capacity:50kg
103
KM 3025 SÄCKSTÄLLNING/SACK TROLLEY
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Liter
Liter Vikt (kg)
Weight
KM3025
Elz/Electrogalvanised
500x450x900
125
•
•
•
•
Elförzinkadmedhalkskyddförsäcken
Levererasmedbådehjulochställfötter
4stlänkhjul75mm
Belastning:75kg
•
•
•
•
Electrogalvanisedwithantislipsackholders
Deliveredwithcastorsandfixedfeet
4swivelcastors75mm
Capacity:75kg
9
KM 3026 SÄCKSTÄLLNING/SACK TROLLEY
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Liter
Liter Vikt (kg)
Weight
KM3026
Elz/Electrogalv
770x470x900
2x125
13,5
•
•
•
•
Elförzinkadmedhalkskyddförsäckarna
Levererasmedbådehjulochställfötter
4stlänkhjul75mm
Belastning:75kg
•
•
•
•
Electrogalvanisedwithantislipsackholders
Deliveredwithcastorsandfixedfeet
4swivelcastors75mm
Capacity:75kg
KM 144904 SÄCKSTÄLLNINGSVAGN MED LOCK/SACK TROLLEY WITH LID
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Liter
Liter KM 144904
Grå/Grey
580 x 470 x 940
125
• Pulverlackeradsäckhållaremedlock
• Gummihjulmedplastfälg150mm
• Belastning:50kg
• Powdercoatedsackholderwithlid
• Solidrubberonplasticrim150mm
• Capacity:50kg
104
Vikt (kg)
Weight
4
KM 144903 SÄCKSTÄLLNINGSVAGN/SACK TROLLEY
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Liter
Liter Vikt (kg)
Weight
KM 144903
Grå/Grey
580 x 470 x 940
125
4,5
• Pulverlackeradsäckhållare
• Gummihjulmedplastfälg150mm
• Belastning:50kg
• Powdercoatedsackholder
• Solidrubberonplasticrim150mm
• Capacity:50kg
KM 144902 SÄCKSTÄLLNINGSVAGN/SACK TROLLEY
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Liter
Liter Vikt (kg)
Weight
KM 144902
Grå/Grey
600 x 600 x 900
125
8,5
• Pulverlackerad
• Luftgummihjul260mm
• Belastning:150kg
• Powdercoated
• Pneumaticwheels260mm
• Capacity:150kg
KM 145760 STÄDKÄRRA/STREET SWEEPER TROLLEY
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
KM 145760
Gul/Yellow
1200 x 820 x 1070
24,5
• Pulverlackerad
• 2luftgummihjulmedplåtfälg,400x100mm
• Belastning:150kg
• Powdercoated
• 2pneumaticwheelswithsteelrim,400x100mm
• Capacity150kg
105
KM 3031 PALLBASSÄNG/PALLET TANK
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Liter
Liter
Vikt (kg)
Weight
KM 3031
Blå/Blue
1240 x 800 x 415
410
31
• Pulverlackeradstålplåt
• För2x200litersfat
• AnpassadförEUR-pall
• Powdercoatedsheetsteel
• For2x200litredrum
• SuitableforEURpallet
KM 3031-2 PALLBASSÄNG/PALLET TANK
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Liter
Liter
KM 3031-2
Blå/Blue
1240 x 800 x 160
155
Vikt (kg)
Weight
20
• Pulverlackeradstålplåt
• Fördunkar,flaskor,kvartsfat
• AnpassadförEUR-pall
• Powdercoatedsteelsheet
• Fortubs,bottles,quartzdrums
• SuitableforEURpallet
KM 2500 DUNKTIPP/TUB TIP
ART.NR.
L x B x H (mm)
L x W x H (mm)
Liter
Liter
KM 2500
280 x 260 x 410
25
Vikt (kg)
Weight
5
•
•
•
•
Aluzinkbehandladstålplåt
Bådeförgolvochväggmontage
Självklarhjälpvidtömningavtungadunkar
Endastför25lbehållare
•
•
•
•
Aluzinksteelsheet
Canbemountedonbothfloorandwall
Usefullwhenhandlingandemptyingheavycansandtubs
Onlyfor25lcontainers
KM 2501 DUNKTIPP/TUB TIP
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 2501
285 x 280 x 410
106
Liter
Liter
20/25
Vikt (kg)
Weight
5
•
•
•
•
•
Aluzinkbehandladstålplåt
Bådeförgolvochväggmontage
Självklarhjälpvidtömningavtungadunkar
Invändigtmått285mm
För20/25lbehållare
•
•
•
•
•
Aluzinksteelsheet
Canbemountedonbothfloorandwall
Usefullwhenhandlingandemptyingheavycansandtubs
Insidediameter285mm
For20/25lcontainer
ALLA PRODUKTER PÅ LAGER!
ALL PRODUCTS IN STOCK!
107-116
Kärrorna i vårt sortiment sträcker sig över många användningsområden.
De har hopfällbara lastplan, ergonomiska handtag, stödbyglar och stora
hjul för extra tung last. Du hittar även bagagekärror och vår ergonomiska
gastubskärra i sortimentet.
T 018-18 68 80
E [email protected]
I www.ergoff.se
aranti Wa
r
•G
ANTEE
GUAR
5
• Garan
nty
t
ra
ti Warrant
y
ran
ÅTERFÖRSÄLJARE: ERGOFF MILJÖ AB
Hållnäsgatan 5
752 28 Uppsala
years
arranty • Ga
iW
Symbolen/The symbol = Denna produkt
levereras i platt paket/This product will be
deliveredinflatpack
5-års garanti på alla våra vagnar/
5 years warranty for all of our Trolleys
2 bromsade hjul/2 wheels with
brakes EN 1757-3
Kärror
Trucks
Our truck assortment is wide and you will find trucks for many different
uses. They have for example folded platforms, ergonomic handles and
big wheels for heavy load. You will also find luggage trucks and our
ergonomic Bottle Truck in the assortment.
107
KM 0207 BAGAGE & MAGASINKÄRRA/LUGGAGE & SACK TRUCK
ART.NR.
Färg
Colour
L x B x D (mm)
LxWxD(mm)
Vikt (kg)
Weight
KM 0207
Grå/Grey
390 x 1000 x 420
3,5
•
•
•
•
•
Kraftigkostruktionialuminium
Lättaattfällaihop(390x55x675)
Lastplan385x230mm
Gummihjulmedplastfälg125mm
Belastning:60kg
•
•
•
•
•
Robustconstructionofaluminium
Easytofold(390x55x675)
Loadingbase385x230mm
Rubberwheelswithplasticrim125mm
Capacity:60kg
KM 0208 BAGAGE & MAGASINKÄRRA/LUGGAGE & SACK TRUCK
ART.NR.
Färg
Colour
L x B x D (mm)
LxWxD(mm)
KM 0208
Grå/Grey
570 x 1090 x 540
Vikt (kg)
Weight
6
•
•
•
•
•
Kraftig kostruktion i aluminium
Lättaattfällaihop(490x70x800)
Lastplan480x300mm
Gummihjulmedplastfälg175mm
Belastning:125kg
•
•
•
•
•
Robustconstructionofaluminium
Easytofold(490x70x800)
Loadingbase480x300mm
Rubberwheelswithplasticrim175mm
Capacity:125kg
KM 144900 BAGAGE & MAGASINKÄRRA/LUGGAGE & SACK TRUCK
ART.NR.
Färg
Colour
L x B x D (mm)
LxWxD(mm)
KM 144900
Grå/Grey
600 x 600 x 1100
108
Vikt (kg)
Weight
9,5
•
•
•
•
•
Pulverlackerad
Lastplan300x145mm
Litetlastplan430x125mm
Luftgummihjul260mm
Belastning:150kg
•
•
•
•
•
Powdercoated
Loadingbase300x145mm
Smallloadingbase430x125mm
Pneumaticwheels260mm
Capacity:150kg
KM 145685 BAGAGE & MAGASINKÄRRA/LUGGAGE & SACK TRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
KM 145685
Gul, grå/Yellow, grey
590 x 480 x 1175/1525
17,5
•
•
•
•
•
•
Avaluminiumochplast
Lastplan320x370mm
Justerbarthandtag
Ergonomisktipphjälp
Luftgummihjul260x85mm
Belastning:250kg
•
•
•
•
•
•
Aluminiumandplasticmaterial
Loadingbase320x370mm
Adjustablehandle
Ergonomic
Pneumaticwheels260x85mm
Capacity:250kg
KM 145251 BAGAGE & MAGASINKÄRRA/LUGGAGE & SACK TRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
KM 145251
Gul/Yellow
810 x 500 x 1140
14,5
•
•
•
•
•
•
Pulverlackerad
Lastplan500x350mm
Litetlastplan385x120mm
Ergonomisktipphjälp
Luftgummihjul260x85mm
Belastning:250kg
•
•
•
•
•
•
Powdercoated
Loadingbase500x350mm
Smallloadingbase385x120mm
Ergonomic
Pneumaticwheels260x85mm
Capacity:250kg
KM 100 BAGAGE & MAGASINKÄRRA/LUGGAGE & SACK TRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
KM 100
Gul/Yellow
500 x 420 x 1000
4
•
•
•
•
Pulverlackerad
Lastplan270x310mm
Gummihjulmedplastfälg180mm
Belastning:50kg
•
•
•
•
Powdercoated
Loadingbase270x310mm
Rubberwheelswithplasticrim180mm
Capacity:50kg
109
KM 101 BAGAGE & MAGASINKÄRRA/LUGGAGE & SACK TRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
KM 101
Gul/Yellow
800 x 430 x 1150
Vikt (kg)
Weight
13,5
•
•
•
•
•
Pulverlackerad
Lastplan345x500mm
Litetlastplan415x135mm
Massivagummihjul250mm
Belastning:150kg
•
•
•
•
•
Powdercoated
Loadingbase345x500mm
Smallloadingbase415x135mm
Solidrubberwheels250mm
Capacity:150kg
KM 102 BAGAGE & MAGASINKÄRRA/LUGGAGE & SACK TRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
KM 102
Gul/Yellow
800 x 430 x 1150
11
•
•
•
•
•
Pulverlackerad
Lastplan345x500mm
Litetlastplan415x135mm
Luftgummihjul260x85mm
Belastning:150kg
•
•
•
•
•
Powdercoated
Loadingbase345x500mm
Smallloadingbase415x135mm
Pneumaticwheels260x85mm
Capacity:150kg
KM 103 BAGAGE & MAGASINKÄRRA/LUGGAGE & SACK TRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
KM 103
Gul/Yellow
780 x 555 x 1110
110
Vikt (kg)
Weight
15,5
•
•
•
•
•
Pulverlackerad
Lastplan360x480mm
Litetlastplan415x175mm
Massivagummihjul250mm
Belastning:250kg
•
•
•
•
•
Powdercoated
Loadingbase360x480mm
Smallloadingbase415x175mm
Solidrubbercastors250mm
Capacity:250kg
KM 104 BAGAGE & MAGASINKÄRRA/LUGGAGE & SACK TRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
KM 104
Gul/Yellow
780 x 555 x 1110
13
•
•
•
•
•
Pulverlackerad
Lastplan360x480mm
Litetlastplan415x175mm
Luftgummihjul260x85mm
Belastning:250kg
•
•
•
•
•
Powdercoated
Loadingbase360x480mm
Smallloadingbase415x175mm
Pneumaticwheels260x85mm
Capacity:250kg
KM 105 BAGAGE & MAGASINKÄRRA/LUGGAGE & SACK TRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
KM 105
Gul/Yellow
470 x 555 x 1110
11,5
•
•
•
•
Pulverlackerad
Lastplan415x175mm
Luftgummihjul260x85mm
Belastning:250kg
•
•
•
•
Powdercoated
Loadingbase415x175mm
Pneumaticwheels260x85mm
Capacity:250kg
KM 106 BAGAGE & MAGASINKÄRRA/LUGGAGE & SACK TRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
KM 106
Gul/Yellow
920 x 480 x 1170
15
•
•
•
•
•
Pulverlackerad
Lastplan340x630mm
Litetlastplan415x205mm
Luftgummihjul260x85mm
Belastning:250kg
•
•
•
•
•
Powdercoated
Loadingbase340x630mm
Smallloadingbase415x205mm
Pneumaticwheels260x85mm
Capacity:250kg
111
KM 107 BAGAGE & MAGASINKÄRRA/LUGGAGE & SACK TRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
KM 107
Gul/Yellow
870 x 510 x 1225
•
•
•
•
•
Pulverlackerad
Lastplan350x500mm
Litetlastplan425x150mm
Massivagummihjul160x30mm
Belastning:200kg
•
•
•
•
•
Powdercoated
Loadingbase350x500mm
Smallloadingbase425x150mm
Solidrubberwheels160x30mm
Capacity:200kg
Vikt (kg)
Weight
18,5
KM 104-H BAGAGE & MAGASINKÄRRA/LUGGAGE & SACK TRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
KM 104-H
Gul/Yellow
780 x 560 x 1320
Vikt (kg)
Weight
13,5
• Pulverlackerad
• Uniktergonomiskthandtagsomgörattdu
kan hålla det i olika positioner
• Lastplan360x480mm
• Litetlastplan415x175mm
• Luftgummihjul260x85mm
• Belastning:250kg
• Powdercoated
• Uniqeergonomichandlethatmakesiteasyto
grip in different positions for best usage
• Loadingbase360x480mm
• Smallloadingbase415x175mm
• Pneumaticwheels260x85mm
• Capacity:250kg
KM 104-HPF BAGAGE & MAGASINKÄRRA/LUGGAGE & SACK TRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
KM 104-HPF
Gul/Yellow
780 x 560 x 1320
Vikt (kg)
Weight
13,5
• Pulverlackerad
• Uniktergonomiskthandtagsomgörattdukan
hålla det i olika positioner
• Lastplan360x480mm
• Litetlastplan415x175mm
• Punkteringsfriamassivapolyuretanskum
hjul, 260 x 85 mm
• Belastning:250kg
• Powdercoated
• Uniqeergonomichandlethatmakesiteasyto
grip in different positions for best usage
• Loadingbase360x480mm
• Smallloadingbase415x175mm
• Flatfreesolidpolyurethanefoamwheels,260x85mm
• Capacity:250kg
112
KM 104-HPL BAGAGE & MAGASINKÄRRA/LUGGAGE & SACK TRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
KM 104-HPL
Gul/Yellow
780 x 560 x 1320
14
• Pulverlackerad
• Uniktergonomiskthandtagsomgörattdu
kan hålla det i olika positioner
• Lastplan360x480mm
• Litetlastplan415x175mm
• Punkteringsfriapolyuretanskumhjulmedlåg
profil, 260 x 85 mm
• Belastning:250kg
• Powdercoated
• Uniqeergonomichandlethatmakesiteasyto
grip in different positions for best usage
• Loadingbase360x480mm
• Smallloadingbase415x175mm
• Flatfreepolyurethanefoamcastorswith
low profile, 260 x 85 mm
• Capacity:250kg
KM 07200 GASTUBSKÄRRA/BOTTLE TRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
KM07200
Elz/Electrogalv
600x600x1440
18,5 •
•
•
•
•
Elförzinkadergonomiskgaskärra
Förenklarlyftenväsentligt
Förgasflaskor/tubdiameter235mm/50l-tub
2luftgummihjul,260x85mm
Belastning:80kg
• Ergonomicbottletruckinelectrogalvanisedsteel
• Greatlyreducestheeffortrequiredtochangethe
gas bottles
• Forcylindersdiameter235mm/50l-tube
• 2pneumaticrubberwheels260x85mm
• Capacity:80kg
113
KM 145860 GASTUBSKÄRRA/BOTTLE TRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
KM 145860
Gul/Yellow
750 x 1160 x 1170
31
Märkt
Marked
•
•
•
•
•
Pulverlackerad
Gastubskärraför2storaflaskor/tuber
Lastplan565x280mm
Luftgummihjul400x100mm
Belastning:250kg
•
•
•
•
•
Powdercoated
Bottletruckfor2bigtubes/bottles
Loadingbase565x280mm
Pneumaticwheels400x100mm
Capacity:250kg
KM 145855 GASTUBSKÄRRA/BOTTLE TRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
KM 145855
Gul/Yellow
750 x 1160 x 1170
Märkt
Marked
Vikt (kg)
Weight
31
•
•
•
•
•
Pulverlackerad
Gastubskärraför2storaflaskor/tuber
Lastplan565x280mm
Punkteringsfriahjul400x100mm
Belastning:250kg
•
•
•
•
•
Powdercoated
Bottletruckfor2bigtubes/bottles
Loadingbase565x280mm
Flatfreewheels400x100mm
Capacity:250kg
KM 145845 GASTUBSKÄRRA/BOTTLE TRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
KM 145845
Gul/Yellow
530 x 1080 x 550
14
•
•
•
•
•
Pulverlackerad
Gastubskärraför1flaska/tub
Lastplan285x255mm
Massivagummihjul250x60mm
Belastning:150kg
•
•
•
•
•
Powdercoated
Bottletruckfor1 flaska/tub
Loadingbase285x255mm
Solidrubbercastors250x60mm
Capacity:150kg
114
KM D1 DÄCKKÄRRA/TYRE TRUCK
ART.NR.
Färg
Colour
L x H x B (mm)
LxHxW(mm)
Vikt (kg)
Weight
KM D1
Gul/Yellow
1300 x 840/650 x 1490
24,5
•
•
•
•
•
Pulverlackerad
Öppetläge800mm
Stängtläge400mm
Luftgummihjul260 x 85 mm
Belastning: 200 kg
•
•
•
•
•
Powdercoated
Openposition800mm
Closedposition400mm
Pneumaticrubberwheels260x85mm
Capacity:200kg
KM D2 DÄCKTRALLA/TYRE DOLLY
ART.NR.
Färg
Colour
H (mm)
H(mm)
KM D2
Svart/Black
130
Diameter (mm)
Diameter (mm)
650
Vikt (kg)
Weight
3,2
• Pulverlackerad
• 5länkhjul,50mm
• Belastning: 120 kg
• Powdercoated
• 5swivelcastors,50mm
• Capacity:120kg
NEW 2014
KM 145730 STOLKÄRRA/CHAIR TRUCK
ART.NR.
Färg
Colour
H x B x D (mm)
HxWxD(mm)
Vikt (kg)
Weight
KM 145730
Gul/Yellow
440 x 380 x 1320
7
•
•
•
•
Pulverlackerad
Ställbarhöjd
Massivgummihjul,200x50mm
Belastning:75kg
•
•
•
•
Powdercoated
Adjustableheight
Solidrubberwheels200x50mm
Capacity:75kg
115
KM 145961 FATVAGGA/DRUM CRADLE
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
KM 145961
Gul/Yellow
900/1640 x 450 x 590
12
•
•
•
•
Pulverlackerad
Inskjutbarahandtag
Nylonhjul100mm
Belastning:200kg
•
•
•
•
Powdercoated
Withextensionarms
Nylonwheels100mm
Capacity:200kg
KM 145740 FATKÄRRA/DRUM TRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
KM 145740
Gul/Yellow
620 x 655 x 1580
10
• Pulverlackerad
• Luftgummihjul300mm
• Belastning:200kg
• Powdercoated
• Pneumaticwheels300mm
• Capacity:200kg
KM 07300 DRAGKÄRRA/UTILITY TROLLEY
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
KM 07300
Svart/Black
1600 x 910 x 900
116
Vikt (kg)
Weight
20,5
•
•
•
•
•
Pulverlackeratstål,medträflak
Invändigtmått820x650x100mm
Höjdtilllastplan240mm
2punkteringsfriahjul,400mm
Belastning:150kg
•
•
•
•
•
Inpowdercoatedsteel,withbaseofwood
Insidedimensions820x650x100mm
Heighttoplatform240mm
Puncturefreewheels400mm
Capacity:150kg
ALLA PRODUKTER PÅ LAGER!
ALL PRODUCTS IN STOCK!
Här hittar du effektiva lösningar för ditt kontor eller dina konferensutrymmen.
Find effective solutions for the office and your conference spaces.
T 018-18 68 80
E [email protected]
I www.ergoff.se
aranti Wa
r
•G
ANTEE
GUAR
5
• Garan
nty
t
ra
ti Warrant
y
ran
ÅTERFÖRSÄLJARE: ERGOFF MILJÖ AB
Hållnäsgatan 5
752 28 Uppsala
years
arranty • Ga
iW
Symbolen/The symbol = Denna produkt
levereras i platt paket/This product will be
deliveredinflatpack
5-års garanti på alla våra vagnar/
5 years warranty for all of our Trolleys
2 bromsade hjul/2 wheels with
brakes EN 1757-3
Kontor/konferens
Office/Conference
117-120
117
KM 155 SKRIVPULPETVAGN/WRITING TABLET TROLLEY
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 155
570 x 800 x 1300
Vikt (kg)
Weight
17
•
•
•
•
•
•
Elförzinkadmedbokskivaförseddmedpennfack
Högstahöjd:1300mm
Lägstahöjd:910mm
Lutning:10°
4länkhjulvarav2medbroms125mm
Belastning:150kg
• Electrogalvanisedandbeechtopwith
pen compartment
• Maximumheight:1300mm
• Minimumheight:910mm
• Gradient:10°
• 4swivelcastors/2withbrakes125mm
• Capacity:150kg
KM 155-1 SKRIVPULPETVAGN/WRITING TABLET TROLLEY
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 155-1
570 x 800 x 1070
Vikt (kg)
Weight
19
• Elförzinkadmedbokskivaförseddmedpennfack
• 4länkhjulvarav2medbroms100mm
• Belastning:150kg
• Electrogalvanisedandbeechtopwith
pen compartment
• 4swivelcastors/2withbrakes100mm
• Capacity:150kg
KM 145 SKRIVPULPET/WRITING TABLET
ART.NR.
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
KM 145
47 x 250 x 330
1,5
• Aluzinkbehandladstålplåt
• Passarallarörfrån20till35mm
• StorlekA4
• Aluzinksteelsheet
• Fitsallpipesbetween20and35mm
• SizeA4
118
KM 113700 KONFEKTIONSSTÄLL/CLOTHES RACK
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
KM 113700
Grå/Grey
1700 x 600 x 1690
Vikt (kg)
Weight
21
•
•
•
•
Pulverlackerad
Kraftigrörkonstruktionförtuffhantering
4länkhjul125mm
Belastning:150kg
•
•
•
•
Powdercoated
Heavytubeconstructionforextratoughhandling
4swivelcastors125mm
Capacity:150kg
KM 113500 KONFEKTIONSSTÄLL/CLOTHES RACK
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 113500
1180 x 710 x 1830
Vikt (kg)
Weight
13
•
•
•
•
Pulverlackerad
Ställbartihöjd:1420-1820mm
4länkhjul,varav2medbroms,125mm
Belastning:75kg
•
•
•
•
Powdercoated
Adjustableinheight:1420-1820mm
4swivelcastors,2withbrakes,125mm
Capacity:75kg
KM 151S FLYTTHYLLA - 3 HYLLPLAN/MOVABLE - 3 SHELF TROLLEY
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 151S
790 x 290 x 1500
Vikt (kg)
Weight
25
•
•
•
•
•
•
Elförzinkademedlaminatskiva
Helsvetsad
Höjdtillöverstahylla1250mm
Avståndmellanhyllplan515mm
4länkhjul,100mm
Belastning25kg/hylla
•
•
•
•
•
•
Electrogalvanisedwithlaminateshelfes
All-welded
Heightoftopshelf1250mm
Distancebetweenshelves515mm
4swivelcastors,100mm
Capacity25kg/hylla
119
KM 151S4 FLYTTHYLLA - 4 HYLLPLAN/MOVABLE - 4 SHELF TROLLEY
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 151S4
790 x 290 x 1500
Vikt (kg)
Weight
29
•
•
•
•
•
•
Elförzinkademedlaminatskiva
Helsvetsad
Höjdtillöverstahylla1250mm
Avståndmellanhyllplan325mm
4länkhjul,100mm
Belastning:25kg/hylla
•
•
•
•
•
•
Electrogalvanisedwithlaminateshelf
All-welded
Heightoftopshelf1250mm
Distancebetweenshelves325mm
4swivelcastors,100mm
Capacity:25kg/hylla
KM 151 FLYTTHYLLA - 3 HYLLPLAN/MOVABLE - 3 SHELF TROLLEY
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 151
750 x 290 x 1140
Vikt (kg)
Weight
24,5
•
•
•
•
•
•
•
Elförzinkademedlaminatskiva
Helsvetsad
Höjdtillöverstahylla 890 mm
Avståndmellanhyllplan350 mm
Inkl.6bokstöd
4länkhjul,100mm
Belastning:25kg/hylla
•
•
•
•
•
•
•
Electrogalvanisedwithlaminateshelf
All-welded
Heightoftopshelf890mm
Distancebetweenshelves350mm
6booksupportsincluded
4swivelcastors,100mm
Capacity:25kg/hylla
KM 152 FLYTTHYLLA - 3 HYLLPLAN/MOVABLE - 3 SHELF TROLLEY
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 152
1000 x 290 x 1140
120
Vikt (kg)
Weight
30
•
•
•
•
•
•
•
Elförzinkademedlaminatskiva
Helsvetsad
Höjdtillöverstahylla 890 mm
Avståndmellanhyllplan350 mm
Inkl.6bokstöd
4länkhjul,100mm
Belastning:25kg/hylla
•
•
•
•
•
•
•
Electrogalvanisedwithlaminateshelf
All-welded
Heightoftopshelf890mm
Distancebetweenshelves350mm
6booksupportsincluded
4swivelcastors,100mm
Capacity:25kg/hylla
ALLA PRODUKTER PÅ LAGER!
ALL PRODUCTS IN STOCK!
Konga Mekaniskas sortiment av torkvagnar lämnar inte mycket åt slumpen. Här hittar du torkvagnar för i stort sett alla användningsområden.
Drying Trolleys from Konga Mekaniska will cover all the uses that you
can need.
T 018-18 68 80
E [email protected]
I www.ergoff.se
aranti Wa
r
•G
TEE
AN
GUAR
5
• Garan
nty
t
ra
ti Warrant
y
ran
ÅTERFÖRSÄLJARE: ERGOFF MILJÖ AB
Hållnäsgatan 5
752 28 Uppsala
years
arranty • Ga
iW
Symbolen/The symbol = Denna produkt
levereras i platt paket/This product will be
deliveredinflatpack
5-års garanti på alla våra vagnar/
5 years warranty for all of our Trolleys
2 bromsade hjul/2 wheels with
brakes EN 1757-3
Torkvagnar
Drying Trolleys
121-124
121
KM 152979 FLEXIBEL TORKVAGN/FLEXIBLE DRYING TROLLEY
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
KM 152979
Vit/White
1520 x 860 x 1960
Avstånd mellan pinnar
Distancebetweensticks
Vikt (kg)
Weight
Avstånd mellan pinnar 85 mm/14 nivåer/ Distance between sticks 85 mm/14 levels
73
• Pulverlackeradmedelförzinkadepinnar,
överdragna med avtagbar plast
• Sektionernaimittenärjusterbara
• Höjdtillöverstapinne1770mm
• Pinnarnaslängdtotalt740mm,
längd att lägga på 650 mm
• 4länkhjulvarav2medbroms,125mm
• Belastning/planca20kg
• Belastning:300kg
• Powdercoatedwithelectrogalvanisedsticks,
covered with removable plastic
• Thetwosectionsinthemiddleisadjustablesideways
• Heighttotopstick1770mm
• Totallengthofofsticks740mm,
load length 650 mm
• 4swivelcastors,2withbrakes,125mm
• Capacity/levelabout20kg
• Capacity:300kg
KM 152975 TORKVAGN/DRYING TROLLEY
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
KM 152975
Grå/Grey
955 x 600 x 845
Antal plan
Numberofshelves
10
Vikt (kg)
Weight
32,5
•
•
•
•
•
Pulverlackerad,övrehyllplaniboklaminat
Höjdtillövrehyllplan770mm
Avståndmellanhyllplan45mm
4länkhjul,2medbroms,100mm
Belastning:100kg
•
•
•
•
•
Powdercoated,topshelfinbeechlaminate
Heighttotopshelf770mm
Distancebetweenshelves45mm
4swivelcastors,2withbrakes100mm
Capacity:100kg
KM 152976 TORKVAGN/DRYING TROLLEY
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
KM 152976
Grå/Grey
950 x 600 x 1120
122
Antal plan
Numberofshelves
15
Vikt (kg)
Weight
38
•
•
•
•
•
Pulverlackerad,övrehyllplaniboklaminat
Höjdtillövrehyllplan1010mm
Avståndmellanhyllplan45mm
4länkhjul,2medbroms,100mm
Belastning:100kg
•
•
•
•
•
Powdercoated,topshelfinbeechlaminate
Heighttotopshelf1010mm
Distancebetweenshelves45mm
4swivelcastors,2withbrakes100mm
Capacity:100kg
KM 152977 TORKVAGN/DRYING TROLLEY
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
KM 152977
Grå/Grey
950 x 600 x 1640
Antal plan
Numberofshelves
25
Vikt (kg)
Weight
58,5
•
•
•
•
•
Pulverlackerad,övrehyllplaniboklaminat
Höjdtillövrehyllplan1540mm
Avståndmellanhyllplan45mm
4länkhjul,2medbroms,100mm
Belastning:100kg
•
•
•
•
•
Powdercoated,topshelfinbeechlaminate
Heighttotopshelf1540mm
Distancebetweenshelves45mm
4swivelcastors,2withbrakes100mm
Capacity:100kg
KM 152974 TORKSTÄLL/DRYING RACK
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
KM 152974
Blå/Blue
460 x 500 x 1200
Antal plan
Numberofshelves
25
Vikt (kg)
Weight
15
•
•
•
•
•
Pulverlackerad
Torkställförmålningarochteckningar
Avståndmellanhyllplan30mm
4stlänkhjulvarav2medbroms,50mm
Belastning:10kg
•
•
•
•
•
Powdercoated
Dryingrackfordrawingsandpaintings
Distancebetweenshelves30mm
4swivelcastors,2withbrakes,50mm
Capacity:10kg
KM 152978 MÅLARVAGN/PAINT TROLLEY
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
KM 152978
Grå/Grey
700 x 900 x 1505
Antal plan
Numberofshelves
10
Vikt (kg)
Weight
30
•
•
•
•
•
Pulverlackeradmedtavloravplywood,700 x 620 mm
Avståndmellanhyllplan50mm
10näthyllor,nätetsmaska110x100mm
4stlänkhjulvarav2medbroms,50mm
Belastning:50kg
•
•
•
•
•
Powdercoatedwithboardsinplywood,700x620mm
Distancebetweenshelves50mm
10netshelves,netstich110x100mm
4swivelcastors,2withbrakes,50mm
Capacity:50kg
NEW 2014
Lev.tid på förfrågan
Delivery time on request
123
KM 125077 SKO OCH STÖVELTORK/SHOE AND BOOT RACK
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Antal skor
Numberofshoes
Vikt (kg)
Weight
KM 125077
KM125077-O
Grå/Grey
Elz/electrogalv
780 x 714 x 1192
780x714x1192
54
54
19,5
19,5
• Pulverlackeradellerelfözinkadoch
klarlackerad
• 3länkhjul,varav1medbroms,50mm
• Belastning25kg
• Powdercoatedorelectrogalvanisedand
clear coated
• 3swivelcastors,1withbrake,50mm
• Capacity25kg
KM 125077
KM 125077-O
KM 125264 SKO OCH STÖVELTORK/SHOE AND BOOT RACK
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Antal skor
Number of shoes
Vikt (kg)
Weight
KM 125264
KM125264-O
Grå/Grey
Elz/electrogalv
870 x 540 x 1200
870x540x1200
60
60
20,5
20,5
• Pulverlackeradellerelförzinkadochklarlackerad
• 4länkhjul,varav2medbroms,50mm
• Belastning25kg
• Powdercoatedorelectrogalvanisedand
clear coated
• 4swivelcastors,2withbrakes,50mm
• Capacity25kg
KM 125264
KM 125264-O
124
ALLA PRODUKTER PÅ LAGER!
ALL PRODUCTS IN STOCK!
Våra robusta byggvagnar har smarta funktioner och är populära inom
flera branschområden.
Our quality construction trolleys have smart functions and are popular
among a lot of industries.
T 018-18 68 80
E [email protected]
I www.ergoff.se
aranti Wa
r
•G
ANTEE
GUAR
5
• Garan
nty
t
ra
ti Warrant
y
ran
ÅTERFÖRSÄLJARE: ERGOFF MILJÖ AB
Hållnäsgatan 5
752 28 Uppsala
years
arranty • Ga
iW
Symbolen/The symbol = Denna produkt
levereras i platt paket/This product will be
deliveredinflatpack
5-års garanti på alla våra vagnar/
5 years warranty for all of our Trolleys
2 bromsade hjul/2 wheels with
brakes EN 1757-3
Byggvagnar
Construction Trolleys
125-131
125
KM 08600 LYFTTRANSPORTVAGN/LIFTNING TRANSPORT TROLLEY
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
KM 08600
Blå/Blue
4300 x 700 x 530/630
Märkt
Marked
Vikt (kg)
Weight
190
• Pulverlackeradstålkonstruktion
• Ergonomisktlyfterupptill1500kg
• Fyrhjulsstyrd,vilketgerensvängradiepå1,5m
• Bromsasenkeltgenomatttryckahandtagetnedåt
•Flakhöjdmedfällstöduppfällda650-750mm
• Flaklängd2200mm
• Handtagslängd1400mm
• Hjul380x80mmmassivahårdgummi,kullagrade
• Belastning:1500kg
• Powdercoatedsteelconstruction
• Ergonomicliftsupto1500kg
• Fourwheelsteering,whichprovidesaturning
radius of 1,5 m
• Brakessimplybypressingthehandledownwards
• Loadingheightwithfoldingsupport650-750mm
• Lenghtofplatform2200mm
• Lengthofhandle1400mm
• Wheels380x80mmsolidhardrubber,ballbearing
• Capacity:1500kg
KM 08200 SKIVVAGN/BOARD TROLLEY
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
KM 08200
Blå/Blue
1900 x 700 x 1470
126
Vikt (kg)
Weight
105
•
•
•
•
•
•
Pulverlackerad/elförzinkad
Arbetshöjd900mm
Justerbarförolikaskivstorlekar
2punkteringsfriahjul300x100mm
4svängbarahjulvarav2medbroms,160mm
Belastning:500kg
•
•
•
•
•
•
Powdercoated/electrogalvanised
Workheight900mm
Adjustablefordifferentboardsizes
2puncturefreecastors300x100mm
4swivelwheels2withbrakes,160mm
Capacity:500kg
KM 08375 GIPSBOCK/PLASTER BOARD TRESTLE
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
KM 08375
Blå/Blue
1170 x 540 x 660
•
•
•
•
Vikt (kg)
Weight
5
Pulverlackeradgipsbock
Tarlitenplatsnärdeärihopfällda
Ergonomiskarbetshöjd
Lättattförflyttaskivormellanbockarna,
använd gärna tre bockar så blir det stabilt
• OBS-säljsstyckvis
• Belastning:650kg
•
•
•
•
Powdercoatedplasterboardtrestle
Takesuplittlespacefolded
Ergonomicworkingheight
Easytomoveboardsbetweenthebucks,
use three to make it stable
• NOTE-soldindividually
• Capacity:650kg
KM 08400 SKIVTRANSPORTÖR/BOARD TRANSPORTER
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
KM 08400
Blå/Blue
Elz/Electrogalv
1000 x 700 x 1380
Vikt (kg)
Weight
38,5
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
KM 08400B
Blå/Blue
1000 x 700 x 1380
Elz/Electrogalv
38,5
•
•
•
•
Pulverlackad/elförzinkad
Lastbreddibotten140mm
2fastaoch2länkhjul,massivgummi,200mm
Belastning:500kg
•
•
•
•
Powdercoated/electrogalvanised
Bottomloadwidth140mm
2fixedand2swivelcastors,solidrubber,200mm
Capacity:500kg
KM 08450 GRENSTÄLL TILL KM 08400/LOAD CARRIES FOR KM 08400
ART.NR.
Vikt (kg)
Weight
KM 08450
5,5
• Bygelsatsernabestårav6lösa
rör för montage på KM 08400
• 6looseloadcarrierstobe
attached on KM 08400
127
KM 08300 SKIVLYFT/BOARD LIFT
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
KM 08300
Blå/Blue
Elz/Electrogalv
1820 x 800 x 1790
Märkt
Marked
24
•
•
•
•
Pulverlackerad/elförzinkad
Justerbarhöjdmellan1790-3000mm
5länkhjulvarav1medbroms100mm
Belastning:70kg
•
•
•
•
Powdercoated/electrogalvanised
Adjustableheight1790-3000mm
5swivelcastors1withbrake100mm
Capacity:70kg
KM 08350 SKIVLYFT/BOARD LIFT
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
KM 08350
Blå/Blue
Elz/Electrogalv
1820 x 800 x 1790
Märkt
Marked
NEW 2014
128
29
•
•
•
•
•
•
•
Pulverlackad/elförzinkad
Justerbarhöjdmellan1790-3000mm
Tiltbarlastbygel
Lastairättarbetshöjd
Ergonomisk
5länkhjulvarav1medbroms100mm
Belastning:70kg
•
•
•
•
•
•
•
Powdercoated/electrogalvanised
Adjustableheight1790-3000mm
Tiltableloadingbracket
Loadincorrectworkingheight
Ergonomic
5swivelcastors1withbrake100mm
Capacity:70kg
KM 9202 VERKTYGSVAGN/TOOL TROLLEY
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
KM 9202
Blå/Blue
940 x 620 x 610
Vikt (kg)
Weight
35
• Pulverlackeradav1,5mmstålplåt-Volym160L
• Lockav2mmaluzinkplåtoch10mmlaminatskiva,inkl
uppställningsbeslag
• Kraftiglåsregelsomkanlåsasmedhänglås
• Innermåttövredel800x520x255mm
• Innermåttnedredel800x380x180mm
• Längdmedhandtag1490mm
• Luftgummihjul260mm
• Belastning:250kg
•
•
•
•
•
•
•
•
Powdercoatedand1,5mmsteelsheet-Volume160L
Lidof2mmaliuzinksteelsheetand10mmlaminateboard,incl.fittings
Stronglockbolt,lockedwithpadlock(notincuded)
Interiordimensionstop800x520x255mm
Interiordimensionsbottom800x380x180mm
Lengthwithhandle1490mm
Pneumaticwheels260mm
Capacity:250kg
KM 9199 VERKTYGSVAGN/TOOL TROLLEY
ART.NR.
Färg
Colour
L x B x H (mm)
L x W x H (mm)
KM 9199
Blå/Blue
1260 x 760 x 720
Vikt (kg)
Weight
68
• Pulverlackeradav1,5mmstålplåt-Volym300L
• Lockav2mmaluzinkplåtoch10mmlaminatskiva,
inkl. uppställningsbeslag
• Kraftiglåsregelsomlåsesmedhänglås
• Innermåttövredel995x620x275mm
• Innermåttnedredel995x480x240mm
• 2helgjutnagummihjul400x125mmoch
2 länkhjul med broms 125 mm
• Belastning:400kg
•
•
•
•
•
•
Powdercoated1,5mmsteelsheet-Volume300L
Lidof2mmaluzinksteelsheetand10mmlaminateboard,incl.fittings
Stronglockbolt,lockedwithpadlock(notincl)
Interiordimensionstop995x620x275mm
Interiordimensionsbottom995x480x240mm
2rubberwheelswithplasticrim400x125mmand
2 braked swivel castors 125 mm
• Capacity:400kg
KM 08425 BYGGVARUVAGN/DIY TROLLEY
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
KM 08425
Blå/Blue
1000 x 700 x 1250
Storlek korg L x B x H (mm)
SizeofbasketLxBxH(mm)
910 x 190 x 190
Vikt (kg)
Weight
35,5
•
•
•
•
Pulverlackeradbyggvaruvagnmedelzinkadkorg
Höjdtilllastplan320mm
2luftgummihjul260mm,2massivalänkhjul200mm
Belastning:500kg
•
•
•
•
PowdercoatedDIYtrolleywithelectrogalvanisedbasket
Heighttoplatform320mm
2pneumaticwheels260mm,2solidrubberswivel,200mm
Capacity:500kg
129
KM 215 LÅNGGODSKÄRRA/BARROW FOR LONG ITEMS
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
KM 215
Blå/Blue
1600 x 600 x 750
Vikt (kg)
Weight
15
•
•
•
•
Pulverlackerad
Längd:600mm,medhandtag1600mm
Luftgummihjul260mm
Belastning:200kg
•
•
•
•
Powdercoated
Length:600mm,withhandle1600mm
Pneumaticwheels260mm
Capacity:200kg
KM 216 BANDVAGGA/COIL CRADLE
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
KM 216
Blå/Blue
990 x 460 x 640
Vikt (kg)
Weight
16
•
•
•
•
•
•
Pulverlackerad
Passarenkelspolatbandfrån16-19mmbredd
Enkelochsnabbskiftningavspole
Rymligtfackförverktygochtillbehör
Bandningsverktygochstålbandingårinte
Solidagummihjul200mm
•
•
•
•
•
•
Powdercoated
Suitssingle-woundcoil16-19mmwide
Quickandeasychangingofcoil
Spaciouscompartmentfortoolsandaccessories
Coiltoolandcoilarenotincluded
Solidrubberwheels200mm
KM 213 MATERIAL-TRANSPORTVAGN/MATERIALS HANDLING TRUCK
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
KM 213
Blå/Blue
1600 x 600 x 800
130
Vikt (kg)
Weight
15
•
•
•
•
•
•
Pulverlackerad
2handtagsfästensomgöratthandtagetblirvändbart
Längd:600mm,meddraghandtag1600mm
Lastbredd90mm
Luftgummihjul260mm
Belastning:200kg
•
•
•
•
•
•
Powdercoated
2handleattachmentsthatallowhandletoturn
Length:600mm,withhandle1600mm
Loadwidth90mm
Pneumaticcastors260mm
Capacity:200kg
KM 142652 SKIVGODSVAGN/BOARD TROLLEY
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
KM 142652
Gul/Yellow
800 x 380 x 900
9
•
•
•
•
•
Pulverlackerad
Gummikläddlastyta
Lastbredd160mm
Luftgummihjul260x85mm
Belastning:200kg
•
•
•
•
•
Powdercoated
Loadplanewithrubbermat
Loadwidth160mm
Pneumaticwheels260x85mm
Capacity:200kg
KM 142650 SKIVGODSVAGN/BOARD TROLLEY
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
KM 142650
Gul/Yellow
490 x 380 x 260
6
•
•
•
•
•
Pulverlackerad
Gummikläddlastyta
Lastbredd160mm
Luftgummihjul260x85mm
Belastning:200kg
•
•
•
•
•
Powdercoated
Loadplanewithrubbermat
Loadwidth160mm
Pneumaticcastors260x85mm
Capacity:200kg
131
ALLA PRODUKTER PÅ LAGER!
ALL PRODUCTS IN STOCK!
Konga Moving System can be used on several of our trolleys.
Manufactured when ordered.
T 018-18 68 80
E [email protected]
I www.ergoff.se
ti Warrant
y
ran
ÅTERFÖRSÄLJARE: ERGOFF MILJÖ AB
Hållnäsgatan 5
752 28 Uppsala
aranti Wa
r
•G
ANTEE
GUAR
5
years
arranty • Ga
iW
132
Konga Moving System kan användas på flera serier i vårt sortiment. Tillverkas på
beställning.
• Garan
nty
t
ra
Konga Moving System
132-134
Symbolen/The symbol = Denna produkt
levereras i platt paket/This product will be
deliveredinflatpack
5-års garanti på alla våra vagnar/
5 years warranty for all of our Trolleys
2 bromsade hjul/2 wheels with
brakes EN 1757-3
KM 230-630, WIDTH 700 MM PLATFORMSVAGN/PLATTFORM TRUCK
VAGN
TROLLEY
SIDA
PAGE
KM
KM
KM
KM
KM
53-54
54-55
57-59
60-62
63-65
23X-2
33X-2
43X-2
53X-2
63X-2
KOPPLINGSPAKET
TOWINGPACKAGE
KMT
KMT
KMT
KMT
KMT
50-101
50-101
50-101
50-101
50-101
HJUL
CASTORS
KM
KM
KM
KM
KM
144-5
144-5
144-5
144-5
144-5
BROMSADEHJUL
CASTORSWITHBRAKES
KM
KM
KM
KM
KM
144-6
144-6
144-6
144-6
144-6
KM 230-630, WIDTH 800 MM PLATFORMSVAGN/PLATTFORM TRUCK
VAGN
TROLLEY
SIDA
PAGE
KM
KM
KM
KM
KM
53-54
54-55
57-59
60-62
63-65
23X-3
33X-3
43X-3
53X-3
63X-3
KOPPLINGSPAKET
TOWINGPACKAGE
KMT
KMT
KMT
KMT
KMT
50-102
50-102
50-102
50-102
50-102
HJUL
CASTORS
KM
KM
KM
KM
KM
144-5
144-5
144-5
144-5
144-5
BROMSADEHJUL
CASTORSWITHBRAKES
KM
KM
KM
KM
KM
144-6
144-6
144-6
144-6
144-6
VAGN/TROLLEY + KOPPLINGSPAKET/TOWING PACKAGE + HJUL/CASTORS = DRAGVAGN/TOWING TROLLEY
Märkt
Marked
NEW 2014
Lev.tid på förfrågan
Delivery time on request
KM 217-222, WIDTH 800 MM PALLVAGN/PALLET TRUCK
VAGN
TROLLEY
SIDA
PAGE
KM 217-EP
KM 221-EP
KM 222-EP
78
78
78
KOPPLINGSPAKET
TOWINGPACKAGE
KMT 50-104
KMT 50-104
KMT 50-104
HJUL
CASTORS
KM 144-5
KM 144-5
KM 144-5
BROMSADEHJUL
CASTORSWITHBRAKES
KM 144-6
KM 144-6
KM 144-6
VAGN/TROLLEY + KOPPLINGSPAKET/TOWING PACKAGE + HJUL/CASTORS = DRAGVAGN/TOWING TROLLEY
Märkt
Marked
NEW 2014
Lev.tid på förfrågan
Delivery time on request
133
KM 9000, KM 10000 WIDTH 650 MM FLEXIBEL HYLLVAGN/FLEXIBLE TROLLEY
VAGN
TROLLEY
SIDA
PAGE
KM 9000X
KM 10000X
40
66
KOPPLINGSPAKET
TOWINGPACKAGE
HJUL
CASTORS
KMT 32-105
KMT 32-105
BROMSADEHJUL
CASTORSWITHBRAKES
KM 144-51
KM 144-51
KM 144-61
KM 144-61
VAGN/TROLLEY + KOPPLINGSPAKET/TOWING PACKAGE + HJUL/CASTORS = DRAGVAGN/TOWING TROLLEY
Märkt
Marked
NEW 2014
Lev.tid på förfrågan
Delivery time on request
KM 1000E, WIDTH 650 MM ALLROUNDVAGN/ALLROUND TROLLEY
VAGN
TROLLEY
KM 1000E
KOPPLINGSPAKET
TOWINGPACKAGE
KMT 32-109
HJUL
CASTORS
BROMSADEHJUL
CASTORSWITHBRAKES
KM 144-5
KM 144-6
VAGN/TROLLEY + KOPPLINGSPAKET/TOWING PACKAGE + HJUL/CASTORS = DRAGVAGN/TOWING TROLLEY
Märkt
Marked
NEW 2014
Lev.tid på förfrågan
Delivery time on request
RULLCONTAINERS MED TÅGKOPPLING PÅ FÖRFRÅGAN
ROLL CONTAINER AVAILABLE WITH TRAIN CONNECTION ON REQUEST
134
ALLA PRODUKTER PÅ LAGER!
ALL PRODUCTS IN STOCK!
Konga Movern är en kompakt elektrisk dragare som kan användas i olika miljöer för person
eller godstransporter. Centralt för dess utformning är användarvänlighet.
The Konga Mover is a compact electric mover that can be used in and around all kinds of
areas where moving of people and goods are needed. Central to the design is user comfort.
T 018-18 68 80
E [email protected]
I www.ergoff.se
aranti Wa
r
•G
ANTEE
GUAR
5
• Garan
nty
t
ra
ti Warrant
y
ran
ÅTERFÖRSÄLJARE: ERGOFF MILJÖ AB
Hållnäsgatan 5
752 28 Uppsala
years
arranty • Ga
iW
Symbolen/The symbol = Denna produkt
levereras i platt paket/This product will be
deliveredinflatpack
5-års garanti på alla våra vagnar/
5 years warranty for all of our Trolleys
2 bromsade hjul/2 wheels with
brakes EN 1757-3
Konga Mover
135 - 136
135
KM 360 TMX KONGA MOVER
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight
KM 360 TMX
Grön/Green
800 x 670 x 1360
100
Märkt
Marked
•
•
•
•
•
•
•
•
•
Mjukkörning
Säkerhetskänsla
Säkerhetsstyrning
Parkeringsbroms
Nödbroms
Varningssignal
Halkfrittmaterialpåståplattan
Laddningsindikator(synligochmedljud)
Förarnyckel
•
•
•
•
•
•
•
•
•
Verysmoothdriving
Thefeelingofsafety
Safestearing
Parkingbrake
Emergencybrake
Warningbeeper
Nonslipsurfaceontheplattform
Batterypowerindicator(visualandsound)
Operatorkeytopreventunauthorizeduse
NEW 2014
Lev. tid på förfrågan
Delivery time on request
TEKNISK SPECIFIKATION/TECHNICAL DETAILS
•
•
•
•
•
•
•
•
•
•
•
Höjdtillståplatta130mm
Höjdlågdel160mm
Höjdtillvertikalthandtag1350mm
Hastighet6km/tim:maxfart
Batterier60Ahpå24volt
Laddare10Amp
Dragkapacitet1500kg
800watt-topp,500wattnormalkörning
Maxlast150kg
Cirka50kmkörningperladdningochutandraglast
Cirka30kmkörningperladdningmeddraglast
Förarnyckel
Operatorkeytopreventunauthorizeduse
Säkerhetsstyrning
Safe stearing
Halkfri ståplatta
Non slip surface on the platform
•
•
•
•
•
•
•
•
•
•
•
Heightplattform130mm
Heightlowpart160mm
Heighthandlebarvertical1350mm
Speed6km/h:maximumspeed
Batteries60Ahin24Volt
Charger10Amp
Towingcapacity1500kg
Power:800Wattpeak,500Wattcontinuesdrive
Maximumloadonmachine150kg
Approximately50kmdrivewithoutcharging,withouttowingload
Approximately30kmdrivewithoutcharging,withload
Laddningsindikator (synlig och med ljud)
Battery power indicator (visual and sound)
Parkeringsbroms
Parking brake
Varningssignal
Warning beeper
Du kan använda olika drag
Many connection possibilities
Liten svängradie
Small turning circle
136
Nödbroms
Emergency brake
ALLA PRODUKTER PÅ LAGER!
ALL PRODUCTS IN STOCK!
ESD-vagnarna är utrustade med dissipativa mattor.
Här finner du vagnar där hyllplanen enkelt justeras i höjdled för att tillgodose dina
transportbehov. Finns i en mängd olika modeller och storlekar.
ESD Trolleys are equipped with dissipative carpets.
These trolleys have shelves that are adjustable in different heights so it will suit your
transportation needs. They are available in a variety of models and sizes.
T 018-18 68 80
E [email protected]
I www.ergoff.se
aranti Wa
r
•G
TEE
AN
GUAR
5
• Garan
nty
t
ra
ti Warrant
y
ran
ÅTERFÖRSÄLJARE: ERGOFF MILJÖ AB
Hållnäsgatan 5
752 28 Uppsala
years
arranty • Ga
iW
Symbolen/The symbol = Denna produkt
levereras i platt paket/This product will be
deliveredinflatpack
5-års garanti på alla våra vagnar/
5 years warranty for all of our Trolleys
2 bromsade hjul/2 wheels with
brakes EN 1757-3
ESD vagnar
ESD Trolleys
137 - 141
137
KM 8000-2-ESD FLEXIBEL HYLLVAGN/FLEXIBLE SHELF TROLLEY
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM
KM
KM
KM
815 x 470 x 1120
945 x 470 x 1120
1195 x 470 x 1120
1395 x 470 x 1120
8000-2S-ESD
8000-2M-ESD
8000-2L-ESD
8000-2XL-ESD
Vikt (kg)
Weight
21
24
27
29
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM
KM
KM
KM
815
945
1195
1395
NEW 2014
Lev.tid på förfrågan
Delivery time on request
8000-2S-ESDB
8000-2M-ESDB
8000-2L-ESDB
8000-2XL-ESDB
x
x
x
x
470
470
470
470
x
x
x
x
1120
1120
1120
1120
•
•
•
•
•
ElförzinkadmedESDhyllor
Hyllplansteglöstställbaraihöjd
Justerbarthandtag
4länkhjul125mm
Belastning: 250 kg
•
•
•
•
•
ElectrogalvanisedwithESDshelves
Shelvesadjustableinheight
Adjustablehandle
4swivelcastors125mm
Capacity:250kg
Vikt (kg)
Weight
21
24
27
29
KM 8000-3-ESD FLEXIBEL HYLLVAGN/FLEXIBLE SHELF TROLLEY
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM
KM
KM
KM
815
945
1195
1395
8000-3S-ESD
8000-3M-ESD
8000-3L-ESD
8000-3XL-ESD
x
x
x
x
470
470
470
470
x
x
x
x
1120
1120
1120
1120
Vikt (kg)
Weight
26
30
35
38
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM
KM
KM
KM
815
945
1195
1395
NEW 2014
Lev.tid på förfrågan
Delivery time on request
8000-3S-ESDB
8000-3M-ESDB
8000-3L-ESDB
8000-3XL-ESDB
x
x
x
x
470
470
470
470
x
x
x
x
1120
1120
1120
1120
•
•
•
•
•
ElförzinkadmedESDhyllor
Hyllplansteglöstställbaraihöjd
Justerbarthandtag
4länkhjul125mm
Belastning: 250 kg
•
•
•
•
•
ElectrogalvanisedwithESDshelves
Shelvesadjustableinheight
Adjustablehandle
4swivelcastors125mm
Capacity:250kg
Vikt (kg)
Weight
26
30
35
38
KM 8000-4-ESD FLEXIBEL HYLLVAGN/FLEXIBLE SHELF TROLLEY
ART.NR.
KM
KM
KM
KM
8000-4S-ESD
8000-4M-ESD
8000-4L-ESD
8000-4XL-ESD
NEW 2014
Lev.tid på förfrågan
Delivery time on request
138
L x B x H (mm)
L x W x H (mm)
815 x 470 x 1590
945 x 470 x 1590
1195 x 470 x 1590
1395 x 470 x 1590
Vikt (kg)
Weight
34
39
41
48
ART.NR.
KM
KM
KM
KM
L x B x H (mm)
L x W x H (mm)
8000-4S-ESDB
8000-4M-ESDB
8000-4L-ESDB
8000-4XL-ESDB
815 x 470 x 1590
945 x 470 x 1590
1195 x 470 x 1590
1395 x 470 x 1590
•
•
•
•
•
ElförzinkadmedESDhyllor
Hyllplansteglöstställbaraihöjd
Justerbarthandtag
4länkhjul125mm
Belastning: 250 kg
•
•
•
•
•
ElectrogalvanisedwithESDshelves
Shelvesadjustableinheight
Adjustablehandle
4swivelcastors125mm
Capacity:250kg
Vikt (kg)
Weight
34
39
41
48
KM 172-ESD BORDSVAGN/SHELF TROLLEY
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 172-ESD
850 x 435 x 950
Vikt (kg)
Weight
21
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 172-ESDB
850 x 435 x 950
NEW 2014
Lev.tid på förfrågan
Delivery time on request
•
•
•
•
•
ElförzinkadmedESDhyllor
Höjdtillöverstahyllplan720mm
Avståndmellanhyllplan515mm
4länkhjul100mm
Belastning:150kg
•
•
•
•
•
ElectrogalvanisedwithESDshelves
Heighttotopshelf720mm
Distancebetweenshelves515mm
4swivelcastors100mm
Capacity:150kg
Vikt (kg)
Weight
21
KM 173-ESD BORDSVAGN/SHELF TROLLEY
ART.NR.
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
KM 173-ESD
850 x 435 x 950
28
ART.NR.
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
KM 173-ESDB
850 x 435 x 950
28
NEW 2014
•
•
•
•
•
ElförzinkadmedESDhyllor
Höjdtillöverstahyllplan740mm
Avståndmellanhyllplan245mm
4länkhjul100mm
Belastning:150kg
•
•
•
•
•
ElectrogalvanisedwithESDshelves
Heighttotopshelf740mm
Distancebetweenshelves245mm
4swivelcastors100mm
Capacity:150kg
Lev.tid på förfrågan
Delivery time on request
KM 167-ESD FLEXIBEL BACKVAGN/FLEXIBLE BIN TROLLEY
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 167-ESD
470 x 858 x 1880
Vikt (kg)
Weight
20
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 167-ESD B
470 x 858 x 1880
Vikt (kg)
Weight
20
•
•
•
•
•
•
Väljtillgejdrarochhyllplan
Dukanmonteragejdrar/hyllorhorisontellt16°,30°och40°
Förplatsbackar:600x400mm
Antalhål63st,cc:25mm
4länkhjul,100mm
Belastning:150kg
•
•
•
•
•
•
Withoutshelvesandrails
Youcanmountrails/shelveshorizontal16°,30°and40°
Forplasticbins:600x400mm
Numberofholes63,cc:25mm
4swivelcastors,100mm
Capacity:150kg
ART.NR.
Produkt
Product
KM 167-G
KM 167-H
Gejder/par - Rails/Pair
Hyllplan/st - Trays/pce
Vikt (kg)
Weight
1,5
4
NEW 2014
Lev.tid på förfrågan
Delivery time on request
139
KM 4147-ESD BORDSVAGN/SHELF TROLLEY
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 4147-ESD
1070 x 585 x 940
Vikt (kg)
Weight
29,5
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 4147-ESDB
1070 x 585 x 940
NEW 2014
Vikt (kg)
Weight
29,5
•
•
•
•
•
ElförzinkadmedESDhyllor
Höjdtillöverstahyllplan760mm
Avståndmellanhyllplan530mm
4länkhjul125mm
Belastning:250kg
•
•
•
•
•
ElectrogalvanisedwithESDshelves
Heighttotopshelf760mm
Distancebetweenshelves530mm
4swivelcastors125mm
Capacity:250kg
Lev.tid på förfrågan
Delivery time on request
KM 4148-ESD BORDSVAGN/SHELF TROLLEY
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 4148-ESD
1070 x 585 x 940
Vikt (kg)
Weight
40
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 4148-ESDB
1070 x 585 x 940
•
•
•
•
•
ElförzinkadmedESDhyllor
Höjdtillöverstahyllplan760mm
Avståndmellanhyllplan260mm
4länkhjul125mm
Belastning:250kg
•
•
•
•
•
ElectrogalvanisedwithESDshelves
Heighttotopshelf760mm
Distancebetweenshelves260mm
4swivelcastors125mm
Capacity:250kg
Vikt (kg)
Weight
40
NEW 2014
Lev.tid på förfrågan
Delivery time on request
KM 4123-ESD BORDSVAGN/SHELF TROLLEY
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 4123-ESD
980 x 585 x 1445
NEW 2014
Lev.tid på förfrågan
Delivery time on request
140
Vikt (kg)
Weight
43
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 4123-ESDB
980 x 585 x 1445
•
•
•
•
•
•
ElförzinkadmedESDhyllor
Höjd till översta hyllplan 1340 mm
Avstånd mellan hyllplanen 530 mm
Hyllplanets storlek 900 x 540 mm
4 länkhjul, 125 mm
Belastning: 250 kg
•
•
•
•
•
•
ElectrogalvanisedwithESDshelves
Heighttotopshelf1340mm
Distancebetweenshelves530mm
Sizeofshelf900x540mm
4swivelcastors125mm
Capacity:250kg
Vikt (kg)
Weight
43
KM 4124-ESD BORDSVAGN/SHELF TROLLEY
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 4124-ESD
980 x 585 x 1445
Vikt (kg)
Weight
63
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 4124-ESDB
980 x 585 x 1445
NEW 2014
Lev.tid på förfrågan
Delivery time on request
•
•
•
•
•
•
ElförzinkadmedESDhyllor
Höjd till översta hyllplan 1340 mm
Avstånd mellan hyllplanen 250 mm
Hyllplanets storlek 900 x 540 mm
4 länkhjul, 125 mm
Belastning: 250 kg
•
•
•
•
•
•
ElectrogalvanisedwithESDshelves
Heighttotopshelf1340mm
Distancebetweenshelves250mm
Sizeofshelf900x540mm
4swivelcastors125mm
Capacity:250kg
Vikt (kg)
Weight
63
KM 3029, 3030-ESD SÄCKSTÄLLNING/SACK TROLLEY
ART.NR.
Färg
Colour
L x B x H (mm)
L x W x H (mm)
Liter
Liter
Vikt (kg)
Weight
KM3029-ESD
KM3030-ESD
Elz/Electrogalv
Elz/Electrogalv
345x380x690
450x380x900
60
125
5,5
6
• Elförzinkadmedhelbottenplatta
• 4stlänkhjul50mm
• Belastning:30kg
• Electrogalvanisedwithsolidbase
• 4swivelcastors50mm
• Capacity:30kg
NEW 2014
Lev.tid på förfrågan
Delivery time on request
KM 3025, 3026-ESD SÄCKSTÄLLNING/SACK TROLLEY
ART.NR.
Färg
Colour
L x B x H (mm)
L x W x H (mm)
Liter
Liter
Vikt (kg)
Weight
KM3025-ESD
KM3026-ESD
Elz/Electrogalv
Elz/Electrogalv
500x450x900
770x470x900
125
2x125
9
13,5
• Elförzinkadmedhalkskyddförsäckarna
• 4stlänkhjul,75mm
• Belastning:75kg
• Electrogalvanisedwithantislipsackholders
• 4swivelcastors,75mm
• Capacity:75kg
NEW 2014
Lev.tid på förfrågan
Delivery time on request
KM 673-ESD TRALLA/DOLLY
ART.NR.
Färg
Colour
L x B x H (mm)
LxWxH(mm)
Vikt (kg)
Weight(kg)
KM673-ESD
Elz/Electrogalv
600x400x160
8
• Elförzinkad
• 4stlänkhjul,100mm
• Belastning:300kg
NEW 2014
Lev.tid på förfrågan
Delivery time on request
• Electrogalvanised
• 4swivelcastors,100mm
• Capacity:300kg
141
ALLA PRODUKTER PÅ LAGER!
ALL PRODUCTS IN STOCK!
Konga Mekaniskas saltspreaders are available in three different models
and equipped with raincovers and directional flaps to adjust the spread.
T 018-18 68 80
E [email protected]
I www.ergoff.se
ti Warrant
y
ran
ÅTERFÖRSÄLJARE: ERGOFF MILJÖ AB
Hållnäsgatan 5
752 28 Uppsala
aranti Wa
r
•G
ANTEE
GUAR
5
years
arranty • Ga
iW
142
Våra populära saltspridare finns i tre olika modeller. De är utrustade med
regnskydd och justerbara klaffar som reglerar spridningen.
• Garan
nty
t
ra
Spridarvagnar
Spreaders
142 - 143
Symbolen/The symbol = Denna produkt
levereras i platt paket/This product will be
deliveredinflatpack
5-års garanti på alla våra vagnar/
5 years warranty for all of our Trolleys
2 bromsade hjul/2 wheels with
brakes EN 1757-3
KM 944 SALTSPRIDARE/SALT SPREADER
ART.NR.
L x B x H (mm)
L x W x H (mm)
KM 944
1000 x 530 x 900
Vikt (kg)
Weight
11,5
•
•
•
•
Medregnskyddochbehållaremedskärm
Spridararealpåupptill3m
Luftgummihjul300x75mm
Kapacitet:22kg/21L
•
•
•
•
Withraincoverandhopperscreen
Spreadwidthofupto3metres
Pneumaticwheels300x75mm
Capacity:22kg/21L
KM 945 SALTSPRIDARE/SALT SPREADER
ART.NR.
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
KM 945
770 x 580 x 900
11,5
•
•
•
•
•
•
Medregnskyddochbehållaremedskärm
Rostfritthandtag
Justerbaraklaffarsomreglerarspridningen
Spridararealpåupptill3m
Luftgummihjul300x100mm
Kapacitet:37kg/34L
•
•
•
•
•
•
Withraincoversandhopperscreen
Stainlesssteelhandle
Fittedwithdirectionalflapstoadjustthespread
Spreadwidthofupto3metres
Pneumaticwheels300x100mm
Capacity:37kg/34L
KM 946 SALTSPRIDARE/SALT SPREADER
ART.NR.
L x B x H (mm)
L x W x H (mm)
Vikt (kg)
Weight
KM 946
900 x 840 x 900
22,5
•
•
•
•
•
•
Medregnskyddochbehållaremedskärm
Rostfritthandtag
Justerbaraklaffarsomreglerarspridningen
Spridararealpåupptill3m
Luftgummihjul360x130mm
Kapacitet:57kg/53L
•
•
•
•
•
•
Withraincoversandhopperscreen
Stainlesssteelhandle
Fittedwithdirectionalflapstoadjustthespread
Spreadwidthofupto3metres
Pneumaticwheels360x130mm
Capacity:57kg/53L
143
ALLA PRODUKTER PÅ LAGER!
ALL PRODUCTS IN STOCK!
144 - 148
I Konga Mekaniskas sortiment hittar du också välsorterade kvalitetshjul
allt från svart gummi till slitstarka fyllda hjul. Du känner igen Konga
Mekaniskas hjul på känslan när de rullar.
ti Warrant
y
ran
T 018-18 68 80
E [email protected]
I www.ergoff.se
aranti Wa
r
•G
ANTEE
GUAR
5
years
arranty • Ga
iW
144
ÅTERFÖRSÄLJARE: ERGOFF MILJÖ AB
Hållnäsgatan 5
752 28 Uppsala
• Garan
nty
t
ra
Hjul
Wheels
In our assortment you will find high quality wheels in a lot of sizes and
materials. You can recognize Konga Mekaniskas wheel when they moves.
Symbolen/The symbol = Denna produkt
levereras i platt paket/This product will be
deliveredinflatpack
5-års garanti på alla våra vagnar/
5 years warranty for all of our Trolleys
2 bromsade hjul/2 wheels with
brakes EN 1757-3
SVART GUMMI/BLACK RUBBER
ART.NR.
Diameter (mm)
Wheel diameter (mm)
Banbredd (mm)
Widt of tread (mm)
LÄNKHJUL/SWIVELCASTORS
3470PVR100P62 100
35
3470PVR125P62 100
37
3370PRR160P63 160
40
3370PRR200P63 200
50
LÄNKHJULMEDBROMS/SWIVELSWITHBRAKES
3477PVR100P62 100
35
3477PVR125P62 125
37
3377PRR160P63 160
40
3377PRR200P63 200
50
FASTAHJUL//FIXEDWHEEL
3478PVR100P62 100
35
3478PVR125P62 125
37
3478PRR160P63 160
40
3478PRR200P63 200
50
Plattstorlek(mm)
Sizeofplate (mm)
CCmått(mm) Plate hole centres (mm)
Temperatur
Temperature
Belastning(kg)
Load capacity (kg)
105x85
105x85
137x105
137x105
80/77x60
80/77x60
105x80/75
105x80/75
-20/+60°C
-20/+60°C
-20/+60°C
-20/+60°C
75
100
135
205
105x85
105x85
137x105
137x105
80/77x60
80/77x60
105x80/75
105x80/75
-20/+60°C
-20/+60°C
-20/+60°C
-20/+60°C
75
100
135
205
103x85
103x85
137x115
137x115
80/77x60
80/77x60
105x80/75
105x80/75
-20/+60°C
-20/+60°C
-20/+60°C
-20/+60°C
75
100
135
205
Plattstorlek(mm)
Sizeofplate (mm)
CCmått(mm) Plate hole centres (mm)
Temperatur
Temperature
Belastning(kg)
Load capacity (kg)
105x85
105x85
137x105
137x105
80/77x60
80/77x60
105x80/75
105x80/75
-20/+60°C
-20/+60°C
-20/+60°C
-20/+60°C
160
250
300
350
105x85
105x85
137x105
137x105
80/77x60
80/77x60
105x80/75
105x80/75
-20/+60°C
-20/+60°C
-20/+60°C
-20/+60°C
160
250
300
350
103x85
103x85
137x115
137x115
80/77x60
80/77x60
105x80/75
105x80/75
-20/+60°C
-20/+60°C
-20/+60°C
-20/+60°C
160
250
300
350
ELASTIK/ELASTIC
ART.NR.
Diameter (mm)
Wheel diameter (mm)
Banbredd (mm)
Widt of tread (mm)
LÄNKHJUL/SWIVELCASTORS
3470UFR100P62 100
34
3470UFR125P62 125
40
3470UFP160P63 160
46
3470UFP200P63 200
46
LÄNKHJULMEDBROMS/SWIVELSWITHBRAKES
3477UFR100P62 100
34
3477UFR125P62 125
40
3477UFP160P63 160
46
3477UFP200P63 200
46
FASTAHJUL/FIXEDWHEEL
3478UFR100P62 100
34
3478UFR125P62 125
40
3478UFP160P63 160
46
3478UFP200P63 200
46
NYLON/NYLON
ART.NR.
Diameter (mm)
Banbredd (mm)
Plattstorlek(mm)
Wheel diameter (mm) Widt of tread (mm) Sizeofplate (mm)
LÄNKHJUL/SWIVELCASTORS
3470UOP100P62 100
36
3470UAR125P62 125
32
3470UOR160P63 160
40
3470UOR200P63 200
50
LÄNKHJULMEDBROMS/SWIVELSWITHBRAKES
3477UOP100P62 100
36
3477UAR125P62 125
32
3477UOR160P63 160
40
3477UOR200P63 200
50
FASTAHJUL//FIXEDWHEEL
3478UOP100P62 100
36
3478UAR125P62 125
32
3478UOR160P63 160
40
3478UOR200P63 200
50
CCmått(mm)
Temperatur
Plate hole centres (mm) Temperature
Belastning(kg)
Load capacity (kg)
105x85
105x85
137x105
137x105
80/77x60
80/77x60
105x80/75
105x80/75
-40/+80°C
-40/+80°C
-40/+80°C
-40/+80°C
250
200
350
350
105x85
105x85
137x105
137x105
80/77x60
80/77x60
105x80/75
105x80/75
-40/+80°C
-40/+80°C
-40/+80°C
-40/+80°C
250
200
350
350
103x85
103x85
137x115
137x115
80/77x60
80/77x60
105x80/75
105x80/75
-40/+80°C
-40/+80°C
-40/+80°C
--40/+80°C
250
200
350
350
145
TUNG LAST/HEAVY LOAD
ART.NR.
Diameter (mm)
Banbredd (mm)
Plattstorlek(mm)
Wheel diameter (mm) Widt of tread (mm) Sizeofplate (mm)
LÄNKHJUL/SWIVELCASTORS
4680ITP200P63 200
CCmått(mm)
Temperatur
Plate hole centres (mm) Temperature
Belastning(kg)
Load capacity (kg)
50
137x105
105X80/75
-20/+60°C
800
LÄNKHJULMEDBROMS/SWIVELSWITHBRAKES
4687ITP200P63 200
50
137x105
105X80/75
-20/+60°C
800
FASTAHJUL//FIXEDWHEEL
4688ITP200P63 200
137x105
105x80/75
-20/+60°C
800
50
LÄTTA HJUL C HÅL/LIGHT WHEELS C HOLES
ART.NR.
Diameter (mm)
Wheel diameter (mm)
Banbredd (mm)
Widt of tread (mm)
entrumbult(mm)
C
Centerhole (mm)
Temperatur
Temperature
Belastning(kg)
Load capacity (kg)
2470PJP150P30
-20/+60°C
150
32
11
100
LUFT/PNEUMATIC WHEELS
ART.NR.
Diameter (mm)
Wheel diameter (mm)
350562 (länk/swivel)
350564 (fast/fixed)
LUFT260
Banbredd (mm)
Widt of tread (mm)
260
260
260
Plattstorlek(mm)
Sizeofplate (mm)
80
80
80
CCmått(mm)
Plate hole centres (mm)
137 x 105
137 x 105
105 X 80/75
105 X 80/75
Belastning(kg)
Load capacity (kg)
125
125
125
350562
LUFT260
FYLLDA HJUL = PUNKTERINGSFRIA/FILLED WHEELS = FLAT FREE
ART.NR.
Diameter (mm)
Wheel diameter (mm)
2470PNP100P30
2470PNP125P30
2470PNP150P30
KMLUFT400FYLLT
51400090108
FS284
FS307
100
125
150
400
546
260
260
Banbredd (mm) Widt of tread (mm)
C
entrumbult(mm)
Centerhole(mm)
Temperatur
Temperature
Belastning(kg)
Load capacity (kg)
-20/+60°C
-20/+60°C
-20/+60°C
30
30
30
85
170
KMLUFT400FYLLT
2470PNP150P30
146
11
11
11
FS284
2470PNP125P30
FS307
2470PNP100P30
51400090108
60
75
75
375
1300
180
150
HJULSATS FÖR UTBYTE ELASTIKHJUL/REPLACEMENTS CASTORS ELASTIC CASTORS
ART.NR.
Mått (mm)
Size(mm)
2SVÄNGBARAOCH2FASTAHJUL
2FIXEDAND2SWIVELCASTORS
KM 144
200 X 50
Belastning (kg)
Load capacity (kg)
1000
2BROMSADESVÄNGBARAOCH2FASTAHJUL
2FIXEDAND2SWIVELCASTORSW/BRAKES
KM 144-2
200 X 50
1000
4SVÄNGBARAHJUL
4SWIVELCASTORS
KM 144-4
200 X 50
2 svängbara, 2 fasta hjul
2 fixed and 2 swivel castors
4 svängbara hjul
4 swivel castors
1000
2 bromsade svängbara, 2 fasta hjul
2 fixed and 2 swivel castors, with brakes
HJULSATS FÖR UTBYTE NYLONHJUL/REPLACEMENTS CASTORS POLYPROPEN CASTORS
ART.NR.
Mått (mm)
Size(mm)
2SVÄNGBARAOCH2FASTAHJUL
2FIXEDAND2SWIVELCASTORS
KM 5000
200 X 50
Belastning (kg)
Load capacity (kg)
1000
2BROMSADESVÄNGBARAOCH2FASTAHJUL
2FIXEDAND2SWIVELCASTORSW/BRAKES
KM 5000-2
200 X 50
1000
4SVÄNGBARAHJUL
4SWIVELCASTORS
KM 5000-4
200 X 50
2 svängbara, 2 fasta hjul
2 fixed and 2 swivel castors
4 svängbara hjul
4 swivel castors
1000
2 bromsade svängbara, 2 fasta hjul
2 fixed and 2 swivel castors, with brakes
HJULSATS FÖR UTBYTE TUNGLASTHJUL/REPLACEMENTS HEAVYLOAD CASTORS
ART.NR.
Mått (mm)
Size(mm)
2SVÄNGBARAOCH2FASTAHJUL
2FIXEDAND2SWIVELCASTORS
KM 6000
200 X 50
Belastning (kg)
Load capacity (kg)
2500
2BROMSADESVÄNGBARAOCH2FASTAHJUL
2FIXEDAND2SWIVELCASTORSW/BRAKES
KM 6000-2
200 X 50
2500
4SVÄNGBARAHJUL
4SWIVELCASTORS
KM 6000-4
200 X 50
2 svängbara, 2 fasta hjul
2 fixed and 2 swivel castors
4 svängbara hjul
4 swivel castors
2500
2 bromsade svängbara, 2 fasta hjul
2 fixed and 2 swivel castors, with brakes
HJULSATS FÖR UTBYTE LUFTGUMMIHJUL/REPLACEMENTS PNEUMATIC RUBBER CASTORS
ART.NR.
Mått (mm)
Size(mm)
Belastning (kg)
Load capacity (kg)
2SVÄNGBARAOCH2FASTAHJUL
2FIXEDAND2SWIVELCASTORS
KM 141
260 X 85
500
4SVÄNGBARAHJUL
4SWIVELCASTORS
KM 141-4
200 X 85
500
2 svängbara, 2 fasta hjul
2 fixed and 2 swivel castors
4 svängbara hjul
4 swivel castors
147
HJULSATS FÖR UTBYTE MASSIVGUMMIHJUL/REPLACEMENTS SOLID RUBBER CASTORS
ART.NR.
Mått (mm)
Size(mm)
4SVÄNGBARAHJUL
4SWIVELCASTORS
KM 143-4
200 X 50
Belastning (kg)
Load capacity (kg)
800
4 svängbara hjul
4 swivel castors
FAKTA OM VÅRA HJULMODELLER/FACTS REGARDING OUR SET OF CASTORS
•Luftgummihjul260mm,passarutmärktförutomhusbruk
och på ojämnt underlag. Belastning: 500 kg
• Pneumaticrubbercastor,260mm,isexcellentforoutside
workonroughsurface.Capacity:500kg
• Massivgummihjul200mm,vårtvanligastehjul.
Belastning: 800 kg
• Solidrubbercastor,200mm.Capacity:800kg
• Elastikhjul200mm,rullarväldigtlättochtyst.
Belastning: 1000 kg
• Nylonhjul200mm,rullarextremtlättmenharlite
högre ljudnivå. Belastning: 1000 kg
• Tunglasthjul200mm,vårtbästahjulförextrema
belastningar. Belastning: 2500 kg
148
• Elasticcastor,200mm,rollseasyandquiet.
Capacity:1000kg
• Polypropylenecastor,200mm,rollextremelyeasybut
isslightlylouder.Capacity:1000kg
• Castorforheavyload,200mm,ourbestcastorfor
extremeloads.Capacity:2500kg
Specialorder
Special order
149 - 150
Här ser ni ett axplock av de specialvagnar som vi tagit fram till våra kunder. Så vad ni än behöver så kan vi
ta fram det.
The trolleys that we show in this chapter are not available in our standard assortment. They are
special requests from our customers, just to show you, that whatever you need we can provide it.
CAD-ritning/DrawingfromCAD
Färdig vagn/Finished Trolley
149
KONTAKT FÖR FÖRFRÅGAN PÅ SPECIAL/FOR OFFER ON SPECIAL PLEASE CONTACT
ÅTERFÖRSÄLJARE: ERGOFF MILJÖ AB
Hållnäsgatan 5
752 28 Uppsala
150
T 018-18 68 80
E [email protected]
I www.ergoff.se
Download
Related flashcards
Create Flashcards