Long QT Syndrome-Related Antibody Explorer Kit
Cat. #: AK-350
18 vials
Application key: FC- Flow cytometry, IC- Immunocytochemistry, IFC- Indirect flow cytometry, IH- Immunohistochemistry, IP- Immunoprecipitation, WB- Western blot.
Species reactivity key: H- Human, M- Mouse, R- Rat
Anti-KCNE1 (IsK)
Control antigen included
Cat #: APC-163 | Size: 50 µl | Source: Rabbit | Type: Polyclonal | Application: WB | Reactivity confirmed: M, R
Immunogen
Peptide (C)RSKKLEHSHDPFN, corresponding to amino acid residues 68-80 of rat KCNE1. Intracellular, C-terminus.
Homology
Mouse, pig, dog – identical; human – 12/13 amino acid residues identical.
Anti-K V7.1 (KCNQ1)
Control antigen included
Cat #: APC-022 | Size: 50 µl | Source: Rabbit | Type: Polyclonal | Application: IC, IH, IP, WB | Reactivity confirmed: H, M, R
Immunogen
Peptide (C)TYEQLTVPRRGPDEGS, corresponding to amino acid residues 661-676 of human Kv7.1. Intracellular, C-terminus.
Homology
Rat, mouse - 14/16 amino acid residues identical.
Anti-K V7.1 (KCNQ1) (extracellular)
Control antigen included
Cat #: APC-168 | Size: 50 µl | Source: Rabbit | Type: Polyclonal | Application: IC, LCI, WB | Reactivity confirmed: H, M, R
Immunogen
Peptide(C)EKDAVNESGRIEFG,corresponding to amino acid residues 284 - 297 of rat KV7.1. 3rd extracellular loop.
Homology
Mouse – identical; human – 13/14 amino acid residues identical.
Anti-K V11.1 (erg1)
Control antigen included
Cat #: APC-016 | Size: 50 µl | Source: Rabbit | Type: Polyclonal | Application: IC, IH, IP, WB | Reactivity confirmed: H, M, R
Immunogen
Peptide (CY)EEL PAGAP ELPQD GPT, corresponding to residues 1122-1137 of rat Kv11.1 (erg1). Intracellular, C-terminal part.
Homology
Mouse - identical; human, dog, rabbit - 14/16 amino acid residues identical.
Anti-hK V11.1 (HERG)
Control antigen included
Cat #: APC-062 | Size: 50 µl | Source: Rabbit | Type: Polyclonal | Application: IC,IH, IP, WB | Reactivity confirmed: H, M, R
Immunogen
GST fusion protein with sequence DSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQ
PLHRHGSDPGS, corresponding to amino acid residues 1106-1159 of human Kv11.1 (HERG), (MW: 35 kDa.). Intracellular, Cterminus.
Homology
Rabbit - identical; dog - 51/54 amino acid residues identical; mouse, rat - 50/54 amino acid residues identical.
Anti-K V11.1 (HERG) (extracellular)
Control antigen included
Cat #: APC-109 | Size: 50 µl | Source: Rabbit | Type: Polyclonal | Application: IC, IFC, IH, IP, LCI, WB | Reactivity confirmed: H, R
Immunogen
Peptide AFLLKETEEGPPATEC corresponding to residues 430-445 of human KV11.1 (HERG). Extracellular, between S1 and S2
domains.
Homology
Rat, mouse - 11/16 amino acid residues identical; dog, rabbit - 15/16 amino residues identical.
Control antigen included
Anti-NaV1.5
Cat #: ASC-005 | Size: 50 µl | Source: Rabbit | Type: Polyclonal | Application: IC, IH, IP, WB | Reactivity confirmed: H, M, R
Immunogen
Peptide DRLPKSDSEDGPRALNQLS(C), corresponding to amino acid residues 493-511 of rat NaV1.5. Intracellular loop between
domains I and II.
Homology
Mouse - identical; human - 17/19 amino acid residues identical.
Anti-Human NaV1.5
Control antigen included
Cat #: ASC-013 | Size: 50 µl | Source: Rabbit | Type: Polyclonal | Application: IC, IFC, IH, WB | Reactivity confirmed: H, R
Immunogen
GST fusion protein with amino acid residues 1978-2016 of human Nav1.5, (MW: 33 kDa.). Intracellular, C-terminus.
Homology
Rat - 36/39 amino acid residues identical; mouse - 34/39 amino acid residues identical.
Control antigen included
Anti-NaV1.5
Cat #: AGP-008 | Size: 50 µl | Source: Guinea pig | Type: Polyclonal | Application: WB | Reactivity confirmed: H, M, R
Immunogen
Peptide DRLPKSDSEDGPRALNQLSC, corresponding to amino acid residues 493-511 of rat Nav1.5. Intracellular loop between
domains I and II.
Homology
Mouse - identical; human - 17/19 amino acid residues identical.
Storage & Reconstitution Instructions:
Storage before reconstitution
Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Reconstitution
Add deionized water, depending on the sample size.
Buffer after reconstitution
Phosphate buffered saline (PBS), pH 7.4, 1% BSA, 0.025% NaN3.
Storage after reconstitution
The reconstituted solution can be stored at 4°C for up to 2 weeks. For longer periods, small aliquots should be stored at -20°C or below. Avoid
multiple freezing and thawing. The further dilutions should be made using a carrier protein such as BSA (1%). Centrifuge all antibody
preparations before use (10000 × g 5 min).
Control antigen storage before reconstitution
Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Control antigen reconstitution
100 μl water.
Control antigen storage after reconstitution
-20ºC.
Preadsorption control
1 μg peptide per 1 μg antibody.