Product datasheet Anti-E2F8 antibody ab185727 1 Image Overview Product name Anti-E2F8 antibody Description Rabbit polyclonal to E2F8 Tested applications IHC-P, WB Species reactivity Reacts with: Human Predicted to work with: Mouse, Rat, Cow Immunogen Recombinant full length protein corresponding to Human E2F8 aa 1-867. Sequence: MENEKENLFCEPHKRGLMKTPLKESTTANIVLAEIQPDFGPLTTPTKPKE GSQGEPWTPTANLKMLISAVSPEIRNRDQKRGLFDNRSGLPEAKDCIHEH LSGDEFEKSQPSRKEKSLGLLCHKFLARYPNYPNPAVNNDICLDEVAEEL NVERRRIYDIVNVLESLHMVSRLAKNRYTWHGRHNLNKTLGTLKSIGEEN KYAEQIMMIKKKEYEQEFDFIKSYSIEDHIIKSNTGPNGHPDMCFVELPG VEFRAASVNSRKDKSLRVMSQKFVMLFLVSTPQIVSLEVAAKILIGEDHV EDLDKSKFKTKIRRLYDIANVLSSLDLIKKVHVTEERGRKPAFKWTGPEI SPNTSGSSPVIHFTPSDLEVRRSSKENCAKNLFSTRGKPNFTRHPSLIKL VKSIESDRRKINSAPSSPIKTNKAESSQNSAPFPSKMAQLAAICKMQLEE QSSESRQKVKVQLARSGPCKPVAPLDPPVNAEMELTAPSLIQPLGMVPLI PSPLSSAVPLILPQAPSGPSYAIYLQPTQAHQSVTPPQGLSPTVCTTHSS KATGSKDSTDATTEKAANDTSKASASTRPGSLLPAPERQGAKSRTREPAG ERGSKRASMLEDSGSKKKFKEDLKGLENVSATLFPSGYLIPLTQCSSLGA ESILSGKENSSALSPNHRIYSSPIAGVIPVTSSELTAVNFPSFHVTPLKL MVSPTSVAAVPVGNSPALASSHPVPIQNPSSAIVNFTLQHLGLISPNVQL SASPGSGIVPVSPRIESVNVAPENAGTQQGRATNYDSPVPGQSQPNGQSV AVTGAQQPVPVTPKGSQLVAESFFRTPGGPTKPTSSSCMDFEGANKTSLG TLFVPQRKLEVSTEDVH Database link: A0AVK6 Run BLAST with Positive control Run BLAST with HeLa cell lysate. Properties Form Liquid Storage instructions Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. 1 Storage buffer pH: 7.3 Preservative: 0.02% Sodium azide Constituents: 49% PBS, 50% Glycerol Purity Immunogen affinity purified Clonality Polyclonal Isotype IgG Applications Our Abpromise guarantee covers the use of ab185727 in the following tested applications. The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user. Application Abreviews IHC-P Notes 1/50 - 1/200. ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody. WB 1/500 - 1/2000. Predicted molecular weight: 94 kDa. Target Function Along with E2F7, inhibitor of E2F-dependent transcription. Binds DNA independently of DP proteins through the E2 recognition site, 5'-TTTC[CG]CGC-3'. Directly represses E2F1 transcription. Appears to regulate a subset of E2F-dependent genes whose products are required for normal cell cycle progession. Sequence similarities Belongs to the E2F/DP family. Domain Both DNA-binding domains are required for DNA-binding and are proposed to form an intramolecular structure that is similar to the winged helix structure of the E2F-DP heterodimer. Cellular localization Nucleus. Anti-E2F8 antibody images Anti-E2F8 antibody (ab185727) at 1/500 dilution + HeLa cell lysate Predicted band size : 94 kDa Western blot - Anti-E2F8 antibody (ab185727) Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE" Our Abpromise to you: Quality guaranteed and expert technical support 2 Replacement or refund for products not performing as stated on the datasheet Valid for 12 months from date of delivery Response to your inquiry within 24 hours We provide support in Chinese, English, French, German, Japanese and Spanish Extensive multi-media technical resources to help you We investigate all quality concerns to ensure our products perform to the highest standards If the product does not perform as described on this datasheet, we will offer a refund or replacement. For full details of the Abpromise, please visit http://www.abcam.com/abpromise or contact our technical team. Terms and conditions Guarantee only valid for products bought direct from Abcam or one of our authorized distributors 3