PRODUCT DATA SHEET Recombinant Human ER (ER alpha) Catalog Number: 90039 Description: This product is the N-terminal region of estrogen receptor. ER is a ligand-activated transcription factor composed of several domains important for hormone binding, DNA binding, and activation of transcription. The protein localizes to the nucleus where it may form a homodimer or a heterodimer with estrogen receptor 2. Estrogen and its receptors are essential for sexual development and reproductive function, but also play a role in other tissues such as bone. Estrogen receptors are also involved in pathological processes including breast cancer, endometrial cancer, and osteoporosis PRODUCT SPECIFICATIONS Product Details: Purified human recombinant ER (ER alpha) protein (amino acids 2-181, 180 a.a.) produced in human cells. (Accession NP_000116.2; UniProt P03372) Purity: >95% pure by SDS-PAGE Source: Human cell line Formulation: Lyophilized from 0.2µm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free). Endotoxin: <0.1EU per g protein by LAL method Predicted Molecular Weight: 19.4 kDa Tag: StrepII at N Cell Culture Medium: Chemically-defined, serum- and animal-product-free culture medium Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. Stability & Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles. Sequence: TMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGG FPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKE SDS-PAGE of 2 g purified recombinant ER (ER alpha). FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES. PlexBio Co., Ltd. 6F-1 No. 351 Yangguang St., Neihu District, Taipei 11491 Version 1.1 315130 tel. | +886-2-2627-5878 email | contact@plexbio.com web | www.plexbio.com