Conformational Dynamics Control Catalysis in Disparate Systems: Structural Insights from DNA Repair and Antibiotic Biosynthetic Enzymes by Jeremy Wayne Setser B.S., Chemistry (2008) The University of Akron OF TECHNOLOGY 1 JUN 3 0 2014 LIBRARIES Submitted to the Department of Chemistry in Partial Fulfillment of the Requirements for the Degree of Doctor of Philosophy at the MASSACHUSETTS INSTITUTE OF TECHNOLOGY June 2014 C 2014 Massachusetts Institute of Technology. All rights reserved. Signature of Author ......... Signature redacted Department of Chemistry May 9,2014 Signature redacted,. C ertified by ........................................................................................................................ . Catherine L. Drennan Professor of Chemistry and Biology Howard Hughes Medical Institute Investigator and Professor Thesis Supervisor A ccepted by ................................ Signature redacted Robert W. Field Chairman, Departmental Committee on Graduate Students This doctoral thesis has been examined by a Committee of the Department of Chemistry as follows: Signature redacted Assistk1't Professor Elizabeth M. Nolan Committee Chairman Pfizer-Laubach Career Development Assistant Professor of Chemistry Signature redacted Professor Catherine L. Drennan Research Supervisor Professor of Chemistry and Biology Howard Hughes Medical Institute Investigator and Professor Signature redacted Professor Leona D. Samson Committee Member Professor of Biological Engineering and Biology Uncas and Helen Whitaker Professor American Cancer Society Research Professor 2 Conformational Dynamics Control Catalysis in Disparate Systems: Structural Insights from DNA Repair and Antibiotic Biosynthetic Enzymes by Jeremy Wayne Setser Submitted to the Department of Chemistry on May 9, 2014 in Partial Fulfillment of the Requirements for the Degree of Doctor of Philosophy in Biological Chemistry ABSTRACT Chemical reactions allow biological systems to function. The majority of these biochemical reactions occur due to the work of protein catalysts known as enzymes. These biocatalysts are often thought of as pre-formed, static 'locks' that bind, and subsequently transform, their substrate molecule 'keys'. However, scientists are increasingly finding that dynamic movements of enzymes are a crucial aspect of catalysis. One such example of a system that relies on conformational flexibility is the human DNA repair protein alkyladenine DNA glycosylase (AAG). To efficiently repair DNA, AAG must search the millionfold excess of unmodified DNA bases to find a handful of DNA lesions. Such a search can be facilitated by the ability of glycosylases, like AAG, to interact with DNA using two affinities: a lower-affinity interaction in a searching process, and a higher-affinity interaction for catalytic repair. We have captured crystallographic snapshots of AAG bound to DNA in both high- and lower-affinity states. These depictions reveal several significant and unexpected protein structural rearrangements, providing molecular insight into the DNA-searching process adopted by AAG. By combining these new insights with existing biochemical and structural data, we are able to relate AAG to the big picture question of how DNA binding proteins find their binding sites in the vast expanse of the genome. In another study, a member of a biosynthetic pathway for antibiotic natural products, called kutznerides, was shown to be dependent on conformational changes. The enzyme in question, KtzI, uses a bound flavin cofactor, reducing equivalents from NADPH, and molecular oxygen to install a hydroxyl group on the side-chain nitrogen of the amino acid L-ornithine, which is subsequently incorporated into the kutzneride scaffold. KtzI was structurally characterized after being subjected to various chemical and environmental factors, capturing the enzyme in several states along its catalytic trajectory. These states suggest that a novel conformational change of both the protein backbone and the flavin moiety must take place in order to complete the enzymatic cycle of KtzI. This drastic rearrangement was also shown to be chemically interchangeable in the protein crystal, suggesting that these dynamic motions are catalytically relevant. Thesis Supervisor: Title: Catherine L. Drennan Professor of Chemistry and Biology Howard Hughes Medical Institute Investigator and Professor 3 ACKNOWLEDGEMENTS I am indebted to so many people for so many things. First, I would like to say thank you to Cathy for accepting me into your group, and believing I could succeed. Joining a completely foreign research area was daunting enough to me; I cannot imagine having the amount of trust needed to believe I could learn from the ground up. It really has been an amazing experience over the past six years. I would also like to thank Liz Nolan, Leona Samson, and Sarah O'Connor for their scientific insights and guidance during this time. A large part of my graduate experience was built by the support of my fellow lab members, to whom I owe many thanks. Graduate school is not easy. Experiments fail almost exclusively. Without the support of the Drennan Lab members, past and present, this would have been a crippling undertaking. Thank you all. To Nozomi Ando - I could say that I would have made it through the final years of graduate school without my lab BFF, but I would probably be lying. Thank you for spending countless hours listening and laughing with me. Your support and friendship bolstered me when I was at my most disillusioned. To Peter Goldman - You were the first person I talked to in the Drennan Lab, and made me understand that a regular dude could succeed in our lab. This realization was a large part of why I joined in the first place. Even if the utter breakdown of your body ruined our chances at volleyball supremacy, you made our lab a fun place to be. To Marco Jost - I was reluctant to accept the 'hot shot German' who knew everything about crystallography coming into our lab, but you won me over eventually. I have no problem getting your advice now, because I have come to understand you as the 'hot shot German' who knows everything about everything. To Yan Kung and Christine Phillips Piro - Thank you for teaching me what it meant to be a Drennan Lab member. To Mishtu Dey and Danny Yun - Thank you for your ever-patient guidance. Ultimately, friends and family are the reason I made it through graduate school. I love you all. To Emily Setser - Even though you will always be Emily Lippert to me, I am excited every time I remember we are married. You have been my most important source of support for over six years. Thank you for being the best thing that has happened to me. I could not have done this without you. I love you clown. To Jeff Setser - Thank you for always being there to provide a brother's love when I needed it most. To Diana Setser - I could not have asked for a better Sister-in-law, and the joy I have observed in your household always reminds me that things will be OK. To Nola, June, and Oden Setser - Thank you for being constant reminders that the future will be bright and joyful. To my Dad, Jim Setser - Thank you for constantly making sure I was healthy and happy. To Mom and Dad Lippert - Thank you for always treating me as your own Son. To Josh Slaga - We have come a long way since 8 th grade. Thank you for handling all best friend-related duties for the last 15 years. To Alyssa Larson - The free stuff line at Sid Pac may not have offered up any useful items, but it did provide me with a best friend here at MIT. Thank you for being a constant source of support for five years and counting. To all CGSC members past and present - Always remember that we actually make an impact around here. Keep it up. To all my other friends here and elsewhere - Thank you for your support and all the fun times had at TGIF, the Muddy, around Boston, in Ohio, and around the country; It has all been instrumental in getting me to this point. Finally, this thesis would not have been possible without my Mother..She supported me in every endeavor, in any way that she could...even if this meant letting her 'baby' move 650 miles away from home. My Mother passed away in the middle of graduate school, and the period of time before, during, and after this tragedy was the worst experience of my life. I was extremely lucky to have an advisor as understanding as Cathy, as I spent much of my Mother's last months at her bedside. This time allowed me to support and comfort her in what ways I could, and to spend what would end up being our last quality time together. 'Grateful' does not even begin to express the amount of appreciation I have for my Mother's wonderful influence. 'Sorrow' falls incredibly short of describing what I feel in her absence. Therefore, I would like to dedicate this thesis in honor of the kind, strong, generous, and above all, loving woman that was my Mother. 4 For Judy Ann Setser. I love you Mom. 5 6 Table of Contents ABSTRACT ACKNOWLEDGEMENTS 3 4 Chapter 1. The Dynamism of DNA-binding and Flavin-dependent Enzymes I. I.1I 1.111 I.IV SUMMARY INTRODUCTION DNA repair by human alkyladenine DNA glycosylase (AAG) Natural product biosynthesis with FAD-dependent N-hydroxylases FIGURES Figure 1.1 The damage of DNA bases. Figure 1.2 Base excision repair (BER) in humans. Figure 13 Introduction to the flavin and nicotinamide cofactors. Figure 1.4 General mechanism of flavin-dependent monooxygenases. I.V REFERENCES 13 13 15 16 19 23 Chapter 2. Structural Basis for the Inhibition of Human Alkyladenine DNA Glycosylase (AAG) by 3,N 4-Ethenocytosine-containing DNA 11.1 SUMMARY 11.11 INTRODUCTION 11.111 RESULTS AAG binding studies Catalytic ability of AAG for eC containingDNA Inhibition of AAG by cC containing DNA Overall structure of the JI79AAG-EC DNA inhibitorcomplex Protein-DNA interactions Metal ion Mn2 , in the A79AAG-EC:G structure Active site architectureof JI79AAG-EC DNA complex II.IV DISCUSSION II.V MATERIALS AND METHODS J79AAG plasmid construction, creation of mutants, andprotein preparation AAG protein expression andpurification Preparationof oligonucleotidesand 32P-labeling Gel mobility shift assays DNA glycosylase assays Competition DNA glycosylase assays Crystallizationof the I79AAG-EC:G complex Data collection and structure determination II.VI ACKNOWLEDGEMENTS 27 28 30 34 37 42 7 TABLES & FIGURES Table 11.1 Table 11.2 Table 11.3 Figure 11.1 Figure 11.2 Figure Figure Figure Figure Figure II.3 11.4 11.5 11.6 11.7 Figure 11.8 Figure 11.9 Figure 11.10 43 Dissociation constant (Kd) values measured using gel shift assays; and 50% inhibitory concentration (IC50) for the inhibition of A79AAG activity on EA:T 25-mer, measured using competition DNA glycosylase assay at 37'C, in the presence of increasing concentration of cold competitor 13-mer duplexes. Data collection and refinement statistics of the A79AAG-DNA complex. List of oligonucleotide primers used for the creation of A79AAG mutants by PCR based site directed mutagenesis. Biochemical characterization of AAG variants with oligomers containing etheno lesions. Gel results of DNA glycosylase assays for truncated A79AAG on EA:T and EC:X (X=G/A/T/C) 13-mer DNA duplexes used for crystallization. Structure of A79AAG with EC inhibitor DNA. Comparison of the overall structures of the A79AAG-DNA complexes. Cation site in A79AAG structures. Interaction of Tyr 162 and putative Mn 2 ' binding site in the structure of A79AAG-cC:G. Active site architecture of AAG. AAG binding pocket. Activation of the leaving group by protonation. A wall-eyed stereoview of the active site of AAG. II.VII REFERENCES 58 Chapter 3. Searching for DNA Lesions: Structural Evidence for Lower- and Higher-Affinity DNA Binding Conformations of Human Alkyladenine DNA Glycosylase III. SUMMARY 111.11 INTRODUCTION 111.111 RESULTS Structural overview of asymmetric unit A79AAG pseudo-duplex structure A79AAG lower-affinity structure III.IV DISCUSSION III.V MATERIALS AND METHODS AAG plasmidconstruction andproteinpreparation Crystallization of A79AAG with single-strandedEC DNA Data collection and structure determination III.VI ACKNOWLEDGEMENTS TABLES & FIGURES Table 111.1 Figure 111.1 Figure 111.2 Figure 111.3 Figure III.4 Figure 111.5 Figure 111.6 8 61 62 64 67 70 72 73 Data collection and refinement statistics for A79AAG-DNA complex. DNA adducts to which AAG binds with high affinity: Lesions (A) EC and (B) EA and (C) one-base loop structures. Structures of A79AAG bound to EC DNA. Wall-eyed stereoview of the disordered loops of the lower-affinity A79AAG structure in the context of the crystal lattice. A79AAG shows no affinity for ssFC 13-mer by gel shift. A79AAG structural comparisons. Tyr162 contacts in lower-affinity A79AAG. Figure 111.7 Figure 111.8 Figure 111.9 Comparison of the lower-affinity A79AAG structure with the high-affinity A79AAG-EA:T structure. Wall-eyed stereoviews of electron density in the lower-affinity A79AAG structure. Proposal for how AAG can recognize DNA with two different affinities. III.VIIREFERENCES 84 Chapter 4. Crystallographic Evidence for Drastic Conformational Changes in the Active Site of a Flavin-Dependent N-hydroxylase IV.I SUMMARY IV.II INTRODUCTION IV.III RESULTS Quaternarystructure Active site of reduced KtzI Active site of oxidized KtzI In crystallo conformationalchanges IV.IV DISCUSSION IV.V MATERIALS AND METHODS Proteinexpression andpurification Reconstitution of KtzI for crystallization Crystallizationof KtzI Re-reduction of oxidized KtzI crystals Re-oxidation of reduced KtzI crystals Data collection, structure determination,and structuralanalysis IV.VI ACKNOWLEDGEMENTS TABLES & FIGURES Table IV.1 Table IV.2 Table IV.3 Table IV.4 Table IV.5 Table IV.6 Table IV.7 Table IV.8 Figure IV.1 Figure IV.2 Figure IV.3 Figure IV.4 Figure IV.5 Figure IV.6 Figure IV.7 Figure IV.8 Figure IV.9 Figure IV.10 87 88 91 97 106 112 113 Structures of KtzI and their respective resolution. Data collection and refinement statistics for KtzI-FADred-NADP'-L-orn. Data collection and refinement statistics for KtzI-FADox-NADP*-L-orn. Data collection and refinement statistics for KtzI-FADred-ox-NADP'-L-orn. Data collection and refinement statistics for KtzI-FADred-NADP'-Br. Data collection and refinement statistics for KtzI-FADox-Br. Data collection and refinement statistics for KtzI-FADox-red-NADP*-Br. List of ordered residues and those modeled as alanine in KtzI structures. Kutzneride scaffold cryptically incorporates the product of KtzI. Sequence alignment of L-orn N-hydroxylases. Proposed kinetic mechanism for L-orn N-hydroxylases. Crystals of reconstituted KtzI. Structure of KtzI in reduced and oxidized states. Tetrameric assembly of L-orn N-hydroxylases. Wall-eyed stereoview of the electron density for bent isoalloxazine ring. Wall-eyed stereoviews of the active sites of reduced L-orn N-hydroxylases. Wall-eyed stereoviews of the active sites of oxidized KtzI. Structurally-based proposal for L-orn N-hydroxylase mechanism. II.VII REFERENCES 138 9 Chapter 5. Outstanding Questions for AAG and KtzI V.1 V.II V.111 SUMMARY Repairing DNA with AAG Antibiotic biosynthesis with KtzI FIGURES Figure V.1 Figure V.2 Figure V.3 V.IV Sequence alignment of our N-terminal truncation mutant (A79) and full-length (FL) alkyladenine DNA glycosylase (AAG). Kinetic mechanism for hydroxylation in (a) bold and (b) cautious flavin-dependent monooxygenases. Diverse flavin conformations are found in (a) KtzI and (b) para-hydroxybenzoate hydroxylase (PHBH). REFERENCES Curriculum Vitae 10 143 143 145 149 152 153 11 12 Chapter 1. The Dynamism of DNA-binding and Flavin-Dependent Enzymes I.I SUMMARY Chemical reactions are at the heart of life. Molecules combine and change to create new entities, and life has emerged from, and mutated in response to, these chemicals. Many chemical reactions are not favored, with some likely to occur only on the timescale of millions of years. To accelerate these reactions in biological systems, enzymes are used. These biological catalysts function by binding a substrate and hastening its transformation into a product. Many enzymes depend on dynamic movements to catalyze their chemical reactions, and this dissertation will examine two such cases. In Chapters 2 and 3, an enzyme that repairs DNA in humans will be discussed. The subject of Chapter 4 will be a member of an assembly line of enzymes responsible for synthesizing an antibiotic in a soil bacterium. These dissimilar systems are linked by their reliance on conformational flexibility. 1.11 INTRODUCTION Proteins comprise a significant portion of the cellular makeup, up to 55% in Escherichia coli (1). These entities perform functions as wide-ranging as acting as a cellular garbage disposal, in the case of proteolytic species like the 26S proteasome, to determining which cellular entities are produced by binding DNA sequences, in the case of transcription factors like NF-KB, to synthesizing vital components of the cell, like the over 30 enzymes involved in the biosynthesis of cholesterol. Dysfunctions in any of these pathways are linked to disease in humans, underlining their practical importance for our health and well-being. The proteins that function to take a hypothetical substrate 'S', to its product 'P', are known as enzymes, and are an extremely active area of research. Enzymes use their amino acids, and in some cases, the help of organic or inorganic species known as cofactors, to accelerate chemical reactions, thus acting as biological catalysts. These biocatalysts have traditionally been viewed as having a fixed structure that is tuned to precisely fit its substrate molecule, stemming from their initial likening to a "lock and key" by H. Emil Fischer in the late 1 9 th century. In more recent years, however, proteins have been understood to be dynamic, and an emphasis has been placed on studying both small-scale (short timescale) and large-scale (long timescale) movements, as this conformational flexibility is often vital to a protein's function (reviewed in (2)). Various techniques including nuclear magnetic resonance (NMR), small-angle X-ray scattering (SAXS), and fluorescence methods like those 13 based on Fbrster resonance energy transfer (FRET), are well-suited to study large-scale conformational changes, as these techniques occur while the protein is in solution, mimicking the freedom found in the cellular milieu (2). X-ray crystallography, which requires a protein to be trapped in a crystalline lattice (often frozen at 100K), is less useful in this context, as the protein's degrees of freedom are limited. What this method does provide, however, is a much higher-resolution picture than the other techniques mentioned above. Therefore, X-ray crystallography tends to trade the vital information on conformational flexibility for more detailed molecular-level understanding. Indeed, a crystal structure provides very little in the way of dynamic information. As we will show in this thesis, however, a combination of crystal structures can illustrate the flexibility of a protein. In the following chapters, we describe the ability to get the best of both worlds, obtaining information on protein dynamics by combining a series of atomic-level snapshots, using two enzymes with very dissimilar roles as case studies. In Chapters 2 and 3, we analyze the human DNA repair protein alkyladenine DNA glycosylase (AAG). In Chapter 4, we will examine the L-ornithine N-hydroxylase from Kutzneria sp. 744, KtzI. These two enzymes function in very different worlds. AAG repairs damaged DNA in humans, and KtzI is a member of a host of enzymes that synthesize natural product defenses for a soil actinomycete. Through our structural work, however, we have found that these systems are linked through their reliance on conformational changes. For AAG, we have snapshots of the enzyme both bound to an inhibitor DNA base (Chapter 2) and interacting with DNA in a nonspecific manner (Chapter 3). These structures allow us to observe the differences between these higher- and lower-affinity complexes, with most alterations found in a region that is highly flexible in the absence of a bound DNA base. By compiling our data with that of the field in general, we propose this dynamic region to be vital for AAG's ability to search for its damaged-DNA substrates. For KtzI, we have determined several structures of this enzyme along its reaction path, which indicate that a highly mobile active site, including movements of the protein backbone and the flavin cofactor, is required for catalysis (Chapter 4). We have been able to recapitulate these proposed conformational interchanges in the protein crystal, showing that the required conformational flexibility is both chemically competent, and able to occur in the "rigidified" environment of the crystalline lattice. Together, these studies show large-scale dynamics to be a crucial aspect of enzyme catalysis, and further, that this 14 information can be obtained by a collection of X-ray crystallography snapshots put together in a 'flip-book'-type methodology. 1.111 DNA repair by human alkyladenine DNA glycosylase (AAG) Damaged DNA must be repaired to allow faithful replication of genetic information for healthy cell division and, thus, for life to occur. Ultraviolet light, ionizing radiation, xenobiotic chemicals such as alkylating agents, and endogenous metabolites such as reactive oxygen and nitrogen species (RONS) or methylating agents (e.g. S-adenosylmethionine, AdoMet) can harm nucleic acids (3). The most common manifestations of DNA damage are known as DNA lesion bases (4), where a canonical DNA base (Figure 1.1, top) is chemically altered (Figure 1.1, bottom). These lesion bases occur at a rate of 10,000 per cell per day (4, 5), and affect base pairing interactions and DNA energetics, causing transition (A<-+G; C<-+T) and transversion (A,G-*C,T) mutations and, as errors are compounded, cell death (5, 6). Most DNA lesions are repaired via base excision repair (BER), an endogenous pathway that removes and replaces the damaged base in a series of steps (3). BER is highly conserved in all kingdoms of life (7), and in humans these steps are catalyzed by the sequential action of a DNA glycosylase, AP endonuclease I, DNA polymerase P, and DNA ligase I/III ((8, 9); Figure 1.2). Alkyladenine DNA glycosylase (AAG) is a monofunctional DNA glycosylase involved in the human BER process. Monofunctional glycosylases, which lack inherent endonuclease activity, initiate BER by binding specific lesion bases and catalyzing the cleavage of the bond between the base and its ribose sugar (N-glycosidic bond), releasing the free base and leaving behind an apurinic/apyrimidinic (AP) site (Figure 1.2, 1). The repair of the AP site is completed by the action of three subsequent enzymes as mentioned above (Figure 1.2, 2-4), which finally restores the DNA to its undamaged state. AAG has been of particular interest due to its involvement in remediating lesions brought on by chronic inflammatory diseases like ulcerative colitis (10-12), which predispose individuals to cancer. Further, AAG represents an interesting biochemical problem as it recognizes a wide variety of lesion bases (13-15), including substrates that it can excise, such as 1,M-ethenoadenine (EA) and 7-methylguanine (7-meG) (Figure I.1), and those that it cannot remove, including the inhibitory 3,N 4-ethenocytosine lesion (EC) (Figure 1.1). This biochemical puzzle led to a collaboration between members of the Drennan and 15 Samson groups here at MIT, and together we were able to biochemically and structurally characterize AAG. In one study (Chapter 2, (16)), we examined the ability of AAG to bind EC with high-affinity, while being unable to excise this lesion, and determined the molecular structure of this AAG-EC inhibitory complex. These data allowed us to propose a chemical rationale for the inability of AAG to excise the eC lesion. We were also able to obtain a fortuitous crystallographic snapshot of this enzyme with a self-assembled, "pseudo-duplex" piece of DNA. In this structure, one AAG molecule in the asymmetric unit recognizes a EC lesion in a manner similar to the high-affinity depiction described in Chapter 2, while the other AAG monomer is making only nonspecific contacts with DNA, and thus is in a lower-affinity state. Taking these and other studies together, we were able to provide evidence for a mechanism by which AAG can find its lesion base substrates in the million-fold excess of undamaged DNA bases using a flexible DNA binding region (Chapter 3, (17)). I.IV Natural product biosynthesis with FAD-dependent N-hydroxylases Flavin-containing enzymes, or flavoenzymes, have been an intense area of study for nearly a century (18). From the initial discovery of a yellow pigment in cow's milk in 1879 (19) (which we now know to be riboflavin or vitamin B2 (Figure I.3a)), to the elucidation of flavin's chemical structure (20, 21) and the first description of a flavoenzyme (22, 23) in the 1930s, this field has grown and matured to the point that today over 18,000 articles found on PubMed use the term "flavin". Flavoenzymes utilize either the flavin mononucleotide (FMN) or flavin adenine dinucleotide (FAD) forms of flavin (Figure I.3a), and these cofactors can be used to perform a wide variety of reactions. This chemical diversity is due to the reactive isoalloxazine ring of the flavin, which can adopt three oxidation states differing by 1-electron, making it one of the few species in biology that can mediate between both 1- and 2-electron transfers (Figure I.3a). Herein, we will concentrate on a class of FAD-dependent enzymes known as hydroxylases or monooxygenases, and more specifically a recently discovered sub-class that act upon the amino acid L-ornithine (L-orn). The FAD-dependent hydroxylases use molecular oxygen and reducing equivalents from nicotinamide adeninine dinucleotide (phosphate) (NAD(P)H; Figure I.3b) to install a hydroxyl (-OH) group on a nucleophilic substrate (as outlined in Figure 1.4). The catalytic cycle of these 16 enzymes is initiated by hydride transfer from the Pro-R C4 position of the nicotinamide of NAD(P)H to the N5 position of the oxidized flavin isoalloxazine ring. Molecular oxygen can then add to the reduced isoalloxazine via a radical-mediated reaction, generating a C4a-hydroperoxy species. The hydroxylated product is created after nucleophilic attack by the bound substrate on the distal oxygen of the C4a-hydroperoxy, leaving a C4a-hydroxyflavin intermediate. Finally, dehydration of the hydroxyflavin readies this cofactor for another round of catalysis. Although this general mechanism is conserved in the majority of monooxygenase enzymes (reviewed in (24-27)), there are intriguing differences observed in the N-hydroxylase class. Herein, we explore the L-orn N-hydroxylase from Kutzneria sp. 744, called KtzI. This enzyme is involved in the biosynthesis of cyclic peptides that have antimicrobial and antifungal activity, which made it of great interest to both the Walsh and Drennan Labs. We have been able to structurally characterize KtzI in several states along its reaction path, and by pairing these snapshots with the biochemical and structural data already available for this enzyme-class, we propose a structurally-based reaction mechanism that includes never-before-seen conformational changes of both the protein backbone and the flavin cofactor. Further, we were able recapitulate these conformational changes in the protein crystal, displaying their chemical competence. These results are presented in Chapter 4. 17 18 FIGURES Figure 1.1. The damage of DNA bases. Canonical DNA bases (top) are acted upon by a variety of endogenous and exogenous sources, some of which cause damage. These damaged, 'lesion bases' (bottom) are chemically altered (in red), commonly by alkylation (7-meG, 3-meT) or through interaction with peroxide and aldehyde species (EA, EC). Endogenous pathways must repair damaged bases such that mutagenesis and cytotoxicity are minimized. NH 2 N 0 0 CH3 N N N IN DNA K N DNA DNA Cytosine (C) Thymine (T) 0 OH3 CH N N A N NH 2 Guanine (G) (A) 2 NH DNA Adenine NH +N N 3 N CH 3 NH NA N N N N DNA 1,M-ethenoadenIne (sA) N DNA N N O N 0 NH 2 7-methylguanine (7-meG) DNA 3-methylthymine (3-meT) DNA 3, A-ethenocytosine (CC) 19 Figure 1.2. Base excision repair (BER) in humans. The major BER pathway in humans begins with the action of a monofunctional DNA glycosylase like AAG (1). After lesion (red circle) removal, the apurinic/apyrimidinic (AP) site left behind is recognized by AP endonuclease I, which clips the phosphodiester DNA backbone leaving a 3'-hydroxyl group and a 5'-deoxyribosephosphate (dRP) moiety (2;(28)). The dual-function DNA polymerase $ attaches a new template base (in blue) to the 3'-OH and removes the 5'-dRP, leaving a free 5'-phosphate (3;(29)). To complete the repair, the nick left behind is sealed using DNA ligase I or III (4;(9, 30)). 5 3' 4 4 19 9t 4 96-1 I - 4 9 3' 4 I 9 I 51 I 1. DNA glycosylase 5' 3' 5' 2. AP Endonuclease I dRP 5' OH 3' 3' 3. DNA Polymerase p 32 tPO 51 oH 4 4 9 9 3' 4 9 3' 5' T 4. DNA Ligase 1/11t 5' 3' 20 4 4 4 4 9 9 9 4 4 4 3' 5' Figure 1.3. Introduction to the flavin and nicotinamide cofactors. a) b) nicotinamide adenine dinucleotide (phosphate) flavin adenine dinucleotide (FAD) NAD(P)' 0 flavin mononucleotide (FMN) N NNH 2 p0 1 0 OP.-. 0 0- riboflavin (vitamin B2) NAD(P)H (oxidized) H 0 N (reduced) NH 2 N H H 0 H.) (2L) N NH 2 K) N O-P=O 0 0 nicotinamide HO "OH NH 2 Sa N 4 Isoalloxazine 3 7a quinone O H. jj (1 e. N- N KN O-P==O N0 0- FAD (oxidized) R OH 0 N (2e-) OH OH 0 21 81959a101y~ 0 1 "OH Hi 0- N 0 O=P-0- NH N NH H (1 e) 0 semiquinone FADH- R I H NNyO NH H 0 hydroquinone FADH 2 (reduced) 21 Figure 1.4. General mechanism of flavin-dependent monooxygenases. R R 'N N N N NH N N H 0 R N o N NANHN 02N HD :0: 0 :0: H CH I- :0: N N N 0H H A H I~ I N )aN 0 ~~HO .., Nu:J 22 Nu: N *z X I0 N HOt 0 N 0 NH I.V REFERENCES 1. Moran, U., Phillips, R., and Milo, R. (2010) SnapShot: key numbers in biology., Cell 141, 2. Henzler-Wildman, K., and Kern, D. (2007) Dynamic personalities of proteins, Nature 450, 1262-1262. 964-972. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12. 13. 14. Zharkov, D. 0. (2008) Base excision DNA repair, Cell Molec Life Sci 65, 1544-1565. Lindahl, T. (1993) Instability and decay of the primary structure of DNA, Nature 362, 709-715. Lindahl, T., and Barnes, D. (2000) Repair of endogenous DNA damage, Cold Spring Harb Symp QuantBiol 65, 127-134. Shrivastav, N., Li, D., and Essigmann, J. M. (2010) Chemical biology of mutagenesis and DNA repair: cellular responses to DNA alkylation, Carcinogenesis31, 59-70. Robertson, A. B., Klungland, A., Rognes, T., and Leiros, I. (2009) DNA repair in mammalian cells: Base excision repair: the long and short of it, Cell Mol Life Sci 66, 981-993. David, S. S., and Williams, S. D. (1998) Chemistry of Glycosylases and Endonucleases Involved in Base-Excision Repair, Chem Rev 98, 1221-1262. Kubota, Y., Nash, R. A., Klungland, A., Schar, P., Barnes, D. E., and Lindahl, T. (1996) Reconstitution of DNA base excision-repair with purified human proteins: interaction between DNA polymerase beta and the XRCC1 protein, EMBO J 15, 6662-6670. Meira, L. B., Bugni, J. M., Green, S. L., Lee, C.-W., Pang, B., Borenshtein, D., Rickman, B. H., Rogers, A. B., Moroski-Erkul, C. A., McFaline, J. L., Schauer, D. B., Dedon, P. C., Fox, J. G., and Samson, L. D. (2008) DNA damage induced by chronic inflammation contributes to colon carcinogenesis in mice, J Clin Invest 118, 2516-2525. Nair, J., Gansauge, F., Beger, H., Dolara, P., Winde, G., and Bartsch, H. (2006) Increased ethenoDNA adducts in affected tissues of patients suffering from Crohn's disease, ulcerative colitis, and chronic pancreatitis, Antioxid Redox Signal 8, 1003-1010. Hofseth, L., Khan, M., and Ambrose, M. (2003) The adaptive imbalance in base excision-repair enzymes generates microsatellite instability in chronic inflammation, J Clin Invest 112, 1887-1894. Lee, C.-Y. I., Delaney, J. C., Kartalou, M., Lingaraju, G. M., Maor-Shoshani, A., Essigmann, J. M., and Samson, L. D. (2009) Recognition and Processing of a New Repertoire of DNA Substrates by Human 3-Methyladenine DNA Glycosylase (AAG), Biochemistry 48, 1850-1861. O'Brien, P. J. (2006) Catalytic promiscuity and the divergent evolution of DNA repair enzymes, Chem Rev 106,720-752. 15. 16. 17. 18. O'Brien, P. J., and Ellenberger, T. (2004) Dissecting the broad substrate specificity of human 3-methyladenine-DNA glycosylase, J Biol Chem 279, 9750-9757. Lingaraju, G. M., Davis, C. A., Setser, J. W., Samson, L. D., and Drennan, C. L. (2011) Structural basis for the inhibition of human alkyladenine DNA glycosylase (AAG) by 3,N4-ethenocytosine containing DNA, J Biol Chem 286, 13205-13213. Setser, J. W., Lingaraju, G. M., Davis, C. A., Samson, L. D., and Drennan, C. L. (2012) Searching for DNA lesions: structural evidence for lower- and higher-affinity DNA binding conformations of human alkyladenine DNA glycosylase., Biochemistry 51, 382-390. Massey, V. (2000) The chemical and biological versatility of riboflavin., Biochem Soc Trans 28, 283-296. 19. 20. 21. Blyth, A. (1879) The composition of cow's milk in health and disease., J Chem Soc 35, 530-539. Kuhn, R., Reinemund, K., and Weygand, F. (1934) Syntheses des lumi-lactoflavins (Synthesis of lumi-lactoflavins), Ber Deut Chem Gesell 67B, 1460-1462. Karrer, P., Sch6pp, K., and Benz, F. (1935) Synthese des flavins IV (Synthesis of flavins IV), Helv Chim Acta 18,426-429. 23 22. 23. 24. 25. 26. 27. 28. 29. 30. 24 Theorell, H. (1935) Reindarstellung der Wirkungsgruppe des gelben Ferments. (Purification of the active group of the yellow enzyme), Biochem Z 275, 344-346. Warburg, 0., and Christian, W. (1933) Uber das gelbe Ferment und seine Wirkungen (About the yellow enzyme and its effects), Biochem Z 266, 377-411. Palfey, B. A., and McDonald, C. A. (2010) Control of catalysis in flavin-dependent monooxygenases., Arch Biochem Biophys 493, 26-36. van Berkel, W. J. H., Kamerbeek, N. M., and Fraaije, M. W. (2006) Flavoprotein monooxygenases, a diverse class of oxidative biocatalysts., J Biotech 124, 670-689. Entsch, B., Cole, L. J., and Ballou, D. P. (2005) Protein dynamics and electrostatics in the function of p-hydroxybenzoate hydroxylase., Arch Biochem Biophys 433, 297-311. Dym, 0., and Eisenberg, D. (2001) Sequence-structure analysis of FAD-containing proteins., Protein Sci 10, 1712-1728. Robson, C. N., and Hickson, I. D. (1991) Isolation of cDNA clones encoding a human apurinic/apyrimidinic endonuclease that corrects DNA repair and mutagenesis defects in E. coli xth (exonuclease III) mutants, Nucleic Acids Res 19, 5519-5523. Matsumoto, Y., and Kim, K. (1995) Excision of deoxyribose phosphate residues by DNA polymerase beta during DNA repair, Science 269, 699-702. Fan, J., and Wilson, D. M. (2005) Protein-protein interactions and posttranslational modifications in mammalian base excision repair, Free Radical Biol Med 38, 1121-1138. 25 26 Chapter 2. Structural Basis for the Inhibition of Human Alkyladenine DNA Glycosylase (AAG) by 3,N-Ethenocytosine-containing DNA This research was originally published in the Journal of Biological Chemistry. "Gondichatnahalli M. Lingaraju, C. Ainsley Davis, Jeremy W. Setser, Leona D. Samson, Catherine L. Drennan. Structural Basis for the Inhibition of Human Alkyladenine DNA Glycosylase (AAG) by Journal of Biological Chemistry. 2011; 3,N 4-Ethenocytosine-containing DNA. 286(15):13205-13213" C the American Society for Biochemistry and Molecular Biology. 11.1 SUMMARY Reactive oxygen and nitrogen species, generated by neutrophils and macrophages in chronically inflamed tissues, readily damage DNA, producing a variety of potentially genotoxic etheno base lesions; such inflammation-related DNA damage is now known to contribute to carcinogenesis. While the human alkyladenine DNA glycosylase (AAG) can specifically bind DNA containing either 1,N 6-ethenoadenine (FA) lesions or 3,N 4-ethenocytosine (EC) lesions, it can only excise eA lesions. AAG binds very tightly to DNA containing 8.C lesions, forming an abortive protein-DNA complex; such binding not only shields EC from repair by other enzymes, but also inhibits AAG from acting on other DNA lesions. To understand the structural basis for inhibition, we have characterized the binding of AAG to DNA containing EC lesions and have solved a crystal structure of AAG bound to a DNA duplex containing the EC lesion. This study provides the first structure of a DNA glycosylase in complex with an inhibitory base lesion that is induced endogenously, that is by exposure to environmental agents such as vinyl chloride. We identify the primary cause of inhibition as a failure to activate the nucleotide base as an efficient leaving group, and demonstrate that the higher binding affinity of AAG for sC versus i A is achieved through formation of an additional hydrogen bond between Asn169 in the active site pocket and the 02 of 8C. This structure provides the basis for the design of AAG inhibitors currently being sought as an adjuvant for cancer chemotherapy. 27 II.I INTRODUCTION Genotoxic etheno (e)-lesions such as 3,N 4-ethenocytosine (EC) and 1,N-ethenoadenine (eA) are endogenously generated when DNA is attacked by reactive aldehydes. These reactive compounds are generated as by-products of lipid peroxidation that is induced by reactive oxygen and nitrogen species (RONS). Neutrophils and macrophages generate large quantities of RONS in tissues undergoing chronic inflammation (1, 2), and it is widely accepted that such inflammation increases the risk of colon cancer in ulcerative colitis (UC) and Crohn's disease patients, and increases the risk of liver cancer in Wilson's disease and Hemochromatosis patients (1, 3). In fact, increased levels of F-lesions in the DNA of tissues undergoing chronic inflammation have been reported for each of these diseases (4). Depending on the type of DNA polymerase, EC mispairs with A, T or C during DNA replication, resulting in both transition and transversion mutations (5). In contrast, EA primarily gives rise to A:T to T:A transversion mutations (6). These mutagenic E-lesions are generally removed via the base excision repair (BER) pathway, initiated by lesion-specific DNA glycosylases that cleave the N-glycosidic bond between the damaged base and the deoxyribose sugar (5, 7). In humans several DNA glycosylases can excise eC, namely thymine DNA glycosylase, methyl-CpG binding domain protein and single strand monofunctional uracil DNA glycosylase (5). In contrast, there is only one DNA glycosylase known to excise EA lesions in humans, alkyladenine DNA glycosylase (AAG) (5, 8). AAG (also known as MPG and ANPG) has been previously characterized by crystallography. The crystal structures of an N-terminally truncated, but catalytically active, construct of AAG (A79AAG), both bound to a pyrrolidine abasic site mimic (pyr) and bound to an EA containing piece of DNA, suggest a mode by which AAG recognizes a wide range of lesions, while still discriminating against undamaged bases (9, 10). When substrate is bound, AAG can excise the damaged base through acid-base catalysis (11). A putative catalytic water molecule, revealed by crystallographic studies, is proposed to act as a nucleophile, as it is ideally positioned to attack the N-glycosidic bond present between the EA base and the deoxyribose sugar (10). This water molecule is also in contact with the side chain of Glul25, which is proposed to be the catalytic base responsible for activating the water for nucleophilic attack. Consistent with this proposal, introduction of a E125Q mutation completely abolishes AAG activity (9-11). The identity of the general acid is unknown. Interestingly, in the structure of 28 A79AAG bound to FA:T containing DNA, the FA lesion remained intact (10). Later experiments showed that the catalytic activity of A79AAG is significantly inhibited in the presence of a variety of divalent metal ions including Mn 2 *, Zn 2 *, Ca2+, Cd 2 *, Ni2+and most importantly, Mg 2 +, which was contained in the crystallization buffer (9, 10, 12, 13). However, the structures did not show any Mg 2+ ions bound (9, 10). In addition to repairing cA, AAG can repair other RONS, and alkylation induced DNA damage, including lesions hypoxanthine (Hx), 1,N 2-ethenoguanine, 8-oxoguanine, 3-methyladenine (3-meA), 7-methylguanine (7-meG) and 3-methylguanine (2, 8). However, in spite of this broad substrate specificity, there is a growing list of lesions to which AAG can bind while failing to excise the lesion. In addition to FC containing DNA (14), this list now includes 3-methyluracil, 3-ethyluracil, 3-methylthymine and 3-methylcytosine (15). This binding without cleavage can result in the formation of stable abortive complexes between AAG and damaged DNA. The EC-AAG abortive complex has been shown to inhibit AAG glycosylase activity in vivo in human cells, and to result in replication blockage (14), increasing the genotoxicity of cC lesions in vivo. In tissues undergoing chronic inflammation, which have higher cC content (4), the formation of AAG-EC abortive complexes may significantly diminish the repair of other AAG substrates, ultimately resulting in the accumulation of various DNA lesions in addition to cC. Interestingly, in ulcerative colitis patients, the colon epithelium undergoing chronic inflammation was found to have increased AAG expression, perhaps indicating an adaptive response triggered by increased levels of DNA damage (16). This adaptation might compensate for the AAG hijacked by cC lesions. In order to understand the structural basis for the inhibition of AAG by EC containing DNA, we have carried out biochemical and crystallographic studies on AAG, using a truncated form of the protein (A79) that was previously shown to have full catalytic activity (11, 15, 17). Our crystal structure of A79AAG bound to a DNA duplex containing cC:G (G paired opposite EC), in combination with previous (11) and current (this work) biochemical analysis, suggests that the failure of AAG to activate the leaving group (cC) by protonation is likely the primary reason for its inability to remove cC from the DNA. This structure also shows that a divalent metal ion, Mn2 , can bind to the base opposite the cC lesion, changing its sugar pucker, and providing the first structural framework for considering the molecular basis for metal ion inhibition of AAG. 29 11.111 RESULTS AAG binding studies Th, binding affinity of A79AAG to the EA:T (EA paired opposite T) lesion containing 25-mer and 13-mer duplexes was compared with the binding affinity to cC:G (EC paired opposite G) duplexes, using gel mobility shift assays (Figure 11.1, A and B; and Table 11.1). As shown in Table II.1, when either FA or EC lesions are present in a given sequence context, A79AAG consistently binds the FC:G duplex with ~2-fold higher affinity compared to that of the EA:T duplex. In addition, A79AAG binds the EA:T 25-mer duplex (Kd = 20 ± 2 nM) with ~2-fold higher affinity, compared to the EA:T 13-mer duplex used for crystallization (Kd = 46 ± 6 nM). Correspondingly, A79AAG also binds the eC:G 25-mer duplex (Kd = 13 ± 2 nM) with -2-fold higher affinity, compared to the eC:G 13-mer duplex (Kd = 21 ± 3 nM). These results indicate that the binding affinity of A79AAG to DNA containing the same lesion varies depending on the length of the DNA duplex. The binding studies also show that in a given sequence context, A79AAG binds EC:G duplex with higher affinity compared to that of the eA:T duplex. Catalytic ability of AAG for cC containing DNA Following our binding studies, we tested the DNA glycosylase activity of both full-length and A79AAG on EA and PC residues present in the 25-mer oligonucleotide duplexes (Figure II.lE). As shown in the representative gel, both full-length and A79AAG robustly removed EA from the EA:T 25-mer duplex. However, the activity of both full-length and A79AAG on PC residues from the same duplex was completely absent. In contrast, the positive control, E. coli Mismatch Uracil DNA Glycosylase (MUG) (Trevigen) shows robust catalytic activity on PC contained in an cC:G 25-mer duplex (Figure II.lE). Further, we tested the activity of A79AAG on PC containing 13-mer oligonucleotide duplexes used for crystallization, with cC paired opposite different bases. The results show A79AAG does not have activity on cC:G, cC:A, EC:C, or cC:T 13-mer duplexes (Figure 11.2). Inhibition of AAG by eC containingDNA We employed competition assays to measure the inhibition of A79AAG activity on cA:T 25-mers using cA:T and EC:G 13-mer competitor DNA oligonucleotides (Figure II.1, C and D; and Table II.1). The catalytic activity of A79AAG on labeled EA:T 25-mer duplex was measured 30 at 37*C in the presence of an increasing concentration of the aforementioned cold competitors (Figure II.1C). The cleavage data were fitted to equation (2) (Materials and Methods) in order to calculate the 50% inhibitory concentration (IC 50 ) for each cold competitor used in the experiment (Figure II.1D). The results obtained correlate with the binding measurements described above. As shown in Table 11.1, the EA:T 13-mer DNA duplex binds approximately 4-fold weaker (IC 50 = 163 nM) than the cC:G 13-mer (IC 50 = 39 nM). Overall structure of the A 79AAG-EC DNA inhibitor complex The crystal structure of A79AAG-E-C:G at 2.2 A resolution was determined by molecular replacement using the structure of A79AAG-pyr:T complex as a search model (9). Difference electron density maps calculated in the absence of DNA show interpretable electron density for DNA backbone and for the EC base in the active site pocket of AAG. In comparison to the previously published A79AAG-DNA complexes (9, 10), the A79AAG-eC inhibitor complex crystallized in a different space group (P1). The final model of A79AAG-EC:G has been refined to the R factor of 23.9 (Ree = 28.4) (Table 11.2). The overall structure of A79AAG bound to an EC DNA lesion includes the insertion of Tyrl62 into the DNA and the flip of the FC nucleotide into the enzyme active site (Figure 11.3). The two copies of this inhibitor-protein complex in the asymmetric unit are quite similar to each other, with a root mean square deviation (RMSD) for all alpha carbon atoms of approximately 0.6 A, and to that of the A79AAG-cA:T substrate complex (10), also having a RMSD of approximately 0.6 A. With the exception of some loops and two disordered regions (Figure II.4), the only notable difference in our inhibitor structure is that the octahedrally coordinated Na' metal ion modeled in the structure of the A79AAG-eA:T complex was found to be absent. Instead, this site is occupied by the N-terminal amino group of residue 80 of a symmetrically equivalent A79AAG molecule (Figure 11.5). Similar to the Na' ion, the N-terminal amine in this position also interacts with the main chain carbonyls of Metl49, Gly174, Ala177, Serl7l and the side chain of Ser172. Protein-DNA interactions In both molecules in the asymmetric unit of the A79AAG-C:G structure, the DNA duplex is largely B-form and is bent away from the protein by about 220, with the bend primarily 31 centered on the flipped EC nucleotide (Figure II.3A). For the most part, all protein-DNA interactions are similar between the A79AAG-EC:G inhibitor complex and the A79AAG-FA:T substrate complex (Figures 11.3 and 11.4). Tyr162 makes the most important protein contact, given that it is inserted into the DNA duplex, replacing the EC lesion, and forming Van der Waals contacts with the opposite base, G19 (Figure 11.3). A potential steric clash of Tyr162 with G19 is prevented by shifting this opposite base out of the minor groove, leaving it without a base pairing partner (Figure 11.3, B and C). This sliding rearrangement, in which G19 is orphaned in terms of hydrogen bonding, is disruptive and presumably has an energetic penalty associated with it. The deoxyribose of the orphaned base does make favorable Van der Waals interactions with Metl64 (Figures II.3B and II.6C), counteracting some of these energetic costs. As was the case in the A79AAG-EA:T substrate complex, no direct hydrogen bonding interactions are present between the protein and the base opposite the DNA lesion, indicating that specific recognition of this base is not required for the binding of AAG to DNA. Metal ion Mn2" in the z79AAG-EC:G structure The A79AAG-FC:G complex was crystallized in the presence of 200 mM MnCl 2 , a condition under which AAG's ability to excise EA from a DNA duplex is impaired (12, 13). We find electron density consistent with a metal ion near the base opposite the EC lesion (Figures II.3C and 11.6), at a distance of approximately 16 A to the AAG active site (Cl' of EC). Mn 2 , refines well in this electron density with no positive or negative difference electron density. In contrast, refinement of a water molecule or a sodium ion (also present in the crystallization buffer) leads to positive difference electron density, suggesting that the correct atom in this site is heavier than water and sodium, consistent with Mn 2 ,. Anomalous difference density is also present at both sites in the asymmetric unit at approximate sigma levels of 8 and 5 for chain A and chain B respectively, consistent with the presence of Mn 2 1 ions (Figure II.6A). At the wavelength of data collection (k = 1.116 A), sodium would not give rise to an anomalous signal, ruling out the other metal ion contained in the crystallization buffer as being present in this site. The refined Mn 2 , is coordinated to the 06 of G19 (the base opposite SC), to the N7 of A 18, and to three water molecules (Figure II.3C). The coordination of Mn 2' appears to induce a significant change in the phosphodiester backbone in the region around G19, resulting in a change in the sugar pucker to a C2'-exo conformation (Figure II.6B). 32 Active site architectureof z179AAG-EC DNA complex The PC base lesion is recognized and stabilized by hydrogen bonds, along with Van der Waals interactions (Figures 11.7 and 11.8). Similar to the recognition of FA (Figure II.7B), eC is stacked between Tyr127 on one side, and His136 and Tyr159 on the other side (Figure II.7A). Tyr159 makes edge-to-face contact with the lesion base. The specificity to discriminate between the EC lesion and undamaged cytosine appears to be achieved through a hydrogen bond donated from the main chain amide of His136 to the N' of the PC base. This interaction is similar to the damage-specific recognition of -A (versus undamaged adenine) by AAG, which is made through a hydrogen bond donated by the main chain amide of His136 to the N6 of EA. An additional hydrogen bond is also observed between the carboxamide nitrogen of the side chain of Asn169 and the 02 of EC. Mutants of Asn169, namely Asnl69Leu and Asnl69Ala, show respective ~2-fold and ~4-fold reduced affinity for the EC:G 25-mer oligonucleotides, compared to that of wild type A79AAG (Table 11.1), indicating that the additional hydrogen bond donated from Asn169 to FC contributes to the increased affinity of A79AAG for EC inhibitor DNA. Interestingly, in the A79AAG-FC:G inhibitor complex, the putative catalytic water molecule (proposed to act as a nucleophile) occupies the same position as in the A79AAG-eA:T substrate complex (Figure 11.7). Also in agreement with the structure of the A79AAG-EA:T substrate complex, this water molecule interacts with Glul25, Arg 182 and main chain carbonyl oxygen of Val262. Glul25, which is proposed to activate the water molecule for nucleophilic attack (10, 11), is held in its position through a hydrogen bond donated from Tyr127 to its carboxyl group. The side chain of Arg 182 further contacts the 3'-phosphate of the EC nucleotide. In comparison to the recognition of the EA substrate, the EC inhibitor recognition induces slight changes in the active site, mostly with respect to DNA backbone positions (Figure II.7C). Since FC is smaller than EA, the DNA backbone must be pulled farther into the active site such that EC is recognized with optimal molecular interactions. In a modeling exercise in which the DNA backbone is held rigid, AAG fails to form optimal hydrogen bonding interactions between both the main chain amide of His 136 and the N4 of FC, and the side chain of Asn 169 and the 02 of EC. Perhaps as a result of this slight repositioning of the DNA backbone, the side chain of Arg 182 adopts a different conformation (Figure II.7C). The side chain of Arg 182 still interacts with the 3' phosphate of the EC nucleotide and still hydrogen bonds to the putative catalytic water molecule. Overall, however, comparison of the active site of the A79AAG-eC inhibitor 33 complex with that of the A79AAG-EA:T substrate complex shows that, with the exception of Arg182, all the residues involved in lesion recognition and catalysis maintain similar orientations. II.IV DISCUSSION AAG plays an important role in the maintenance of genomic integrity, presumably through its ability to recognize, bind and excise a wide-range of DNA base lesions. It was therefore surprising that AAG also has the ability to recognize and bind a number of DNA base lesions that it is incapable of excising, in particular the -C lesion. Moreover, the tight binding of AAG to EC leads to the inhibition of its catalytic activity and, in addition, is known to shield EC from ABH2-mediated direct reversal repair (18). In order to understand the structural basis for the inhibition of AAG by eC containing DNA, we solved the crystal structure of A79AAG bound to a 13-mer EC:G (EC paired opposite G) duplex. Given that AAG can bind EC containing DNA, we anticipated that the lack of activity may be a result of one or more of the following factors: (i) AAG might fail to flip EC into its active site, or it might flip EC into an alternative binding pocket that lacks the appropriate catalytic residues; (ii) the binding mode of EC in the active site might not favor accommodation of the water molecule thought to act as a nucleophile in the reaction; (iii) the side chain of the putative catalytic base (Glul25) might adopt a nonproductive conformation that fails to activate the putative catalytic water molecule; (iv) AAG might be unable to protonate EC, failing to activate it for departure. The crystal structure shows that AAG successfully flips the EC inhibitor into the same active site pocket that binds the EA substrate, ruling out the first possibility. We also find that the putative catalytic water molecule is present in the inhibitor complex, ruling out the second possibility. Furthermore, as was observed in the structure of the A79AAG-EA:T substrate complex, this water molecule is in contact with Glul25, as would be required for its activation. The water molecules are ideally positioned to attack the N-glycosidic bond. Thus, we infer that AAG's inability to remove EC is unlikely to be due to a problem with nucleophilic activation or attack, ruling out the third possibility from our list. We next examined the fourth possibility, that the failure to excise EC is due to a problem with leaving group activation. In a previous biochemical study, O'Brien and Ellenberger 34 measured the pH-rate profiles for AAG's excision of neutral Hx and CA lesions, and its excision of the positively charged 7-meG lesion under single turnover conditions (11). They found that the pH-rate profiles for FA and Hx excision follow a bell-shaped curve, indicating that for the excision of neutral lesions, AAG uses the action of both a general acid and a general base (Glul25). The general base can activate a catalytic water molecule, while the general acid is expected to facilitate the protonation of neutral lesions, making the lesion base a better leaving group (11). In contrast, the pH-rate profile for the excision of 7-meG shows only a single ionization corresponding to a general base, suggesting that leaving group activation of 7-meG is not necessary because the base is already positively charged. To help pinpoint the site of protonation, the activity of AAG on Hx was compared to its activity on 7-deaza-Hx, and although AAG greatly enhances the rate of Hx excision (~10'), the same lesion with N7 changed to C7 is not cleaved by AAG, directly implicating the involvement of the N7 position in catalysis (See Figure II.9B for numbering) (11). While this study was unable to identify a specific residue as the general acid, the crystal structure of a A79AAG(E125Q)-EA:T substrate complex shows a water molecule in contact with the equivalent position to N7 of Hx, that is N7 of EA (Figure II.9A) (10), raising the possibility that a protein-bound water molecule could be responsible for protonation. Once protonated, the AAG active site is designed to stabilize the protonated form of the base through a hydrogen bond between N7H of FA and the backbone carbonyl oxygen of Ala134 (Figure II.9A). Given these findings on the catalytic significance of protonation of the N7 of Hx and EA, it is important to consider the equivalent position in the EC base. A superposition shows that unlike FA, cC has a carbon (C5) in the position equivalent to N7, and thus cannot be protonated at that site (Figure II.9A). Therefore, as opposed to our findings with respect to possibilities one through three, it appears that AAG's failure to cleave eC could be due to an inability to activate the EC leaving group by protonation. Since AAG is reported to bind and not cleave a number of different pyrimidine lesions, including 3-methyluracil, 3-ethyluracil, and 3-methylthymine (15), this mechanism of inhibition may be broadly applicable. Given that AAG cannot repair EC lesions, it is interesting that AAG binds this lesion so tightly. The molecular basis for the approximate 2-fold higher affinity of AAG for the EC:G duplex (compared to the substrate cA:T duplex) can be attributed to an additional hydrogen bond formed between the carboxamide side chain of Asn 169 and the 02 of EC. Mutation of Asn169 to residues that cannot maintain this hydrogen bond (Leu and Ala) completely abolished this 2-fold 35 binding effect (Table II.1), suggesting that this one hydrogen bond is chiefly responsible for the higher affinity of FC containing DNA. Thus, in addition to its previously proposed role of serving to help discriminate between damaged and undamaged guanine (19), Asn169 appears to play a role the recognition and binding of pyrimidine DNA lesions. It is important to note that Asn169 is strictly conserved among AAG-related glycosylases (9). Although inhibition of AAG by divalent metal ions (Mg 2 l, Mn 2 +, Zn 2 *, Ca 2 *, Cd 2 + and Ni 2 ) has been well-documented (12, 13), no previous crystal structure displayed electron density consistent with such an ion, even though these cations were used in the crystallization buffers (9, 10). Here we find density consistent with the presence of Mn 2 , in position to coordinate the base opposite the EC lesion (G19) (Figures II.3C and 11.6). Binding of Mn 2 . to this site appears to influence the pucker of the sugar yielding a C2'-exo configuration (Figure II.6B). This occurrence is the first time that this sugar pucker has been observed in an AAG structure. In our Mn 2 +containing structure, the binding of -C to the active site is nearly identical to that observed in the A79AAG-EA:T structure. Thus, the inhibitory effect of Mn 2 +does not appear to be due to a large conformational change in the active site, although the electrostatics of the active site could be affected by the presence of the positively charged ion approximately 16 A away. Other dynamic movements of protein or DNA that are important in catalysis might also be affected by the Mn 2. coordination. While binding of divalent metal cations to protein and DNA is common, it is intriguing that we find this divalent metal bound to such an important site in this protein-DNA complex. We now have a physical model for the influence of divalent cations on AAG activity that can be tested. With a molecular view of the AAG-FC abortive complex in hand, it is interesting to consider what the physiological benefits in forming this complex might be. Abortive complexes between alkyltransferase-like (ATL) proteins and a lesion that it cannot excise, 0 6-alkylguanine, have recently been observed (20). ATLs are known to interact with proteins in another DNA repair pathway, nucleotide excision repair (NER), suggesting that ATLs may function to present alkylated DNA to NER proteins for repair (20, 21). Given the difficultly of finding a single damaged DNA base in the midst of the genome, it makes sense that once found, some DNA repair proteins may be designed to 'hand-over' lesion bases that they cannot themselves repair to an alternative repair pathway. While it is too early to infer directly from ATLs, preliminary data do show that AAG can interact with human NER proteins hHR23A and hHR23B (22). 36 Obviously, more studies are necessary to establish if AAG--C abortive complexes interact with NER proteins, resulting in EC repair, but this idea is intriguing and, given the recent studies on ATL, not without precedence. Originally identified by its ability to excise alkylated 3-meA and 7-meG lesions (8, 23), AAG's role in DNA repair is far more complex than once thought. Given the importance of repairing RONS generated DNA damage for tissues undergoing chronic inflammation, a complete understanding of AAG's physiological function is essential. ILV MATERIALS AND METHODS A 79AAG plasmidconstruction, creation of mutants, and protein preparation Constructs of full-length (FL) and a truncated form of AAG (with 84 residues at the Nterminus deleted) were cloned into pET19b-PPS vectors for protein expression (UniprotID: P29372). These constructs encoded the wild-type AAG sequence with an N-terminal loX histidine tag followed by the precision-protease cleavage site (PPS). The precision protease treatment to remove the histidine tag leaves behind four extra amino acids (GPHM) from the expression vector at the N-terminus of AAG. For FL-AAG, this cleavage site results in a GPHM sequence prior to residue 1, and for the truncated form of AAG, this cleavage site results in the addition of residues Gly8O, Pro81, His82 and Met83 prior to residue 84. We refer to this truncated protein construct as A79AAG, although the actual AAG protein sequence starts at Thr84. It should be noted that the AAG protein from previous structural studies was also referred to as A79AAG (9, 10). However, in those former studies, all residues contained in the construct are of the wild type sequence. For the creation of A79AAG-Asnl69Leu and A79AAG-Asn169Ala mutants, PCR based site directed mutagenesis was performed with the primers shown in Table 11.3 and successful incorporation was confirmed by DNA sequencing (MWG Biotech). A79AAG protein expression and purification was done similarly to previously described protocols (11, 24) and is outlined below. AAG protein expression andpurification Both full-length and A79AAG and its mutants (Asnl69Leu, Asnl69Ala) were expressed and purified using a similar protocol. Each pET19b-PPS AAG plasmid construct was transformed into BL21(DE3) cells by heat shock and plated onto LB (Luria Bertani) agar plates, supplemented with 100 [tg/mL of ampicillin and incubated at 37'C overnight. A single colony 37 was used to inoculate 250 mL of LB broth supplied with 100 tg/mL of ampicillin and grown at 37*C overnight. This starter culture was used to inoculate 6 L of LB broth supplied with 100 Rg/mL of ampicillin. The culture was grown at 37*C, until the cells reached an optical density at 600 nm (OD600 ) equal to 1.0. The cultures were cooled to room temperature, and protein expression was induced with 0.5 mM IPTG for 6-8 hr. The cells were centrifuged at 4*C and 4000 rpm for 30 min and resuspended in 150 mL of Buffer A (20 mM Potassium Phosphate pH 7.0, 500 mM NaCl, 10% v/v glycerol, 1 mM DTT) supplied with 4 tablets of EDTA-free protease inhibitor mixture and frozen at -80'C. The cells were thawed and lysed by sonication. The cell lysate was centrifuged at 18,000 rpm for 45 min and the supernatant was loaded onto a HisPrepT M FF 16/10 Ni-affinity column (Amersham Biosciences), which was pre-equilibrated with 10 column volumes (CV) of Buffer A. The first wash was done with 10 CV of Buffer A, followed by a wash with 10 CV of Buffer A containing 40 mM imidazole. The protein was eluted by creating a 10 CV imidazole gradient from Buffer A and Buffer B (Buffer A supplied with 500 mM imidazole). Upon elution, the N-terminal 1oX histidine tag was cleaved from the protein by precision protease (GE Healthcare Biosciences) treatment at 16*C for 12-14 hr. This sample was diluted to the final NaCl concentration of 100 mM and loaded directly onto a HiTrapT M SP FF ion-exchange column (Amersham Biosciences). The unbound protein was eluted using 10 CV of Buffer C (20 mM HEPES pH 7.5, 100 mM NaCl, 10% glycerol, 5 mM DTT). The bound protein was eluted using a gradient between Buffer C and Buffer D (Buffer C supplemented with IM NaCl), and concentrated by centrifugation at 3500 rpm at 4*C using Amicon 10-KDCO (kilodalton cut off) ultrafilters. Further purification was done by gel filtration using Buffer E (20 mM HEPES pH 7.5, 100 mM NaCl, 10% glycerol and 5 mM DTT) and a Superdex" 75 gel filtration column (Amersham Biosciences). The final purified protein in Buffer E was almost 99% pure as evidenced by the SDS-PAGE analysis. The purified protein was concentrated using Amicon 10-KDCO ultrafilters and the amount of protein was estimated using the extinction coefficient method by UV absorption at 280 nm. Preparationof oligonucleotides and 32P-labeling DNA oligonucleotide substrates (Integrated DNA Technologies) were dissolved in TE buffer (10 mM Tris-HCl pH 8.0 and 1 mM EDTA) and quantified by the extinction coefficient method using UV absorption at 260 nm. For the DNA glycosylase and binding studies, the 38 lesion-containing strand was labeled on the 5' end with 1 2 P-yATP (Perkin Elmer) using polynucleotide kinase (PNK) (New England Biolabs) at 37*C for 30 min, followed by heat inactivation of PNK at 70'C for 15 min. Duplex oligonucleotides were created by annealing the 32 P-labeled strand with its complementary strand. The unincorporated 3 2 P-yATP was separated from 32 P-labeled oligonucleotides using Sephadex G-25 quick spin columns (Amersham-Pharmacia). Gel mobility shift assays The binding affinity of A79AAG to different DNA oligonucleotides was measured using gel mobility shift assays. DNA oligonucleotides were 32 P-labeled and purified using Sephadex G-25 quick spin columns (as outlined above). Binding reactions were set up as solutions containing 1X binding buffer (50 mM HEPES-NaOH pH 7.5, 100 mM NaCl, 1 mM EDTA, 9.5% v/v glycerol, 50 [tg/mL BSA and 5 mM DTT), 2 nM 32 P-labeled oligonucleotide and 0-1000 nM of the purified A79AAG protein. The reaction samples were incubated on ice for 30 min and the products were resolved using 6% native-PAGE in 0.5 X TBE buffer at 110 V for 3 hr at 4'C. The extent of complex formation was quantified and analyzed by phosphorimaging. Dissociation constant (Kd) values were calculated by fitting the binding data to the binding equation (equation 1) using GraphPad Prism (GraphPad software, Inc.). Y =Bmax*X/(Kd+X) (1) where Y is the specific binding, Bmax is the maximal binding, X is the concentration of protein and Kd is the dissociation constant. Each experiment was repeated at least three times and the data represent the average of at least three independent experiments. DNA glycosylase assays DNA glycosylase assays were set up as solutions containing IX glycosylase assay buffer (50 mM Tris-HCl pH 7.8, 100 mM NaCl, 1 mM EDTA, 50 gg/mL BSA and 5 mM DTT), 2 nM 32 P-labeled oligonucleotide and 25 nM of either the purified full-length or A79AAG enzyme. The reactions were carried out at 37*C. Aliquots (10 [tL) from particular time points were mixed with piperidine to the final concentration of 0.2 M and heated at 75*C for 15 min. The piperidine 39 treatment cleaves all abasic (AP) sites resulting in single strand breaks at the region of AP-sites. This procedure was followed by the addition of one sample volume of 90% formamide buffer with dye markers. The samples were heated at 75*C for 15 min and the products were resolved using 20% denaturing Urea-PAGE in IX TBE buffer at 450 V for 2 hr. The extent of substrate cleavage was quantified and analyzed by phosphorimaging. Competition DNA glycosylase assays Competition DNA glycosylase assays were performed to measure the inhibition of A79AAG activity on aA containing duplex DNA substrate by EA and PC duplexes. The reactions were set up as solutions containing IX glycosylase assay buffer, 1 nM 32P-labeled EA:T (T paired opposite EA) 25-mer oligonucleotide duplex DNA (5'-GCA ATC TAG CCA EAGT CGA TGT ATG C-3'), 5 nM of the purified A79AAG enzyme and increasing concentrations of competitor DNA (0-3000 nM). The reactions were carried out at 37'C for 30 min. After incubation, NaOH was added to a final concentration of 0.2 M, followed by heating at 75*C for 15 min. Similar to piperidine treatment, hot alkali treatment with NaOH cleaves all AP sites and creates DNA single strand breaks at the AP sites. Upon cooling, one sample volume of 90% formamide buffer with dye markers was added into the reaction mixture. The samples were heated at 75 0 C for 15 min before loading, and the products were resolved using 20% denaturing Urea-PAGE in IX TBE buffer at 450 V for 2 hr. The extent of substrate cleavage was quantified and analyzed by phosphorimaging. The experiment with each competitor was repeated at least three times. In order to calculate the IC 50 (50% inhibitory concentration), the competition data were fitted to the sigmoidal dose response curve (equation 2) using GraphPad Prism. Y= Ymin + (Ymax -Ymin) / (1 + 1 0 LogIC50-X) (2) where X is the logarithm of competitor concentration, Ymax and Ymin are the maximum and minimum values of % AAG activity (Y) and LogIC50 is the logarithm of IC50 . Crystallization of the A79AAG-EC:G complex The eC:G DNA duplex was prepared by annealing the EC containing 13-mer crystallization oligonucleotide (5'-GAC ATG 40 ECTT GCC T-3') with its complementary strand that contained G opposite PC (5'-GGC AAG CAT GTC A-3'). The A79AAG-EC complexes were prepared by mixing equimolar ratios of A79AAG and FC:G 13-mer DNA duplex at the final protein-DNA complex concentration of 0.3 mM in the complex buffer (20 mM HEPES-NaOH pH 7.5, 100 mM NaCl, 0.1 mM EDTA, 5% v/v glycerol and 1 mM DTT). The complex was incubated on ice for 15 min and used for crystallization. The crystals were obtained by the hanging drop vapor diffusion method, upon mixing 1 pL of complex and 1 pL of the reservoir solution (100 mM sodium cacodylate pH 6.0, 200 mM manganese chloride and 20% polyethylene glycol (PEG)-3350) over 0.5 mL of the reservoir solution, followed by incubation for 2 days at 22*C. The crystals formed as plates, which were mounted directly from the hanging drop to the center of loops larger than the crystal size and flash frozen in liquid nitrogen. Data collection and structure determination The X-ray diffraction data for the A79AAG-EC:G complex were collected at the Advanced Light Source (Berkeley, CA) on beamline 12.3.1 at lOOK to 2.2 A resolution. These data were processed using Denzo/Scalepack (25) and the data statistics are given in Table 11.2. The structure of the A79AAG-EC:G, with 2 molecules in the asymmetric unit, was determined by molecular replacement using PHASER (26) and the AAG protein coordinates from the A79AAG-pyr:T complex structure (PDB ID 1BNK (9)) as a search model. A 2mFOI-DIFe! electron density map (all maps having coefficients from 4ligma weighting) contoured at 1R, and a mIFI-DIFel electron density map contoured at 3o, calculated in the absence of DNA, showed an interpretable electron density map for the DNA backbone. Another round of refinement was performed upon partial fitting of the DNA (7 nucleotide pairs starting at 5'- 4ATG(pyr)TTG10 3' and the complementary strand 5'- 16CAAGCAT22 -3'). The resulting calculated 2mlF.I-DIFcl (1 Y) and mIFOI-DIFel (3y) electron density maps showed interpretable electron density for the EC base in the active site pocket of AAG, as well as continuous electron density for building the remaining DNA backbone. Upon fitting the missing DNA portions into the electron density, initial models were subjected to restrained refinements using Refmac 5.4 (27, 28). Topology and parameter files for the FC lesion were generated using XPLO2D (29). Initial refinement included simulated annealing in CNS (30). Iterative rounds of positional and B-factor refinement of the A79AAG-eC complexes were performed with the guidance of calculated 2mFO1-DIFeI, mIF!-DlFel electron density maps (generated by Refmac 5.4), and 2mFOI-DIFcI composite 41 omit-maps (generated by CNS), using the model building program Coot (31). Anomalous difference maps were calculated in CNS (30) using the native data (X = 1.116 A) and the phases from the final A79AAG-EC:G model. Additional rounds of refinement using TLS parameters and non-crystallographic restraints were very effective in improving the quality of the fit. At each stage, the progress of model building was judged by following the change in R factors. The final model of A79AAG-C:G complex converged at an R factor of 23.9 (Rfe = 28.4) (Table 11.2). The final model was evaluated using PROCHECK (32) and Rampage (33). For residues 80-298 of the A79AAG-EC:G structure, the following have no electron density and are therefore not included in the model: the residues 203-207, 265-268 and 295-298 in chain A; the residues 205-206, 265-266 and 294-298 in chain B. Due to a lack of interpretable electron density for the side chains of some residues in the structure of A79AAG-EC:G (Arg201, Leu249 and Glu253 in chain A), these residues were modeled as alanines. Each protein molecule in the asymmetric unit has a DNA 13-mer associated with it. One nucleotide of each of these duplexes is disordered (A26). II.VI ACKNOWLEDGEMENTS This work was supported by the US National Institutes of Health (grants P30-ES002109, GM65337, GM65337-03S2, ES002109, CA055042 and CA092584). C.L.D is a Howard Hughes Medical Institute Investigator. L.D.S. is an American Cancer Society Research Professor. J.W.S. is supported by a Repligen KIICR Graduate Fellowship. The Advanced Light Source is supported by the Director, Office of Science, Office of Basic Energy Sciences, of the U.S. Department of Energy under Contract No. DE-AC02-05CH 11231. The atomic coordinates and structure factors (code (3QI5)) have been deposited in the Protein Data Bank (www.rcsb.org). Author contributions: G.M.L. performed the DNA binding, activity, and inhibition studies. G.M.L. and L.D.S. designed the experiments. G.M.L., C.A.D., J.W.S., and C.L.D. carried out the crystallography experiments and the structural analysis. G.M.L., J.W.S., L.D.S., and C.L.D. wrote the manuscript. 42 TABLES & FIGURES Table 11.1. Dissociation constant (Kd) values measured using gel shift assays; and 50% inhibitory concentration (IC 50 ) for the inhibition of A79AAG activity on gA:T 25-mer, measured using competition DNA glycosylase assay at 37'C, in the presence of increasing concentration of cold competitor 13-mer duplexes. IC501 (95% confidence interval (nM) A79AAG Oligonucleotide Wild type sA:T 25-mer 20 ± 2 Wild type eC:G 25-mer 13 ± 2 Wild type EA:T 13-mer 46 ± 6 163 (152-174) Wild type eC:G 13-mer 21 ± 3 39 (38-41) Asnl69Leu EC:G 25-mer 31± 4 AsnI69Ala eC:G 25-mer 47 ± 6 Kd' ± SD 2 (nM) 1: Average of at least three independent experiments. 2: Standard Deviation 43 Table 11.2. Data collection and refinement statistics of the A79AAG-DNA complex. A79AAG- C:G Space group P1 Cell constants a= 41.23 A, b= 41.22 A, c= 82.14 A a= 81.230, P= 88.4', y= 89.15* 12.3.1 Beamline Wavelength (A) 1.116 Resolution (A) 41 - 2.20 No. total observations 71943 No. unique observations 26278 Completeness (%) c 96.6 (95.2) <I/I(1)> 17.1 (4.9) Rsym (%) a,c 5.8 (19.2) Model refinement 23.9 Rwork (%) b Rfree (%) 28.4 b B-factors (A ) Protein DNA Water Mn 2 , ion 2 15.2 17.9 14.1 chain A: 27.9 chain B: 44.0 RMSD bonds (A) d RMSD angles (0) d Number of atoms Protein 0.007 1.1 3257 (2 mol./asu) DNA Water Mn 2 , ion 1024 232 2 Ramachandran plot (%) Most favored 89.7 Additionally allowed 10.0 Generously allowed 0.3 1 a: Rsym= IIhkI - <IhkI>I Y IIkl, where I is the intensity of a reflection hkl and <I> is the average over symmetry-related reflections of hkl. b: Rork = YIF 0 - FeI/YIFOI in which F and Fe are the observed and calculated 0 structure factor amplitudes, respectively. Rfre is calculated from 5% of the reflections not used in the model refinement. C: Values in parenthesis correspond to the highest resolution shell. d: RMSD, root mean square deviation. 44 Table 11.3. List of oligonucleotide primers used for the creation of A79AAG mutants by PCR based site directed mutagenesis. The codons corresponding to the mutated amino acid are underlined. A79AAG mutants Primer sequences (5'-3') Forward- GTACTTCTGCATGGCCATCTCCAGCC Asnl69Ala Reverse- GGCTGGAGATGGCCATGCAGAAGTAC Forward- GTACTTCTGCATGCTCATCTCCAGCC Asnl69Leu Reverse- GGCTGGAGATGAGCATGCAGAAGTAC 45 Figure 11.1. Biochemical characterization of AAG variants with oligomers containing etheno lesions. (A) Representative gels showing the results of gel mobility shift assays for A79AAG binding to eA:T (FA paired opposite T) and cC:G (eC paired opposite G) 25-mer DNA duplexes. 2 nM 1 2P-labeled oligonucleotide was incubated with an indicated concentration of A79AAG in the lx binding buffer, and the resulting protein-DNA complexes were resolved using 6% native-PAGE. The top band corresponds to the protein-DNA complex and the bottom band corresponds to the free DNA. (B) Graphical representation of A79AAG binding to eA:T 25-mer (n), eC:G 25-mer (0), eA:T 13-mer (e) and eC:G 13-mer (o) oligonucleotide duplexes as measured by gel shift mobility assays. Error bars indicate the standard deviation of at least three independent trials. (C) Representative gels showing the results from competition DNA glycosylase assays. The activity of A79AAG on labeled EA:T 25-mer duplex is inhibited in the presence of indicated concentrations of eA:T 13-mer and eC:G 13-mer unlabeled competitors. 2 nM 32 P-labeled eA:T 25-mer duplex oligonucleotide was incubated in lx glycosylase assay buffer with 5 nM A79AAG enzyme and increasing concentrations of cold competitors at 37*C for 30 min. Following hot alkali treatment, the products were resolved using 20% denaturing Urea-PAGE. The top band represents the uncleaved DNA substrate and the bottom band represents the cleaved product. (D) Graphical representation of the data from competition DNA glycosylase assays, looking at the inhibition of A79AAG activity on labeled eA:T 25-mer duplex substrate by eA:T 13-mer (e) and EC:G 13-mer (o) unlabeled competitors. Error bars indicate the standard deviation of at least three independent trials. (E) Gel results of DNA glycosylase assays for full-length AAG and truncated A79AAG on eA:T and eC:G 25-mer DNA duplexes with E. coli Mismatch Uracil DNA Glycosylase (MUG) as a positive control. Single strand breaks are observed in this Urea denaturing gel when piperdine treatment cleaves AP sites (bottom band). When AAG fails to cleave the lesion base, no AP site is formed and the oligomer remains intact (top band). 46 A B eAT 25-mer Substrate A79AAG (nM) 0 eC:G 25-mer 5 10 25 50 100 250 500 0 1 2.5 5 10 25 50 100 250 100N 1A 7V W, 4w 0i C 4ao2iO2O 400 D Competitor Competitor (nM) - 0 eA:T 13-mer cC:G 13-mer 25 50 100 200 300 400 500 600 5 10 20 40 60 80 100 200 e EIpw sS 400 700 000 Sgo 1000 IA7SAAG) nM Ift a * 301 10 o 4to0 jConii.Itkorj nM E FL -AAG A79AAG Substrate tA:T 25-mer EA:T 25-mer Time (min) 0 30 60 S.A* 0 30 FL-AAG MUG 60 A79AAG EC:G 25-mer EC:G 25-mer 0 0 30 60 30 60 EC:G 25-mer 0 30 60 0-Ao 47 Figure 11.2. Gel results of DNA glycosylase assays for truncated A79AAG on 6A:T and cC:X (X=G/A/T/C) 13-mer DNA duplexes used for crystallization. EA:T 13-mer Time (min) A79AAG 48 60 - 30 + 60 + EC:G 13-mer 60 - 30 60 + + EC:A 13-mer 60 30 60 - + + EC:C 13-mer EC:T 13-mer 60 - 30 60 + + 60 30 60 - + + Figure 11.3. Structure of A79AAG with sC inhibitor DNA. (A) Overall structure of the A79AAG-EC:G complex; the protein is in green ribbons with Tyr162 in stick form. The DNA is colored as follows: carbon, yellow; oxygen, red; nitrogen, blue; and phosphorus, orange. (B) Schematic illustration of the interactions between the amino acid side chains (3 letter code) and main chains (mc) of the AAG protein, and EC containing DNA in the structure of the A79AAG-EC:G complex. Hydrogen bonds are indicated by a solid line and van der Waals interactions by a dashed line. The disordered A26 nucleotide is in dashed lines. (C) Intercalation of Tyrl62 (carbons in green) in the A79AAG-EC:G structure, and coordination of metal ion Mn2 (orange sphere) to the A18 and G19 of the DNA strand opposite the EC lesion (carbons in yellow), and to three water molecules (red spheres). Distances (dashed lines) are measured in Angstr6ms (A). The electron density for the metal ion site is shown in Figure II.6A. Other non-carbon atoms are colored as in (A). B 3' G14 C1 G15 |C1 16 GlO ArgI97 Tyr165 T9 A17 m219 AI| TS #Igle mc163 G19-T 162 Met164- =c220 182 Asn169 Tr12 vC7 ?98 HisI36 Tyr159 Tyr157 Gly163- C 20 G6 A21 T5 mc136 Lys229 mc143 T22 A4 G23 C3 m=145 T24 AI162\ Te G6 C2 A18 2.3 2.3 p 1 C20 .2 3. - I A2 G1 5f G19 49 Figure 11.4. Comparison of the overall structures of the A79AAG-DNA complexes. The superposition of AAG-C:G (green) and AAG-EA:T (gray) (PDB ID 1F4R; (10)) complexes with the carbons of the flipped EC nucleotide colored yellow, and the Tyr162 side chain indicated with an arrow. Regions that show differences with respect to disordered loops are indicated by dashed ellipses. The region 1 (left) corresponds to the residues Gly265-Gly268; and region 2 (right) corresponds to the residues Leu249-Pro254. Tyr1 62 50 - Figure 11.5. Cation site in A79AAG structures. (A) In the structure of the A79AAG-FA:T substrate complex (PDB ID 1F4R (10)), a Na' ion (purple sphere) is coordinated by AAG (carbons in gray) and a water molecule (red sphere). (B) In the structure of A79AAG-FC:G, Na' is replaced by the N-terminal NH 3 ' of Gly80 from a symmetry related molecule (carbons in cyan) in interacting with the A79AAG molecule (carbons in green). All the residues in cyan, Gly80, Pro8l and His82 (along with Met83 not shown in the figure), are part of the precision protease cleavage site sequence and do not represent the wild type AAG sequence. All non-carbon atoms colored as in Figure 11.3. For both (A) and (B), hydrogen bonds are indicated by dashed lines with distances given in Angstr6ms (A). B A Ser1 71 Ser171 Sery72 Ser 729 2 Ala177 . 4 2.6 + 2.6 Met149 Met1 49 %9 3 2 Ala 177 Gly80 ,'2.8 Pro81 His82 Glyl74 Gly1 74 51 Figure 11.6. Interaction of Tyr162 and putative Mn 2 ' binding site in the structure of A79AAGEC:G. (A) 2mFI-DIFeI omit electron density map contoured at la (gray) is drawn around the Mn 2 , ion (orange sphere) and the DNA bases (A18 and G19) that coordinate the metal ion. An anomalous difference electron density map calculated with the native dataset (k = 1.116 A) contoured at 8a (magenta) shows a strong positive peak for an anomalous scatterer such as Mn 2 , (chain A site depicted). Water molecules that coordinate the Mn 2 , ion are not shown. Carbons are in yellow and non-carbon atoms are colored as in Figure 11.3. (B) Difference in the sugar pucker and conformation of DNA backbone near the Mn 2 1 ion in the structure of A79AAG-EC:G compared to A79AAG-EA:T (carbons in gray) (PDB ID IF4R (10)). All other atoms are colored as in (A). (C) The Tyr162 intercalation site is near a Mn 2 + ion and Metl64 (sulfur atom in yellow), which both interact with G19 by using hydrogen bonding and Van der Waals interactions respectively. Protein carbons are in green and all other atoms are colored as in (A). 52 A G6 A121 B * 0 A18 C2 8T19 C2'-exo f' C2'-end~ 18 C e66 1644 G1 53 Figure 11.7. Active site architecture of AAG. (A) Active site of the A79AAG-EC:G inhibitor complex with DNA and amino acid carbons in yellow and green respectively and a putative catalytic water molecule as a red sphere. Hydrogen bonds are indicated as dashed lines. A stereoview of the electron density of this interaction is shown in Figure 11.10. (B) Active site architecture of the A79AAG-EA:T substrate complex (carbons in gray) showing the amino acids interacting with a flipped FA base and the DNA backbone (carbons in yellow) (PDB ID lF4R (10)). (C) Comparison of the active site architecture of A79AAG-EC:G (protein carbons colored green, DNA carbons colored yellow and catalytic water colored red) and A79AAG-FA:T (all carbon atoms and catalytic water colored gray). The movement of the DNA backbone in the A79AAG-EC:G complex due to the binding of EC is indicated by a black arrow. All non-carbon atoms are colored as in Figure 11.3. A GkuI25 Arg182 =i262 Lu80 *Tyr57 Tr159 B Glu125 Tyr7 Asn169 Arg82 LU180 Ty157 tA yr59 C Tyr'127 4G025 Ser286 Arg182 .A 0 tC-3' 54 HOW13 Figure 11.8. AAG binding pocket. A side (A) and top (B) view of EC in the A79AAG-EC:G structure with Van der Waals surfaces shown in gray spheres. (C) 2mIF.I-DIFI omit electron density map contoured at 1o (gray) is drawn only around EC:G containing DNA and a putative catalytic water molecule (red sphere). All atoms are colored as in Figure 11.3. B A Asn169 Leu180 CysI67 Asn169 Leul W GIu125 Cys178 Tyr159 Tyr1 27 6C CW Met149 His136 His1 36 Ata 134. Al134' Ala1 35 Ala135 C Tyr157 Asn 169 Leul80 Aris136 GW01259 'I C Arg182 Tyr162- 55 Figure 11.9. Activation of the leaving group by protonation. (A) Superposition of the structure of the A79AAG-EC:G inhibitor complex (amino acid carbons in green; DNA carbons in yellow; and water as a red sphere) with that of the A79AAG-E125Q-EA:T substrate complex (amino acid carbons, DNA carbons, and waters are in gray) (PDB ID lEWN (10)). All other non-carbon atoms are colored as in Figure 11.3. The hydrogen bonding contacts are indicated as black dashed lines. A magenta dashed line represents a putative hydrogen bonding contact that could stabilize a protonated state of LA. An arrow indicates a water molecule that could protonate N7 of LA. (B) Schematic illustration of the recognition of EA (top) and eC (bottom) by active site residues and of the structure of Hx (right) with each base numbered to correlate with the text. Arrows indicate the proposed protonation site on EA (N7) (top), and the corresponding position in EC (C5) and Hx (N7). A HJs 36 Ala134 N7(rA C5(4C OeC sense. Asn169 B NH. Aa169 <A NH I 2 Hx DNA Asnl89 EC 56 Figure 11.10. A wall-eyed stereoview of the active site of AAG. 2mIFI-DIFeI omit electron density map contoured at 10 (gray) is around EC:G containing DNA, active site protein residues and a putative catalytic water molecule. Atoms are colored as in Figure 11.3. Tyr27 Tyr127 pw4G u125 G u125 Asn169 Arg1 82 _EC Asn 169 Arg1 82 His136,/ IC Tyrl59 His136, Tyrl 5 57 II.VII REFERENCES 1. 2. 3. 4. 5. 6. 7. 8. Coussens, L. M., and Werb, Z. (2002) Inflammation and cancer, Nature 420, 860-867. Wiseman, H., and Halliwell, B. (1996) Damage to DNA by reactive oxygen and nitrogen species: role in inflammatory disease and progression to cancer, Biochem J 313, 17-29. Nair, U., Bartsch, H., and Nair, J. (2007) Lipid peroxidation-induced DNA damage in cancer-prone inflammatory diseases: a review of published adduct types and levels in humans, Free Radic Biol Med 43, 1109-1120. Bartsch, H., and Nair, J. (2002) Potential role of lipid peroxidation derived DNA damage in human colon carcinogenesis: studies on exocyclic base adducts as stable oxidative stress markers, Cancer Detect Prev 26, 308-312. Gros, L., Ishchenko, A. A., and Saparbaev, M. (2003) Enzymology of repair of etheno-adducts, Mutat Res 531, 219-229. Levine, R. L., Yang, I. Y., Hossain, M., Pandya, G. A., Grollman, A. P., and Moriya, M. (2000) Mutagenesis induced by a single 1,N6-ethenodeoxyadenosine adduct in human cells, Cancer Res 60,4098-4104. Zharkov, D. 0. (2008) Base excision DNA repair, Cell Mol Life Sci 65, 1544-1565. Wyatt, M. D., Allan, J. M., Lau, A. Y., Ellenberger, T. E., and Samson, L. D. (1999) 3-methyladenine DNA glycosylases: structure, function, and biological importance, BioEssays 21, 668-676. 9. 10. 11. 12. Lau, A. Y., Scharer, 0. D., Samson, L. D., Verdine, G. L., and Ellenberger, T. (1998) Crystal structure of a human alkylbase-DNA repair enzyme complexed to DNA: mechanisms for nucleotide flipping and base excision, Cell 95, 249-258. Lau, A. Y., Wyatt, M. D., Glassner, B. J., Samson, L. D., and Ellenberger, T. (2000) Molecular basis for discriminating between normal and damaged bases by the human alkyladenine glycosylase, AAG, ProcNatl Acad Sci USA 97, 13573-13578. O'Brien, P. J., and Ellenberger, T. (2003) Human alkyladenine DNA glycosylase uses acid-base catalysis for selective excision of damaged purines, Biochemistry 42, 12418-12429. Adhikari, S., Toretsky, J. A., Yuan, L., and Roy, R. (2006) Magnesium, essential for base excision repair enzymes, inhibits substrate binding of N-methylpurine-DNA glycosylase, J Biol Chem 281, 29525-29532. 13. 14. 15. 16. 17. 18. 19. 58 Wang, P., Guliaev, A. B., and Hang, B. (2006) Metal inhibition of human N-methylpurine-DNA glycosylase activity in base excision repair, Toxicol Lett 166, 237-247. Gros, L., Maksimenko, A. V., Privezentzev, C. V., Laval, J., and Saparbaev, M. K. (2004) Hijacking of the human alkyl-N-purine-DNA glycosylase by 3,N4-ethenocytosine, a lipid peroxidation-induced DNA adduct, J Biol Chem 279, 17723-17730. Lee, C-Y, Delaney, J. C., Kartalou, M., Lingaraju, G. M., Maor-Shoshani, A., Essigmann, J. M., and Samson, L. D. (2009) Recognition and processing of a new repertoire of DNA substrates by human 3-methyladenine DNA glycosylase (AAG), Biochemistry 48, 1850-1861. Hofseth, L. J., Khan, M. A., Ambrose, M., Nikolayeva, 0., Xu-Welliver, M., Kartalou, M., Hussain, S. P., Roth, R. B., Zhou, X., Mechanic, L. E., Zurer, I., Rotter, V., Samson, L. D., and Harris, C. C. (2003) The adaptive imbalance in base excision-repair enzymes generates microsatellite instability in chronic inflammation, J Clin Invest 112, 1887-1894. O'Brien, P. J., and Ellenberger, T. (2004) Dissecting the broad substrate specificity of human 3-methyladenine-DNA glycosylase, J Biol Chem 279, 9750-9757. Fu, D., and Samson, L. D. (2012) Direct repair of 3,N(4)-ethenocytosine by the human ALKBH2 dioxygenase is blocked by the AAG/MPG glycosylase, DNA Repair 11, 46-52. Connor, E. E., and Wyatt, M. D. (2002) Active-site clashes prevent the human 3-methyladenine DNA glycosylase from improperly removing bases, Chem Biol 9, 1033-1041. 20. 21. 22. 23. 24. 25. 26. 27. 28. Tubbs, J. L., Latypov, V., Kanugula, S., Butt, A., Melikishvili, M., Kraehenbuehl, R., Fleck, 0., Marriott, A., Watson, A. J., Verbeek, B., McGown, G., Thorncroft, M., Santibanez-Koref, M. F., Millington, C., Arvai, A. S., Kroeger, M. D., Peterson, L. A., Williams, D. M., Fried, M. G., Margison, G. P., Pegg, A. E., and Tainer, J. A. (2009) Flipping of alkylated DNA damage bridges base and nucleotide excision repair, Nature 459, 808-813. Margison, G. P., Butt, A. , Pearson, S. J., Wharton, S., Watson, A. J., Marriott, A., Caetano, C. M., Hollins, J. J., Rukazenkova, N., Begum, G., and Santibanez- Koref, M. F. (2007) Alkyltransferase-like protein, DNA Repair 6, 1222-1228. Miao, F., Bouziane, M., Dammann, R., Masutani, C., Hanaoka, F., Pfeifer, G., and O'Connor, T. R. (2000) 3-Methyladenine-DNA glycosylase (MPG protein) interacts with human RAD23 proteins, J Biol Chem 275, 28433-28438. Samson, L. D., Derfler, B., Boosalis, M., and Call, K. (1991) Cloning and characterization of a 3-methyladenine DNA glycosylase cDNA from human cells whose gene maps to chromosome 16, Proc Natl Acad Sci USA 88, 9127-9131. Klapacz J., Lingaraju G. M., Guo, H. H., Shah, D., Moar-Shoshani, A., Loeb L. A., and Samson, L. D. (2010) Frameshift mutagenesis and microsatellite instability induced by human alkyladenine DNA glycosylase, Mol Cell 37, 843-853. Otwinowski, Z., and Minor, W. (1997) Processing of X-ray Diffraction Data Collected in Oscillation Mode, Methods Enzymol 276, 307-326. McCoy, A. J., Grosse-Kunstleve, R. W., Adams, P. D., Winn, M. D., Storoni, L. C., and Read, R. J. (2007) Phaser crystallographic software, J Appl Crystallogr40, 658-674. Collaborative Computational Project, Number 4. (1994) The CCP4 suite: programs for protein crystallography, Acta CrystallogrSect D Biol Crystallogr50, 760-763. Murshudov, G. N., Vagin, A. A., and Dodson, E. J. (1997) Refinement of macromolecular structures by the maximum-likelihood method, Acta Crystallogr Sect D Biol Crystallogr 53, 240-255. 29. 30. 31. 32. Kleywegt, G. J., Henrick, K., Dodson, E. J., and van Aalten, D. M. (2003) Pound-wise but penny-foolish: How well do micromolecules fare in macromolecular refinement?, Structure 11, 1051-1059. Brunger, A. T., Adams, P. D., Clore, G. M., DeLano, W. L., Gros, P., Grosse-Kunstleve, R. W., Jiang, J. S., Kuszewski, J., Nilges, M., Pannu, N. S., Read, R. J., Rice, L. M., Simonson, T., and Warren, G. L. (1998) Crystallography & NMR system: A new software suite for macromolecular structure determination, Acta Crystallogr Sect D Biol Crystallogr54, 905-921. Emsley, P., and Cowtan, K. (2004) Coot: model-building tools for molecular graphics, Acta CrystallogrSect D Biol Crystallogr 60, 2126-2132. Laskowski, R., MacArthur, M.W., Moss, D. S., and Thornton, J. M. (1993) PROCHECK: a program to check the stereochemical quality of protein structures, J Appl Crystallogr 26, 283-291. 33. Lovell, S. C., Davis, I. W., Arendall III , W. B., de Bakker, P. I. W., Word, J. M., Prisant, M. G., Richardson, J. S., and Richardson, D. C. (2003) Structure validation by Calpha geometry: phipsi and Cbeta deviation, Proteins 50,437-450. 59 60 Chapter 3. Searching for DNA Lesions: Structural Evidence for Lower- and Higher-Affinity DNA Binding Conformations of Human Alkyladenine DNA Glycosylase Reprinted with permission from "Searching for DNA lesions: Structural Evidence for Lowerand Higher-Affinity DNA Binding Conformations of Human Alkyladenine DNA Glycosylase. Jeremy W. Setser, Gondichatnahalli M. Lingaraju, C. Ainsley Davis, Leona D. Samson, Catherine L. Drennan. Biochemistry. 2012; 51(1):382-390." C 2012 American Chemical Society. 111.1 SUMMARY To efficiently repair DNA, human alkyladenine DNA glycosylase (AAG) must search the million-fold excess of unmodified DNA bases to find a handful of DNA lesions. Such a search can be facilitated by the ability of glycosylases, like AAG, to interact with DNA using two affinities: a lower-affinity interaction in a searching process, and a higher-affinity interaction for catalytic repair. Here, we present crystal structures of AAG trapped in two DNA-bound states. The lower-affinity depiction allows us to investigate, for the first time, the conformation of this protein in the absence of a tightly bound DNA adduct. We find that active site residues of AAG involved in binding lesion bases are in a disordered state. Furthermore, two loops that contribute significantly to the positive electrostatic surface of AAG are disordered. Additionally, a higher-affinity state of AAG captured here provides a fortuitous snapshot of how this enzyme interacts with a DNA adduct that resembles a one-base loop. 61 III.I INTRODUCTION Genomic DNA is under constant attack from endogenous and exogenous sources with most damage occurring in the form of DNA base lesions (1). While approximately 10,000 of these lesions occur daily (1, 2), most do not go on to harm the cell because they are repaired by endogenous pathways. One of the most prevalent DNA repair pathways is known as base excision repair (BER), which is initiated when a DNA glycosylase hydrolyzes the N-glycosidic bond of a lesion base. In humans, the abasic site produced by a monofunctional glycosylase is repaired by the subsequent action of AP endonuclease I, DNA polymerase P, and DNA ligase I or III (3, 4). Human alkyladenine DNA glycosylase (AAG) is one of the monofunctional glycosylase enzymes responsible for initiating BER. AAG catalyzes the removal of a diverse group of purine lesions, including those caused by damage from alkylation (3-methyladenine, 3-methylguanine, and 7-methylguanine) and reactive oxygen and nitrogen species (hypoxanthine, 1,N 6-ethenoadenine (EA) and 1,N 2-ethenoguanine) (5, 6). Removal of these lesions is paramount as they can cause cytotoxicity and mutagenesis (7). To access lesion bases, AAG, like most glycosylases, uses the canonical nucleotide-flipping mechanism wherein the nucleoside with the damaged base is flipped out of the double helix and into the active site while a protein residue intercalates the DNA, effectively substituting for the flipped base. This nucleotide-flipping has been observed in the crystal structure of a catalytically active N-terminal truncation mutant of AAG (denoted A79AAG) in which the protein is bound to DNA containing substrate FA (8). This structure shows that Tyr162 of AAG intercalates DNA while the lesion fits snugly into the binding pocket. This tight interaction observed structurally is supported by the nanomolar affinity of AAG for its substrates in vitro (9-11). Interestingly, AAG also binds with high affinity to DNA containing lesions that it cannot excise, such as inhibitor 3,N 4-ethenocytosine (FC) (5, 9, 12). Structural studies show that EC is also flipped out of the DNA into the active site of AAG and that an extra hydrogen bond between AAG and cC accounts for the two-fold higher affinity for the inhibitor over the substrate DNA (9). Finally, AAG can also bind with high affinity to DNA with a base loop structure, shielding it from repair and leading to frameshift mutations (13). These highly specific interactions (outlined in Figure 111.1) between AAG and DNA are even more intriguing when one considers the massive search that must be undertaken by DNA glycosylases to find damaged DNA bases in the human genome. 62 Given the ~101o nucleotides in the human genome and the -10' lesions per cell per day (1, 2), there are approximately one million normal bases for every lesion present in DNA. Even for an abundant protein like AAG (-2 x 10' molecules per nucleus (14)), each enzyme would have to inspect tens of thousands of normal bases before finding one lesion to excise. Such a task would be seemingly impossible if it involved a strict three-dimensional search, where proteins float through the cell in a stochastic hunt for a scarce number of lesions. In order to limit the search space, it has been proposed that DNA binding proteins could nonspecifically bind and track along DNA in a one-dimensional search (15, 16). Recently, protein 'sliding' on DNA was observed directly in single-molecule fluorescence studies for a number of enzymes including several glycosylases (17-19). Such a nonspecific search has been indirectly observed for AAG using kinetic assays in which the ability of the enzyme to excise two lesions contained in one piece of duplex DNA was examined (20, 21). Kinetic data are also available that indicate AAG is able to search both strands of substrate DNA and avoid obstacles using a 'hopping' mechanism (20). While the ability to slide or hop along DNA requires a lower-affinity and nonspecific complex between protein and DNA, base excision requires high-affinity and specific interactions. Thus, one would expect AAG, and related enzymes, to have differential modes of DNA binding. Evidence in support of this idea is available for other glycosylase systems, including crystal structures of a functional homologue of AAG from Escherichia coli (AlkA) (22, 23), as well as a crystal structure (24) and single-molecule data (17) for human 8-oxoguanine DNA glycosylase (reviewed in (25)). In our current structural studies, we have captured two novel states of AAG. One structure shows AAG making only nonspecific contacts with DNA, depicting a 'lower-affinity' or 'searching' protein-DNA complex. The other shows a higher-affinity complex in which AAG is bound to two pieces of single stranded DNA each containing an *C lesion (sseC) in an arrangement that resembles a single base loop structure. By comparing these structures to each other, and to previously solved structures of AAG bound with high affinity to double-stranded DNA (dsDNA) (8, 9, 26), we can investigate the molecular basis for the differential affinities of this DNA repair protein for DNA and explore the recognition events involved in identifying DNA lesions. 63 111.111 RESULTS Structuraloverview of asymmetric unit The structure of A79AAG in the presence of stoichiometric amounts of single-stranded SC-containing DNA (ssEC) was determined to 2.0 A resolution by molecular replacement using the previously solved structure of A79AAG bound to pyrrolidine-containing DNA (abbreviated A79AAG-pyr:T) (PDB ID 1BNK, (26)) as a search model. The final structure, with two molecules of A79AAG in the asymmetric unit, has been refined to an R factor of 21.9 (Rfree = 26.5) (Table 111.1). Instead of observing two A79AAG molecules each bound to one ssFC DNA, we obtained two different and unique structures of this protein. During crystallization, the ssEC oligonucleotides formed a self-complementary pseudo-duplex, which is specifically recognized by a single molecule of A79AAG in the asymmetric unit (Figures III.2A and III.2B, in orange). We will refer to this interaction as the pseudo-duplex structure. Although the other molecule of A79AAG in the asymmetric unit is also interacting with an EC-containing DNA strand, it only makes nonspecific contacts with the phosphodiester backbone and leaves the EC lesion untouched (Figures III.2B and 111.3). This nonspecific protein-DNA interaction will be referred to as the lower-affinity structure (Figures III.2A and III.2B, in green). The 13-mer pseudo-duplex piece of DNA that we observe crystallographically is highly unlikely to persist in solution, which precludes traditional binding measurements. We have studied the binding of A79AAG to 13-mer ssEC oligonucleotides by gel shift assays as previously described (9) and found no measurable affinity (Figure 111.4). These same assays have shown high affinity A79AAG binding (Kd of 21 E 3 nM) for pre-annealed 13-mer doubled stranded FC oligonucleotides and this highly specific interaction is depicted by a crystal structure with the same dsDNA (9). With these data in mind, the molecules of A79AAG shown in Figure 111.2 must have affinities for their 13-mer oligonucleotides that fall in the range from immeasurably weak, as observed for true single stranded DNA, to the tight binding (Kd of 10-23 nM) measured for pre-annealed dsDNA (9). Considering the green molecule (Figure 111.2) has only a few nonspecific contacts to the DNA, whereas the orange molecule has many specific contacts and closely resembles the high-affinity structures solved previously with dsDNA (8, 9, 26), these structures appear to represent lowerand higher-affinity states, respectively, and will be referred to as such. 64 J 79AAG pseudo-duplex structure In the pseudo-duplex structure, the canonical nucleotide-flipping mechanism of DNA glycosylases can be observed with Tyrl62 inserted into the DNA duplex while the lesion nucleoside (EC7') from one ssEC strand is flipped into the enzyme active site (Figure III.2A Panel I). Interestingly, the active site interactions with the FC lesion for this pseudo-duplex structure are identical to those of A79AAG with dsDNA (abbreviated A79AAG-EC:G) (PDB ID 3QI5, (9)) and both structures share high overall similarity with a root-mean-squared deviation (RMSD) between alpha-carbons of 0.43 A (Figure 111.5). This pseudo-duplex structure is also highly homologous to the structure of A79AAG with substrate lesion EA in dsDNA (abbreviated A79AAG-FA:T) (PDB ID 1F4R, (8)), with an RMSD for a-carbons of 0.93 A. Although nucleotide-flipping is observed in the pseudo-duplex structure, the interactions surrounding the intercalated residue (Tyr162) are not identical to those previously observed in the structure of AAG with SC-containing dsDNA. In the A79AAG-FC:G structure, a potential steric clash of Tyrl62 with G19 (base opposite EC) is prevented by a shifting of G19 out of the minor groove, leaving it without a base pairing partner (Figures III.2C and III.2E) (9). In contrast, A2 of the pseudo-duplex structure avoids a steric clash with a sideways motion that allows for hydrogen bonding to T8' of the opposite strand (Figure III.2D, III.2F). This sideways motion also changes the orientation of the neighboring base G 1, such that it now hydrogen bonds to T9' (Figure III.2D). Although Metl64 contacts the 'opposite bases' (G19 and A2) in both structures, the orientation of the interaction is also different (Figures III.2E and III.2F). A79AAG lower-affinity structure The lower-affinity structure of A79AAG shows only nonspecific interactions (Figures III.2A and III.2B, in green), with hydrogen-bonding contacts to the phosphodiester backbone by the side chains of Argl82, Argl97, and Arg207 and the main chain amides of Ser219 and Lys220 (Figures III.2B and III.6A). Interestingly, the protein residue that normally intercalates substrate DNA, Tyr162, is contacting the pseudo-duplex by stacking with nucleotide A2' (Figure III.2A Panel II and Figure III.6B). While this Tyr162 adopts a similar orientation as found for intercalated Tyrl62 residues from the higher affinity complex structures (e.g. Figure III.7A vs. III.7B), it has higher B-factors, indicating increased conformational flexibility (see Figure III.8B). In addition to stacking with Tyrl62, A2' hydrogen bonds with T8, leaving eC7 orphaned 65 in terms of base pairing (Figure III.6C). This aC7 lesion also has no interaction with protein residues (Figure 111.3). Overall, the structure of lower-affinity A79AAG is similar to other structures of this protein, including the pseudo-duplex structure described above (RMSD for a-carbons = 1.27 = 1.26 the A79AAG-EC:G complex (RMSD for a-carbons A79AAG-EA:T (RMSD for a-carbons lower-affinity = 1.18 A) A) A), (9), and the structure of (8). While these RMSDs are low, the structure has three distinct disordered regions when compared to the A79AAG-EA:T structure (Figures III.7A and III.7B). Since there are no lattice contacts in this area (Figure 111.3), we can attribute the disorder to the absence of bound nucleotide in the active site of lower-affinity AAG. The residues that lack electron density in the low-affinity complex, and are thus considered disordered, include Glul3l-Argl4l (Loop 1), Gly263-Lys273 (Loop 2), and C-terminal residues after Asp289 (Loop 3) (Figure III.7A and III.7B). Loop 1 contains crucial active site residues, including Ala134-Hisl36, which form a snug pocket for lesion bases (Figure III.7C). This binding pocket is only partially formed in the absence of nucleotide (Figure III.7D). Disordered loops 2 and 3 are not involved in forming the active site but contribute to the electrostatic potential of the protein (Figures III.7E-III.7H). Electrostatic surfaces for A79AAG-aA:T (after removing the DNA) and for lower-affinity A79AAG are considerably different (Figures III.7E and III.7F) (All electrostatic depictions were calculated using the Adaptive Poisson-Boltzman Solver (APBS) software plug-in (27) for PyMOL (28)). The A79AAG-aA:T complex shows a continuous, and richly positive, DNA-binding surface as would be expected for a protein that contacts DNA with high affinity (Figures III.7E and III.7G). In contrast, the DNA-binding surface for the lower-affinity structure is more neutral with disordered loops 1-3 disrupting positive patches observed in the A79AAG-EA:T high-affinity complex (Figures III.7E-III.7H). Other regions of the protein show little difference in the ordered electrostatic surface, such as the area near the intercalating residue Tyr162 (marked with a star in Figures 111.7 and 111.9). Also, both structures display a positively charged electrostatic surface that circles the protein molecule from the top of A79AAG to the bottom (see middle view of Figures III.9A and III.9B), as well as a negative electrostatic region located opposite the DNA binding surface (Figure 111.9). 66 III.IV DISCUSSION DNA glycosylases are charged with the formidable task of locating and repairing potentially harmful DNA lesions while avoiding the million-fold excess of normal, healthy DNA bases. The difficulty of this searching process can be partially overcome by the formation of a weak complex between protein and DNA, effectively creating a nonspecific, one-dimensional search. However, to maintain fidelity and genomic integrity, the enzyme must also be able to form a stronger, highly specific complex for lesion recognition and excision. Therefore, the ability to adopt both low and high-affinity conformations appears advantageous. Here, we have trapped a human DNA glycosylase, AAG, in both lower and higher-affinity complexes with DNA (Figure 111.2), providing two snapshots of this enzyme that relate to this search process. Interestingly, AAG has been shown to bind with high affinity to DNA damage that it can repair (such as t-A lesions) as well as to damage that it cannot repair (such as EC lesions and one-base loops) (9-11, 13). Crystallographic studies have provided molecular insight into how AAG recognizes both EA and EC lesions within dsDNA (8, 9), but no structure of AAG bound to a one-base loop or in a low affinity complex with DNA has been determined. The pseudo-duplex structure that we present here appears to be the best representation available of how AAG could bind to such a DNA loop structure. In a one-base loop, one nucleoside is 'looped out' of the DNA, and the base opposite the 'looped out' base hydrogen bonds with an adjacent base instead (Figure III.1C). This arrangement of bases resembles what we observe in the pseudo-duplex structure and represents a major departure from the hydrogen bonding pattern of nucleotides observed in other AAG-DNA complexes (e.g. Figure III.2C). The 'looped out' base is nicely accommodated in the AAG active site with identical interactions to those observed previously for an EC lesion (Figure III.5B) (9). In addition, the close resemblance of the pseudo-duplex structure to previously solved structures of A79AAG bound to dsDNA (8, 9, 26) is consistent with the idea that this structure represents a high-affinity complex between AAG and DNA. This observation is in agreement with the high-affinity binding observed between AAG and a one-base loop structure in vitro (13). A physiological rationale for why AAG binds to DNA damage that it cannot repair remains to be determined: while tight binding of AAG to lesions it can repair such as -A, can be beneficial to the cell (29), tight binding of AAG to base loop structures shields them from repair, increasing mutation rates (13). As the physiological 67 significance of this behavior of AAG is elucidated, our work suggests a molecular basis for the recognition of base loops by this human DNA repair protein. Excitingly, our crystallization conditions have also yielded the first nonspecific or lower-affinity depiction of AAG, providing insight into a conformation of the protein likely responsible for inspecting DNA for damage. Although the top side of the active site, including the position of the putative catalytic water, agrees well with high-affinity lesion-bound structures (Figure III.5B), the residues comprising the active site floor are disordered (Figure 111.7). This observation of a partially ordered active site suggests an order of events for the binding of AAG to DNA in which a lesion base is first identified by a more dynamic state of the protein, and is later recognized with high-affinity as the active site pocket closes around the nucleotide-flipped lesion. Our structural studies are consistent with fluorescence-based kinetic assays, which have provided evidence for a two-state lesion recognition process for AAG, where the active site experiences changes in environment prior to nucleotide flipping (10, 30). This initial state observed kinetically has been likened to the initial recognition complexes suggested for other glycosylases (25, 31). With the lesion flipped into the active site, an intercalating residue (Tyrl62 for AAG) maintains the double helical DNA structure. An interesting point of discussion in the DNA repair literature is whether intercalating residues play an active or passive role in lesion recognition. In other words, whether the intercalating residue directly interrogates base pairs (active), or the success of the search relies on the intercalating residue filling the gap left behind by a flipped lesion (passive). Two recent structural studies on the glycosylases MutM and the functional homologue of AAG from E. coli, AlkA, have provided conflicting answers to this question. In both studies, the glycosylases were linked to undamaged DNA in a stable complex using disulfide crosslinks (22, 31), and the position of the intercalating residue was evaluated. For MutM, the intercalating residue (Phe 114) is fully inserted into the DNA duplex, buckling the bases with which it interacts, as the protein simultaneously bends the DNA, suggestive of an active interrogation mode (31). In contrast, the structures of AlkA with undamaged DNA show snapshots of a glycosylase in a more passive interrogation mode, with the intercalating residue (Leul25) situated completely outside of a double-helix, which maintains all base-stacking interactions and remains mostly linear (22). In our lower-affinity structure, the intercalating residue of AAG, Tyrl62, has increased flexibility, but still maintains the same average position 68 for its sidechain as is found in the higher-affinity structures (e.g. Figure III.7A vs. III.7B). Tyr162 is also still involved in a stacking interaction with a nucleotide (A2') even when intercalation is not possible (Figure 111.6). This observation suggests that Tyrl62 is capable of making both lower and higher-affinity interactions with DNA, possibly playing roles both in a lower-affinity 'searching' process and in a higher-affinity 'recognition' process. Consistent with an ability to form different types of interactions, the Tyri62 loop is flexible, displaying approximately two-fold higher B-factors than average for this crystal structure (Figure 111.8). Just as residues in the active site of AAG are disordered in the absence of a tightly bound DNA lesion, residues that contribute to the positive electrostatic surface are also disordered (loops 2 and 3 in Figures 111.3 and 111.7). The highly positively-charged and complementary surface of AAG that binds DNA with high affinity (Figures III.7E and III.7G) is disrupted in the low-affinity structure (Figures III.7F and III.7H). Loops 2 and 3 are not pre-ordered, ready to bind with high affinity to a DNA lesion. Instead, they are highly mobile, suggesting that they could play an active role in interrogating DNA. In terms of interrogating DNA, there is strong evidence that the searching process of DNA binding proteins is not a strictly linear scan of DNA. A single-molecule study of eight different DNA binding proteins, including three glycosylases, found that the movements of these proteins along DNA was better described by a rotation-coupled sliding mechanism (17). Such movement would orient the enzyme so that its binding surface always faces the axis of the DNA double helix. In essence, these proteins circle the DNA while diffusing along it. The electrostatic potential surface calculated for AAG is consistent with this rotation-coupled search mechanism. In both higher and lower-affinity AAG complexes, a positive electrostatic surface is found to wrap around the protein (Figures III.9A and III.9B). This surface could be used to 'roll' or 'rock' back and forth along the negatively charged DNA backbone while the presence of a negatively charged electrostatic cap on the opposite face of AAG (red in Figure 111.9) would maintain correct orientation for lesion recognition. 'Hopping', another DNA search method, has been established for AAG through the use of kinetic assays (20). Hopping, or short-range dissociationassociation events, allows AAG to search both DNA strands simultaneously and avoid obstacles, such as a DNA-encasing endonuclease like EcoRI, that may be present along the search path (20). Rotation-coupled sliding and hopping are not mutually exclusive, and we consider both in the proposed search mechanism for AAG that is outlined in Figure III.9C. 69 In the initial search, we propose that AAG closely resembles the lower-affinity structure, interacting with DNA nonspecifically through its positive electrostatic surface. Incorrect orientation of AAG would be avoided due to the negative electrostatic patch opposite the active site (Figure III.9B). The positive surface that wraps around AAG would promote a rotationcoupled sliding search of the DNA, while still allowing for the hopping events described above. As a lesion is recognized, disordered regions of AAG, including the active site pocket, become more ordered (Figure 111.7). After nucleotide-flipping, AAG adopts a higher-affinity conformation such as the pseudo-duplex structure (Figure III.2A, in orange) or dsDNA structures published previously (8, 9, 26). Here, previously disordered loops are completely ordered to display the full potential of a continuous electrostatic surface for binding DNA, Tyr162 is fully inserted into the DNA, and a base lesion is bound tightly in the AAG active site. This lesion recognition complex would interact very strongly with the DNA, halting the search by AAG. In cases where the lesion is a substrate, base excision would follow. After base-lesion release, the active site and other loops of AAG would become partially disordered, decreasing the extent of an ordered DNA binding surface, ultimately leaving AAG in its lower-affinity, nonspecific searching state once again. In cases where the lesion cannot be repaired, AAG would remain fixed in its higher-affinity state, providing a rationale for the abortive AAG-EC complexes observed in vivo (12). The two novel structures of human AAG presented here help provide a molecular understanding of this intriguing DNA repair protein, both in terms of understanding how AAG can recognize different types of DNA damage, such as base lesions and one-base loops, and how it may search the genome for DNA damage. With recent literature describing an expanded ability of AAG to both repair base lesions (5) and identify DNA damage that it cannot repair (5, 9, 13), this study provides important insight into the molecular basis of AAG interactions. III.V MATERIALS AND METHODS AAG plasmid construction and proteinpreparation The A79AAG plasmid was constructed as described previously (9). Briefly, 84 residues at the N-terminus of the protein were truncated in this construct, and four extra residues from a PreScission Protease cleavage site (GE Healthcare) (Gly80, Pro8l, His82, and Met83) were left 70 behind after histidine-tag cleavage. Therefore, Thr84 begins the wild type AAG sequence but four residues precede Thr84 such that Gly80 is now the N-terminus. We refer to this truncated protein construct as A79AAG. It should be noted that the AAG protein from previous structural studies was also referred to as A79AAG (8, 26). However, in those studies, all residues contained in the construct are of the wild type sequence. The expression and purification of the A79AAG protein was performed as described previously (see Chapter II.V, 9). Crystallizationof A79AAG with single-strandedeC DNA An equimolar ratio of A79AAG and 13-mer single-stranded EC-containing DNA (sseC) (5'-GAC ATG ECTT GCC T-3') were mixed to form a protein-DNA complex concentration of 0.3 mM in the complex buffer (20 mM HEPES-NaOH pH 7.5, 100 mM NaCl, 0.1 mM EDTA, 5% v/v glycerol and 1 mM DTT). The complex was incubated on ice for 15 min and used for crystallization. Crystals were obtained by the hanging drop vapor diffusion method upon mixing 1 pL of protein-DNA complex and 1 pl of reservoir solution (100 mM BIS-TRIS pH 5.5, 200 mM cesium chloride and 20% polyethylene glycol (PEG) 3350) over 0.5 mL of reservoir solution. Crystals appeared after incubation for 14 days at 22*C. These crystals were cryoprotected with precipitation solution supplemented with 10% glycerol and flash frozen in liquid nitrogen prior to data collection. Data collection and structure determination X-ray diffraction data were collected at the Advanced Light Source (Berkeley, CA) on beamline 12.3.1 at 100 K to 2.0 A resolution and processed using Denzo/Scalepack (32) (Table 111.1). The structure, with two molecules in the asymmetric unit, was determined by molecular replacement in PHASER (33) using the coordinates from the A79AAG-pyr:T complex structure (PDB ID 1BNK, (26)). Refinement was carried out in CNS (34) and Refmac 5.4 (35, 36), using topology and parameter files for the FC lesion generated by XPLO2D (37). Additional rounds of refinement using TLS parameters and non-crystallographic symmetry restraints were very effective in improving the quality of the fit. Model building was performed using the program Coot (38), and figures were prepared using PyMOL (28). The final model converged to an R factor of 21.9 (Rfree = 26.5) (Table 111.1) and was evaluated using PROCHECK (39) and composite omit maps. As was observed in our previously solved structure using this protein 71 construct (9), the positively charged N-terminus of both molecules of A79AAG in the asymmetric unit occupies what was initially identified as a sodium ion site by Ellenberger and co-workers (8). Although this coordination of the N-terminus is common to our A79AAG structures, the packing of the molecules in the current study allowed AAG to crystallize in a novel space group (P4 3). The following residues of the total sequence of 80-298 lack electron density and are therefore not included in the model: 201-208, 265-266 and 294-298 in chain A (pseudo-duplex structure); 131-141, 199-206, 253-254, 263-273 and 290-298 in chain B (loweraffinity AAG). Due to a lack of interpretable electron density for the side chains of some residues in the structure (Leu200, Leu209, Glu250 in chain A; Prol44, Ile161, Met164, and Arg212 in chain B), these residues were modeled as alanines. Nucleotides G 1' and CI '-T 13' of the strand containing the nucleotide-flipped FC lesion, and T9-T13 of the pseudo-complement strand are disordered. III.VI ACKNOWLEDGEMENTS This work was supported, in part, by the US National Institutes of Health Grants P30-ES002109 (to C.L.D. and L.D.S.), GM65337 (to C.L.D.), GM65337-03S2 (to C.A.D.), and CA055042 and CA092584 (to L.D.S.). C.L.D. is an investigator of The Howard Hughes Medical Institute. L.D.S. is an American Cancer Society Research Professor. J.W.S. is supported by a Repligen KIICR Graduate Fellowship. The Advanced Light Source is supported by the Director, Office of Science, Office of Basic Energy Sciences, of the U.S. Department of Energy under Contract No. DE-AC02-05CH 11231. The atomic coordinates have been deposited with the Protein Data Bank (http://www.rcsb.org) under the PDB accession code 3UBY. Author contributions: G.M.L. performed protein expression and purification, crystallization, and data collection. C.A.D. carried out the data processing, molecular replacement, and initial refinement. G.M.L. and C.A.D. started the structural analysis, while J.W.S. carried out the final rounds of refinement and completed the structural analysis. G.M.L. and L.D.S were involved in study design, J.W.S. and C.L.D. wrote the manuscript, and all authors edited the manuscript. 72 TABLES & FIGURES Table 111.1. Data collection and refinement statistics for A79AAG-DNA complex. Space group P43 a = b =41.17, c = 262.55 a= P= Y= 90 ALS 12.3.1 Cell constants (A) (0) Beamline 1.116 Wavelength (A) 66 - 2.00 (2.07 - 2.00) Resolution (A) No. total observations 95966 No. unique observations 26998 Completeness (%) 92.4 (89.6) c <I/(C)>' 14.8 (7.4) Rsym (%) a, c 7.4 (15.8) Model refinement Rwork (%) b 21.9 Rfr,,ee (%) 26.5 b B-factors (A2) Protein DNA Water 35.6 48.9 22.3 RMSD bonds (A) d RMSD angles 0.008 1.2 (0) d Number of atoms Protein DNA Water Ramachandran plot (%) 2965 (2 molecules/asu) 353 250 Most favored 91.0 Additionally allowed 9.0 Generously allowed a: Rsym= Ihk where I is the intensity of a reflection hkl and <I> is the average over symmetry-related reflections of hkl. b: Rwork = IF 0 - FeI/1JFI in which F and Fc are the observed and calculated structure factor amplitudes, 0 respectively. Rfree is calculated from 5% of the reflections not used in the model refinement. C: Values in parenthesis correspond to the highest resolution shell. d: RMSD, root mean square deviation. - hk>1/X hk, 73 Figure 111.1. DNA adducts to which AAG binds with high affinity: Lesions (A) EC and (B) EA and (C) one-base loop structures. A B EC G 74 C EA T A AA TT it Figure 111.2. Structures of A79AAG bound to EC DNA. (A) A79AAG crystallized in the presence of ssEC DNA has two A79AAG molecules in the asymmetric unit: one that makes few contacts to DNA and represents a lower-affinity complex (green) and one that makes multiple contacts to DNA and represents a higher-affinity complex (orange). The two strands of ssFC DNA, which form a pseudo-duplex, are shown as sticks with cyan carbons. Panel (I) displays Tyr162 (in orange stick) intercalating DNA while the FC lesion is flipped into the active site. Panel (II) depicts the lower-affinity interaction between A79AAG and DNA where Tyr162 (in green stick) stacks with nucleotide A2'. Atoms are colored as follows: oxygen (red), nitrogen (blue), and phosphorus (orange). A blue star denotes the location of the empty active site of lower-affinity AAG. (B) Schematic illustration of the interactions between the two strands of ssEC DNA and amino acid side chains (3-letter code) and main chains (mc) of the A79AAG molecules. Amino acid labels from the lower and higher-affinity (pseudo-duplex bound) A79AAG molecules are colored green and orange respectively. Hydrogen bonds are indicated by a solid line and Van der Waals interactions by a dashed line. DNA bases are shown as rectangles containing one-letter codes and numbers that signify their respective positions in the oligonucleotide (5' to 3'). All DNA bases contained in the nucleotide-flipped EC lesion strand are denoted with a prime symbol ('). Disordered nucleotides are in dashed lines. (C) Nucleotide interactions near lesion in A79AAG-EC:G dsDNA (PDB ID 3QI5 (9)) (yellow carbons). Relevant distances shown by dashed lines are given in Angstr6ms (A). (D) Nucleotide interactions near lesion in pseudo-duplex A79AAG structure (cyan carbons). (E) Van der Waals interactions with G19 in A79AAG-EC:G structure. (F) Van der Waals interactions with A2 in pseudo-duplex A79AAG structure. A 3' B C12' C11' G10' C7 r1 T9' 5' Tyr1 62 C A T8' - C3 G6' A4 T5' D A17 2. GI 9 G19 C T5 '3. T8 T8 2 A18 p G6 A4' Arg207 Arq 197 3.6T8 G6 C3' nc219 rnc220 C3 Arg82 .T r162 A21 - Gil EC7 E T9 -Met164 5, A2 C11 G19' Tr 162 Tyr162 12 T13 3' 75 Figure 1113. Wall-eyed stereoview of the disordered loops of the lower-affinity A79AAG structure in the context of the crystal lattice. The asymmetric unit of our structure is represented as in Figure 111.2 with lower-affinity A79AAG and the higher-affinity pseudo-duplex structure in green and orange cartoon, respectively, with the pseudo-duplex piece of DNA between them in stick form with cyan carbons. Molecules that make up the rest of the crystal lattice are in gray with protein in cartoon and DNA in stick form. The disordered loops of lower-affinity A79AAG are visualized by aligning the A79AAG-EA:T structure (PDB ID 1F4R (8)) and displaying these loops as pink cartoon. Regions that become disordered in the absence of a bound DNA adduct are circled and labeled 1-3. This numbering scheme matches that of Figure 111.7. With this view, one can see that these loops would have ample space in the crystal packing and the disorder observed in these residues is not due to crystal contacts. The EC base that is not bound in an AAG active site (in stick form with yellow carbons (FC7)) is found to have no interactions with protein (or DNA) in the crystal lattice. Non-carbon atoms are colored as in Figure 111.2. 76 Figure III.4. A79AAG shows no affinity for ssEC 13-mer by gel shift. Gel mobility shift assays were performed as previously described (9) using the indicated concentrations of A79AAG and 2 nM of 32 P-labeled ssEC 13-mer. The band at the bottom of the gel represents the ssEC 13-mer in solution. A clear band shift is not observed as the amount of A79AAG is increased and the smearing of the gel in the later lanes is indicative of some low-affinity interactions. This same assay performed with 13-mer duplex DNA containing the EC lesion shows a very clear band shift with a Kd of -20 nM (9). Substrate A79AAG (nM) sseC 13-mer 0 5 10 25 50 100 250 500 1000 77 Figure I.5. A79AAG structural comparisons. (A) A wall-eyed stereoview of A79AAG bound to dsDNA (protein in blue ribbon, DNA in yellow sticks) and pseudo-duplex DNA (protein in orange ribbon, DNA in cyan sticks) shows striking similarities in binding mode. The intercalating Tyr162 (in sticks) is denoted with an arrow and the EC lesion is colored such that carbon atoms match the rest of the respective DNA. All Non-carbon atoms are colored as in Figure 111.2. (B) Active site overlay of A79AAG bound to EC-containing dsDNA (protein carbons in blue) and pseudo-duplex EC DNA (protein carbons in orange) with the lower-affinity structure (protein carbons in green). The putative catalytic water molecule that is present in all AAG structures is denoted as a sphere and colored to match the protein carbon atoms of its respective structure. DNA carbons and all other non-carbon atoms are colored as in (A). Hydrogen bonding is indicated as dashed lines. A TyrB62 Tyr162 GIu2 Leu180 Asn169 Arg 182 Tyr157 H20 Hi3 Smc262 T159 78 His1 36 Figure 111.6. Tyr162 contacts in lower-affinity A79AAG. (A) Hydrogen bonding contacts (dashed lines, distances in A) for lower-affinity A79AAG (green) with pseudo-duplex DNA (carbons in cyan), and non-carbon atoms colored as in Figure 111.2. (B) Van der Waals radii for protein and DNA are shown in gray spheres with all other representations and colors as in (A). (C) The same depiction as in (B) with the orientation changed slightly to show relevant distances (in A) as depicted by dashed lines and to draw attention to the rotation of FC7 out of the pseudo-duplex. A Tyr162 3 A2' :2.5 02.8 Arg 197 Lys220 2.9 2.9 Ser219 Arg 182 B CC3' G6 3 s3. &C7 T8 7% C3' :3.7 43 79 Figure 111.7. Comparison of the lower-affinity A79AAG structure with the high-affinity A79AAGEA:T structure. (A) A79AAG (purple cartoon) bound to an FA lesion (stick form with cyan carbons) with active site residue His 136 and intercalating Tyr 162 represented in stick form with purple and yellow carbons respectively (PDB ID 1F4R, (8)). Non-carbon atoms are colored a in Figure 111.2. Regions that become disordered in the absence of a bound DNA adduct are circled and labeled 1-3. This numbering scheme matches that of Figure 111.3. (B) Lower-affinity AAG (green) with Tyr162 (yellow). Loops 1-3 and other atom colors are as in (A). (C) Binding pocket for the EA lesion is shown with Van der Waals surfaces for protein residues (gray spheres) and EA lesion (cyan sphere). (D) Disrupted binding pocket in lower-affinity AAG with Van der Waals surfaces colored as in (B). (E) Electrostatic representation of A79AAG-EA:T calculated in the absence of DNA where surfaces in blue are more positive, those in red more negative, and those in white are near neutral. The position of Tyr162 is denoted with a yellow star. (F) Electrostatic representation of lower-affinity AAG with colors and symbols as in (E). (G) Same depiction as in (E) but with substrate DNA modeled (orange cartoon). (H) Same electrostatic depiction as in (F) aligned and superimposed with a cartoon model (purple) of A79AAG-EA:T. Disordered regions that affect electrostatic potential are circled and represent the same loops as in (A) and (B). 80 B A is 3 Tr162,- Tyr162 2 2 c3 Leul8O Leu180 Asn169 Cys167 Asn169 Cys167 Glul25 Glu125 Tr159 Tyr127 - Tyr127 y' Tyrl59 His136 Ala134E E F G H A d4 81 Figure 111.8. Wall-eyed stereoviews of electron density in the lower-affinity A79AAG structure. (A) 2F0 -F, electron density omit map (blue mesh) contoured at la around Vall06-Glyl19 shows representative electron density. (B) 2F0 -F, electron density omit map (blue mesh) contoured at 10 shows the region from Val158-Tyrl65. This Tyr162 loop is flexible, displaying broken electron density and higher B-factors (2-fold higher than the chain average; this same loop in the high-affinity pseudo-duplex EC structure shows average B-factors). The absence of these residues results in the appearance of positive difference electron density, while refinement in the presence of the modeled residues does not yield negative difference electron density. Thus, these residues are included in the model as depicted. Non-carbon atoms are colored as in Figure 111.2. A B 82 Figure 111.9. Proposal for how AAG can recognize DNA with two different affinities. The electrostatic representations from Figures III.7E and 1II.7F are displayed in (A) and (B), for A79AAG-EA:T and lower-affinity A79AAG, respectively, with the same coloring and symbols as in Figure 111.7. The orientation of the molecules start as in Figure 111.7, and are then rotated 1200 counterclockwise (in two 60* steps) along the vertical axis such that the continuous positive surface can be visualized. (C) Cartoon depiction of the search on DNA by AAG where blue and red represent positively and negatively charged surfaces respectively. Relevant steps are labeled and a lesion base is denoted as a green line. The AAG catalysis complex is a darker shade of blue to represent the more ordered positive surface visualized crystallographically ((A) vs. (B) above). A Ao B C Rotation-coupled sliding Hopping OW Lesion Searching Recognition Lesion Catalysis 83 III.VIIREFERENCES 1. 2. 3. 4. 5. 6. Lindahl, T. (1993) Instability and decay of the primary structure of DNA, Nature 362, 709-715. Lindahl, T., and Barnes, D. (2000) Repair of endogenous DNA damage, Cold Spring Harb Symp Quant Biol.65, 127-134. David, S. S., and Williams, S. D. (1998) Chemistry of Glycosylases and Endonucleases Involved in Base-Excision Repair, Chem Rev 98, 1221-1262. Kubota, Y., Nash, R. A., Klungland, A., Schar, P., Barnes, D. E., and Lindahl, T. (1996) Reconstitution of DNA base excision-repair with purified human proteins: interaction between DNA polymerase beta and the XRCC1 protein, EMBO J 15, 6662-6670. Lee, C.-Y. I., Delaney, J. C., Kartalou, M., Lingaraju, G. M., Maor-Shoshani, A., Essigmann, J. M., and Samson, L. D. (2009) Recognition and Processing of a New Repertoire of DNA Substrates by Human 3-Methyladenine DNA Glycosylase (AAG), Biochemistry 48, 1850-1861. O'Brien, P. J., and Ellenberger, T. (2004) Dissecting the broad substrate specificity of human 3-methyladenine-DNA glycosylase, J Biol Chem 279, 9750-9757. 7. 8. 9. 10. 11. 12. 13. 14. 15. 16. 17. Shrivastav, N., Li, D., and Essigmann, J. M. (2010) Chemical biology of mutagenesis and DNA repair: cellular responses to DNA alkylation, Carcinogenesis31, 59-70. Lau, A. Y., Wyatt, M. D., Glassner, B. J., Samson, L. D., and Ellenberger, T. (2000) Molecular basis for discriminating between normal and damaged bases by the human alkyladenine glycosylase, AAG, ProcNatl Acad Sci USA 97, 13573-13578. Lingaraju, G. M., Davis, C. A., Setser, J. W., Samson, L. D., and Drennan, C. L. (2011) Structural basis for the inhibition of human alkyladenine DNA glycosylase (AAG) by 3,N4-ethenocytosine containing DNA, J Biol Chem 286, 13205-13213. Wolfe, A. E., and O'Brien, P. J. (2009) Kinetic mechanism for the flipping and excision of 1,N(6)-ethenoadenine by human alkyladenine DNA glycosylase, Biochemistry 48, 11357-11369. O'Brien, P. J., and Ellenberger, T. (2003) Human alkyladenine DNA glycosylase uses acid-base catalysis for selective excision of damaged purines, Biochemistry 42, 12418-12429. Gros, L., Maksimenko, A., and Privezentzev, C. (2004) Hijacking of the Human Alkyl-N-purine-DNA Glycosylase by 3,N4-Ethenocytosine, a Lipid Peroxidation-induced DNA Adduct, J Biol Chem 279, 17723-17730. Klapacz, J., Lingaraju, G. M., Guo, H. H., Shah, D., Moar-Shoshani, A., Loeb, L. A., and Samson, L. D. (2010) Frameshift mutagenesis and microsatellite instability induced by human alkyladenine DNA glycosylase, Mol Cell 37, 843-853. Ye, N., Holmquist, G. P., and O'Connor, T. R. (1998) Heterogeneous repair of N-methylpurines at the nucleotide level in normal human cells, J Mol Biol 284, 269-285. Berg, 0. G., Winter, R. B., and von Hippel, P. H. (1981) Diffusion-driven mechanisms of protein translocation on nucleic acids. 1. Models and theory, Biochemistry 20, 6929-6948. Schurr, J. M. (1979) The one-dimensional diffusion coefficient of proteins absorbed on DNA. Hydrodynamic considerations, Biophys Chem 9,413-414. Blainey, P. C., Luo, G., Kou, S. C., Mangel, W. F., Verdine, G. L., Bagchi, B., and Xie, X. S. (2009) Nonspecifically bound proteins spin while diffusing along DNA, Nat Struct Mol Biol 16, 1224-1229. 18. 19. 20. 21. 84 Grandli, A., Yeykal, C. C., Robertson, R. B., and Greene, E. C. (2006) Long-distance lateral diffusion of human Rad5l on double-stranded DNA, Proc Natl Acad Sci USA 103, 1221-1226. Blainey, P. C., van Oijen, A. M., Banerjee, A., Verdine, G. L., and Xie, X. S. (2006) A base-excision DNA-repair protein finds intrahelical lesion bases by fast sliding in contact with DNA, Proc Natl Acad Sci USA 103, 5752-5757. Hedglin, M., and O'Brien, P. J. (2010) Hopping Enables a DNA Repair Glycosylase To Search Both Strands and Bypass a Bound Protein, ACS Chem Biol 5,427-436. Hedglin, M., and O'Brien, P. J. (2008) Human Alkyladenine DNA Glycosylase Employs a Processive Search for DNA Damage, Biochemistry 47, 11434-11445. 22. 23. Bowman, B. R., Lee, S., Wang, S., and Verdine, G. L. (2010) Structure of Escherichiacoli AlkA in complex with undamaged DNA, J Biol Chem 285, 35783-35791. Hollis, T., Ichikawa, Y., and Ellenberger, T. (2000) DNA bending and a flip-out mechanism for base excision by the helix-hairpin-helix DNA glycosylase, Escherichia coli AlkA, EMBO J 19, 758-766. 24. 25. 26. 27. Bruner, S. D., Norman, D. P., and Verdine, G. L. (2000) Structural basis for recognition and repair of the endogenous mutagen 8-oxoguanine in DNA, Nature 403, 859-866. Friedman, J. I., and Stivers, J. T. (2010) Detection of Damaged DNA Bases by DNA Glycosylase Enzymes, Biochemistry 49, 4957-4967. Lau, A. Y., Scharer, D., Samson, L. D., Verdine, G. L., and Ellenberger, T. (1998) Crystal Structure of a Human Alkylbase-DNA Repair Enzyme Complexed to DNA: Mechanisms for Nucleotide Flipping and Base Excision, Cell 95, 249-258. Baker, N. A., Sept, D., Joseph, S., Holst, M. J., and McCammon, J. A. (2001) Electrostatics of nanosystems: application to microtubules and the ribosome, Proc Natl Acad Sci USA 98, 10037-10041. 28. 29. 30. 31. 32. 33. 34. 35. 36. 37. 38. 39. Delano, W. L., Schrodinger LLC. (2002) The PyMOL Molecular Graphics System. Meira, L. B., Bugni, J. M., Green, S. L., Lee, C.-W., Pang, B., Borenshtein, D., Rickman, B. H., Rogers, A. B., Moroski-Erkul, C. A., McFaline, J. L., Schauer, D. B., Dedon, P. C., Fox, J. G., and Samson, L. D. (2008) DNA damage induced by chronic inflammation contributes to colon carcinogenesis in mice, J Clin Invest 118, 2516-2525. Hendershot, J. M., Wolfe, A. E., and O'Brien, P. J. (2011) Substitution of Active Site Tyrosines with Tryptophan Alters the Free Energy for Nucleotide Flipping by Human Alkyladenine DNA Glycosylase, Biochemistry 50, 1864-1874. Banerjee, A., Santos, W. L., and Verdine, G. L. (2006) Structure of a DNA glycosylase searching for lesions, Science 311, 1153-1157. Otwinowski, Z., and Minor, W. (1997) Processing of X-ray diffraction data collected in oscillation mode, Methods Enzymol 276, 307-326. McCoy, A. J., Grosse-Kunstleve, R. W., Adams, P. D., Winn, M. D., Storoni, L. C., and Read, R. J. (2007) Phaser crystallographic software, J Appl Crystallogr40, 658-674. Brtinger, A. T., Adams, P. D., Clore, G. M., DeLano, W. L., Gros, P., Grosse-Kunstleve, R. W., Jiang, J. S., Kuszewski, J., Nilges, M., Pannu, N. S., Read, R. J., Rice, L. M., Simonson, T., and Warren, G. L. (1998) Crystallography & NMR system: A new software suite for macromolecular structure determination, Acta CrystallogrSect D Biol Crystallogr54, 905-921. Murshudov, G., Vagin, A., and Dodson, E. (1997) Refinement of macromolecular structures by the maximum-likelihood method, Acta CrystallogrSect D Biol Crystallogr53, 240-255. Collaborative Computational Project, N. (1994) The CCP4 suite: programs for protein crystallography, Acta CrystallogrSect D Biol Crystallogr50, 760-763. Kleywegt, G. J., and Jones, T. A. (1998) Databases in protein crystallography, Acta Crystallogr Sect D Biol Crystallogr54, 1119-1131. Emsley, P., and Cowtan, K. (2004) Coot: model-building tools for molecular graphics, Acta CrystallogrSect D Biol Crystallogr60, 2126-2132. Laskowski, R., MacArthur, M., and Moss, D. (1993) PROCHECK: a program to check the stereochemical quality of protein structures, J Appl Crystallogr 26, 283-291. 85 86 Chapter 4. Crystallographic Evidence for Drastic Conformational Changes in the Active Site of a Flavin-Dependent N-hydroxylase A version of this chapter will be submitted for publication using the same title and with the following author list: Jeremy W. Setser, John R. Heemstra Jr.2 , Christopher T. Walsh 2 , and Catherine L. Drennani,4 Departments of 'Chemistry, 3Biology, and the 4Howard Hughes Medical Institute, Massachusetts Institute of Technology, 77 Massachusetts Avenue, Cambridge, MA 02139 USA 2 Department of Biological Chemistry and Molecular Pharmacology, Harvard Medical School, 240 Longwood Avenue, Boston, MA 02115 USA IV.I SUMMARY The soil actinomycete Kutzneria sp. 744 produces a class of highly decorated hexadepsipeptides, which represent a new chemical scaffold that has both antimicrobial and antifungal properties. These natural products, known as kutznerides, are created via nonribosomal peptide synthesis using various derivatized amino acids. The piperazic acid moiety contained in the kutzneride scaffold, which is vital for its antibiotic activity, has been shown to derive from the hydroxylated product of L-ornithine: L-N-hydroxy-ornithine. The production of this hydroxylated species is catalyzed by the action of an FAD- and NAD(P)H-dependent N-hydroxylase known as KtzI. We have been able to structurally characterize KtzI in several states along its catalytic path, and by pairing these snapshots with the biochemical and structural data already available for this enzyme-class, we propose a structurally-based reaction mechanism that includes novel conformational changes of both the protein backbone and the flavin cofactor. Further, we were able recapitulate these conformational changes in the protein crystal, displaying their chemical competence and catalytic relevancy. Our series of structures, with corroborating biochemical and spectroscopic data collected by us and others, affords mechanistic insight into this relatively new class of flavin-dependent hydroxylases, and adds another layer to the complexity of flavoenyzmes. 87 IVII INTRODUCTION Natural products and their derivatives are vital for human health, as they comprise over one-third of all FDA-approved small-molecule drugs (1). Many of these compounds are antibiotics that are biosynthesized by microbes via nonribosomal peptide synthesis (NRPS) pathways (2). NRPS pathways are designed such that various enzymes act in an assembly-line fashion to build up peptide chains using a broad range of both canonical and derivatized amino acids. Even with the chemical diversity present in currently available antibiotics, which is largely generated from the variety of permutations available in NRPS and similar systems, there exists a pressing need for new therapeutic candidates to combat drug-resistant infections (2). Therefore, finding new molecular scaffolds with therapeutic benefit, and elucidating the biosynthetic pathways necessary to construct such compounds, is imperative for human health and well-being. Kutznerides are a recently discovered class of antifungal antimicrobials produced by the soil actinomycete Kutzneria sp. 744 (3, 4). These natural products are highly-decorated, cyclic hexadepsipeptides (Fig. IV.la), which are constructed via NRPS. The gene cluster encoding this NRPS pathway has been elucidated (Fig. IV.lc (5)) and the functions of many of its biosynthetic components have been demonstrated in vitro (5-11). One of these enzymes, KtzI (Fig. IV.lc in red), was originally annotated as a 47-kDa flavin-dependent lysine/ornithine N-monooxygenase (hydroxylase) (5), and this proposed activity was further investigated biochemically (7). KtzI was found to use a non-covalently bound FAD cofactor, reducing equivalents from NADPH or NADH (albeit less efficiently), and molecular oxygen to install a hydroxyl group on the side chain nitrogen of L-ornithine (L-orn), producing L-N 5hydroxy-ornithine (Fig. IV.lb), thus making KtzI a "stand-alone" NRPS enzyme. Binding of substrate analogue L-lysine causes oxidation of the NADPH cofactor, without subsequent production of L-hydroxy-lysine, effectively uncoupling the reaction (7). This specificity for substrate, and the cofactor and cosubstrate usage, is similar to previously characterized flavin N-hydroxylases (12-23). However, KtzI does differ from these other systems in the fate of its hydroxylated product. The hydroxyornithine product of KtzI is ultimately incorporated into the kutzneride scaffold as the N-N bond-containing piperazic acid moiety (7) (Fig. IV. 1), which has been shown to be crucial for the antibiotic activity of these molecules (3). The intramolecular cyclization 88 necessary to reach this final structure, that is the creation of a bond between N2 and N of hydroxyornithine, is likely preceded by some further activation of the hydroxylamine, but no candidate enzymes have yet been established. In any case, the hydroxylation catalyzed by KtzI is not retained in the final piperazic acid product, and thus is known as a 'cryptic' modification. This use of cryptic N-hydroxylation for antibiotic biosynthesis is a departure from the previously characterized members of the N-hydroxylase family. All other lysine and ornithine N-hydroxylases investigated to date have their hydroxy-modifications carried on to the final product, where these moieties are used as ligands in iron-scavenging molecules called siderophores (12-23). This divergence in the overall role of the N-hydroxylating protein has no observable effect on the chemistry involved, however, as these enzymes all catalyze the creation of a primary hydroxylamine product. The L-orn-specific N-monooxygenases, which have been characterized in more detail, also appear to follow a common kinetic mechanism. KtzI shares high sequence homology (33% identity) with the L-orn N-hydroxylases from Pseudomonasaeruginosa(PvdA) and Aspergillusfumigatus(SidA) (Fig. IV.2), which have been characterized in detail both biochemically (7, 15-17, 20, 21, 24-29) and structurally (29, 30). In the biochemical studies, PvdA and SidA were proposed to follow a similar reaction mechanism as outlined in Figure IV.3. Common to most flavin monooxygenases, the oxidized FAD cofactor is reduced by hydride transfer from the C4-pro-R position of the NADPH nicotinamide to the N5 position of the flavin isoalloxazine ring, completing what is known as the reductive half of the reaction (Fig. IV.3, 143). The oxidative half of the reaction begins when molecular oxygen adds to the reduced flavin species, creating the highly reactive C4a-(hydro)peroxy intermediate (Fig. IV.3, 4b and 5). Hydroxylation occurs through nucleophilic attack by the bound substrate (here the side chain amine of L-orn) on the activated flavin-hydroperoxide intermediate, producing both the hydroxylated product and a hydroxy-FAD intermediate (Fig. IV.3, 546). The oxidized flavin species is regenerated through the loss of water, and that with the concomitant dissociation of end products completes the catalytic cycle (Fig. IV.3, 6-1). If the hydroperoxy-flavin intermediate is not sufficiently protected or used improperly, it is lost as the toxic byproduct hydrogen peroxide, thus uncoupling the reductive and oxidative halves of the reaction and wasting the reducing equivalents provided by NADPH (Fig. IV.3, 'uncoupling'). Even though the N-hydroxylases follow this canonical mechanism, they diverge in other specifics and create 89 what is effectively a hybrid between two flavin monooxygenase archetypes known as "cautious" and "bold" monooxygenases. The "cautious" (or Class A) monooxygenases, which are typified by the extensively studied para-hydroxybenzoate hydroxylase (PHBH; reviewed in (31-33)), have a stringent substrate-specificity and also maintain tight regulation over the reductive half of their reaction cycle (Fig. IV.3, 143). In these enzymes, the rate of FAD reduction is intimately linked to substrate binding, such that the presence of the hydroxylatable target greatly enhances the reaction rate, upwards of 10 5-fold for PHBH (34). This control point significantly decreases the risk of uncoupling (Fig. IV.3, 'uncoupling'), as the addition of 02 to reduced flavin, yielding the highly reactive C4a-hydroxperoxy-flavin (Fig. IV.3, 4b, 5), can only occur when the substrate is present to accept its hydroxy-modification. On the other hand, in "bold" (or Class B) monooxygenases, such as those of the Baeyer-Villiger monooxygenase (BVMO) and flavin monooxygenase (FMO) enzyme families, the reduction of FAD by NADPH occurs just as well with or without bound substrate, and thus they must utilize a completely different tactic to protect against uncoupling. In these systems, the spent NADP' cofactor remains bound to the protein throughout the C4a-(hydro)peroxy-flavin reaction cycle, protecting both the reduced- species from being quenched (reviewed in (31, and the 32)). "Bold" monooxygenases also tend to have little substrate specificity, illustrated by the over 200 known compounds that the mammalian FMOs will hydroxylate (35). The N-monooxygenases, although formally grouped with the Class B monooxygenases (32), have been found to carry traits from both classes described above. They have the narrow substrate specificity of the "cautious" enzymes, but show no sign of substrate-assisted reduction of FAD and remain bound to NADP* throughout catalysis (15-17), which are both fundamental characteristics of "bold" monooxygenases. Some structural insight into how catalysis is controlled by these hybrid-monooxygenases has been provided by a series of recent crystal structures (29, 30), which describe how cofactors and substrate are bound in the active site. In this study, we build upon this structural knowledge by characterizing the N-hydroxylase KtzI in never-before-seen states of this enzyme class, including the anaerobically reconstituted, "pre-turnover" complex; and a view of the oxidized enzyme that suggests a drastic conformational change, with a novel flavin movement, takes place. These disparate states were shown to be chemically interchangeable in crystallo, demonstrating the chemical competence of 90 the conformational changes involved, and suggesting that these rearrangements are, in fact, catalytically relevant. By combining our data with all other biochemical and structural data for L-orn N-hydroxylases, we are able to propose a structurally-based reaction mechanism that represents a paradigm shift for a flavin-dependent monooxygenase system. IV.III RESULTS The L-ornithine (L-orn) N-hydroxylase from Kutzneria sp. 744, KtzI, was structurally characterized by X-ray crystallography, yielding over 30 structures under various conditions that provide six unique snapshots of the enzyme (Table IV.1). The initial structure of KtzI was obtained by reconstituting the purified protein with FAD and NADPH in an anaerobic environment, followed by crystallization in NaBr-containing conditions. This structure, and all other structures herein, is abbreviated to signify the molecules to which KtzI is bound and the presumed redox state of its cofactors. Thus, the initial structure of this enzyme is denoted KtzIFADred-NADP'-Br, as it binds reduced FAD as evidenced by its colorless appearance (Fig. IV.4a), oxidized NADP' due to the hydride transfer necessary to create the FADred species, and a bromide ion in the substrate-binding pocket. This structure was determined to 2.4 A resolution by molecular replacement using the protein coordinates from the functional homologue of KtzI from Pseudomonas aeruginosa, PvdA (PDB ID 3S5W (30)). Two additional structures under NaBr-containing conditions were obtained where the enzyme was reconstituted with FAD and NADPH aerobically, and then either kept aerobic throughout (KtzI-FADox-Br; 2.1 A) or re-reduced after crystal growth with sodium dithionite under anaerobic conditions (KtzI-FADoxred-NADP'-Br; 2.6 A). The oxidized flavin cofactor (FADox, yellow) is readily visible in the KtzI-FADox-Br crystals (Fig. IV.4b), confirming the assignment of its redox state. The transition from FADox (yellow; Fig. IV.4b) to FADred (colorless; Fig. IV.4a) (abbreviated FADox-red) was readily apparent in the dithionite-reduced crystals. It is possible this 're-reduced' structure has NADPH instead of NADP' bound to the enzyme, due to the chemical reduction by dithionite, however this cofactor was found to bind in an identical manner to that of its anaerobically reconstituted counterpart, KtzI-FADred-NADP*-Br (as detailed below), and thus we have named it consistently for simplification. It was determined empirically that the 91 NaBr-containing condition occluded substrate binding due to a competing bromide ion, and thus an alternative crystallization precipitant was pursued. The reconstituted enzyme was found to crystallize using a replacement salt in the precipitant (KSCN), which afforded substrate binding, and three additional structures. Two structures were determined where KtzI was reconstituted with FAD, NADPH, and L-orn under anaerobic conditions, and then either kept anaerobic (KtzI-FADred-NADP'-L-orn; 2.2 A;) or allowed to equilibrate with atmospheric oxygen, thus re-oxidizing the originally reduced crystals (KtzI-FADred-ox-NADP -L-orn; 2.7 A). The change from colorless (FADred; Fig. IV.4a) to yellow (FADox; Fig. IV.4c) (abbreviated FADred-ox) was used to inform the assignment of the flavin cofactor's redox state. One final structure was determined by following the same reconstitution protocol above, but under aerobic conditions throughout (KtzI-FADox-NADP+-L-orn; 2.4 A), providing off-yellow crystals (Fig. IV.4c). These oxidized structures are proposed to bind NADP+ due to this cofactor binding in a conformation that would not (and does not) provide reduction of FAD (detailed below). The protein coordinates from the initial refined model of KtzI (KtzI-FADred-NADP'-Br) were used as a search model in MR or for rigid body refinement to solve all subsequent structures. Data processing and refinement statistics can be found in Tables IV.2-IV.7. Quaternarystructure Even though KtzI was crystallized under a wide variety of conditions, it was found to adopt the same homotetrameric assembly in each (Fig. IV.5a). Extensive interfaces exist between each of the protomers such that ~25% of the available surface area is buried by these interactions. These interfaces are conserved in the structures of the KtzI homologues PvdA (30) and SidA (29), and the same tetramer is generated in these structures by crystal symmetry (Fig. IV.6a). The buried surface areas are not quite as extensive for PvdA (17% buried) and SidA (16% buried), largely due to a looser association at one of the interfaces (Fig. IV.6b). Although the secondary structure at this interface is similar in all three homologues, the sequence conservation in this region is relatively poor between KtzI and PvdA/SidA (residues 230-235, 260-270, 325-330 (KtzI numbering) in Fig. IV.2), and the arrangement of residues in KtzI causes a helix to rearrange, yielding a clamping effect (Fig. IV.6b). In particular, the aforementioned helix (residues 260-270 in KtzI) moves ~4-6 92 A closer to its adjacent protomer, which allows a cross-protomer hydrogen bond from Tyr270 to the 2'-phosphate of the NADP cofactor (Fig. IV.6b). Given that this helix movement is exclusive to KtzI, the monomeric units of SidA and PvdA are more related structurally to one another (rmsd ~1.1 A), A), than to our enzyme (rmsd ~1.5 despite the fact that overall sequence conservation between the proteins is not markedly different (37% identity between SidA and PvdA vs. 33% between SidA/PvdA and KtzI). Indeed, the sequence and structural conservation between all three proteins is apparent in the active site. Active site of reduced KtzI The fully-liganded, anaerobic complex of KtzI, KtzI-FADred-NADP'-L-orn, depicts this enzyme in its reduced, "pre-turnover" state (Fig. IV.3, 4a and Figs. IV.5b and IV.5e). The FAD and NADP cofactors are bound in an elongated conformation with the nicotinamide of NADP* stacking on the Re-face of the flavin isoalloxazine ring. The nicotinamide cofactor is not in a position to reduce the flavin, as its reactive C4 carbon is pointed away from the site of reduction (N5 of the isoalloxazine ring). Instead, the carbonyl oxygen of the nicotinamide is oriented toward this N5 position by a conserved glutamate residue (Glu212 in KtzI, Fig. IV.2), allowing the carbonyl oxygen to hydrogen bond with the reduced N5-H group of FADred (Fig. IV.5b). The flavin isoalloxazine ring is sandwiched between His51 and NADP', and is found to adopt its bent or "butterfly" conformation (Fig. IV.5b and Fig. IV.7). There is evidence from structural (36) and computational (37, 38) studies that this bend signals the fully reduced state of the cofactor, which would be appropriate in this NADPH-reduced, anaerobic context. However, we find bent isoalloxazine rings in all the structures presented herein, including those from formally oxidized species where the flavin is surrounded by a completely different protein environment (described in detail below), and thus believe it is unlikely that this phenomenon is chemically- or environmentally-induced alone. It has been established for the flavin-containing reductase NrdI that interaction with the photoelectrons produced during X-ray exposure can reduce the flavin isoalloxazine ring, generating the bent conformation of the cofactor (39), and we propose that this is likely to be a contributing factor in our structures, especially those from oxidized preparations. The amino acid substrate L-orn is specifically recognized in the active site by hydrogen bonds to its carboxy and amino moieties, as well as to its sidechain amine (N5 ), by conserved lysine, serine, and asparagine residues (Lys67, Asn245, Asn275, and Ser406 in KtzI; Fig. IV.5b 93 and Fig. IV.2). The carbonyl of Asn275 further hydrogen bonds with the 3'-OH of the nicotinamide ribose of NADP* (Fig. IV.5b). The positioning of L-orn is such that the site of hydroxylation (N5) is aligned with the C4a position of the isoalloxazine at a distance (5.9 A) that would be amenable for catalysis after the addition of oxygen and subsequent creation of the reactive C4a-hydroperoxy intermediate (Fig. IV.3, 5 and Fig. IV.5b, red dashed line). This highly reactive center must be protected from bulk solvent, and this role is filled on one side of the active site by the NADP' cofactor and a protein loop containing Asn275, Tyr276, and Ser277 ('Tyr-loop'; Fig. IV.5e) and on the other by a neighboring protomer (Fig. IV.5b and Fig. IV.6c, colored in wheat). Removal of these contacts on either side would result in an open active site (Fig. IV.5e and Figs. IV.6c and IV.6d). The reduced, pre-turnover state of KtzI was also crystallized wherein the substrate, L-om, is replaced by a bromide ion from the precipitant solution (>1.0 M NaBr), and this structure is denoted as KtzI-FADred-NADP'-Br (Fig. IV.8a). Even when reconstituted with a high concentration of L-orn (31.8 mM), the bromide ion remained bound in the active site, and bromides were found to occupy other sites all over the protein. However, these ions have no real effect on the protein fold (rmsd = 0.3 A vs. KtzI-FADred-NADP'-L-orn), nor on the arrangement of cofactors and crucial active site residues (Fig. IV.8a vs. Fig. IV.5b). Further, the reduced active sites of all the structurally characterized L-orn N-hydroxylases, save some minimal fluctuations, are found to adopt identical conformations (PvdA: Fig. IV.8b (30)) and SidA: Fig. IV.8c (29)) where the protective role served by: NADP', the Tyr-loop (Tyr285 in PvdA and Tyr324 in SidA), and an adjacent protomer (Fig. IV.6), are all conserved. Active site of oxidized KtzI As mentioned above, KtzI was found to adopt the same homotetrameric assembly in each structure, with minimal deviations between the respective states (rmsd = 0.1-0.3 A). However, one structure of this enzyme, that is where it was reconstituted aerobically with FAD and NADPH and then crystallized in NaBr-containing conditions (denoted KtzI-FADox-Br), is most different from the others with an rmsd of ~0.6 A. This divergence is concentrated in the active site where a drastic structural rearrangement has taken place. In this state, NADP* has vacated the active site, Arg104 has swung in to hydrogen bond with Glu212, the isoalloxazine ring of FAD has 'flapped' completely across the active site, and the Tyr-loop has inserted into the active 94 site interior, where Tyr276 stacks with the new conformation of the flavin ring (Figs. IV.5c and IV.5f). The absence of bound NADP(H) is quite surprising as a large excess (20-fold vs. protein) of NADPH was used during reconstitution. The conformational change from FADred to FADox in KtzI shifts the isoalloxazine ring 6.5 A (N5-N5) and rotates the angle between the flavin ring and its ribityl tail by ~1370 (Fig. IV.5h), which is quite different from the change observed for the prototypic Class A flavin hydroxylase, para-hydroxybenzoate hydroxylase (PHBH) (Fig. IV.5i). The insertion of the Tyr-loop into the active site moves the Ca carbon of Tyr276 4.0 A, such that this residue is now sandwiching the isoalloxazine ring with the help of His51, which has rotated slightly to remain parallel with the flavin cofactor (Fig. IV.5c). The absence of NADP' and L-orn has caused other conserved residues: Asn245, Asn275, Ser277, and Ser406, to adopt new conformations with their sidechains pointed away from the active site (Figs. IV.5c and IV.5f). These drastic rearrangements greatly alter the effective surface of the protein active site, such that the isoalloxazine moiety is now open to solvent (Fig. IV.5f). Aside from this active site reorganization, the rest of the protein topology remains largely the same (rmsd ~0.6 A), with most residues adopting identical conformations. KtzI was also reconstituted aerobically with FAD, NADPH, and L-orn, and crystallized under KSCN-containing conditions, which yielded yet another independent snapshot of this state of the enzyme. Following the same aerobic reconstitution that produced the KtzI-FADox-Br structure, but with the addition of L-orn and the use of KSCN in place of NaBr, an amalgamation of the fully-liganded, anaerobic complex (KtzI-FADred-NADP'-L-orn) and KtzI-FADox-Br was produced. This structure, denoted as KtzI-FADox-NADP*-L-orn (Figs. IV.5d and IV.5g), is similar to the fully-liganded, anaerobic complex, in that it has FAD, NADP', and L-orn bound to the protein and the active site residues adopt the same conformation as in the pre-turnover complex (Fig. IV.5d vs. Fig. IV.5b). However, the bound flavin adopts the 'flapped', FADox-conformation observed in KtzI-FADox-Br (Fig. IV.5d vs. Fig. IV.5c). This arrangement appears as if the flavin of fully-liganded anaerobic structure was simply replaced with that of the flapped, oxidized conformation, such that the NADP' moiety now stacks with the Si-face of the isoalloxazine ring (Figs. IV.5d and IV.5g). Both snapshots of the oxidized KtzI enzyme propose a completely novel conformational change for a protein-bound flavin molecule, however, these structures are also quite different from one another (Fig. IV.5c vs. Fig. IV.5d). This dissimilarity was quite surprising as the 95 method employed to crystallize these structures was identical aside from the salt used in the precipitant (NaBr vs. KSCN) and a relatively modest pH change (7.5 vs. 8.5). This unanticipated discrepancy, combined with the lack of precedence for either depiction, concerned us that some crystallization artifact may have trapped non-relevant or dead-end states. In an effort to understand the chemical relevancy of these respective states, manipulations were employed to observe whether the supposed conformational changes could be recapitulated in the protein crystal. In crystallo conformational changes In KtzI-FADox-Br, the 'flapped-flavin' state is accompanied by the departure of NADP' and the insertion of a protein loop, resulting in the isoalloxazine ring being exposed to solvent. Bromide ions, including the substrate-occluding ion observed in KtzI-FADred-NADP*-Br, are also present in the active site of KtzI-FADox-Br (Fig. IV.9a), raising questions about how these ions may affect, or possibly cause, this unusual structure. In an effort to establish the chemical relevancy of this state, crystals were grown as usual and then subjected to chemical reduction by NADPH and sodium dithionite under anaerobic conditions. The crystals showed a definitive color change from yellow (oxidized flavin; Fig. IV.4b) to colorless (reduced flavin; Fig. IV.4a) when either reductant was used, but structural characterization could only be carried out on the sodium dithionite-reduced crystals. This limitation was due to the fact that a longer incubation period (30 min) was required to fully reduce crystals with NADPH as compared to sodium dithionite (<10 sec), and this longer time frame left the crystal too deteriorated for useful data collection. Amazingly, soaking the oxidized, KtzI-FADox-Br crystals with sodium dithionite under anaerobic conditions provided a structure, denoted as KtzI-FADox-red-NADP*-Br, which is identical (rmsd = (KtzI-FADred-NADP'-Br) 0.15 A) to its anaerobically reconstituted (Fig. IV.8d vs. Fig. IV.8a). This finding counterpart means that the conformational changes necessary to turn KtzI-FADox-Br into its reduced, and NADP-bound species, that is the 'flapping' of its isoalloxazine ring across the active site with concomitant evacuation of the Tyr-loop and re-binding of the NADP' cofactor, were all able to occur in the crystal. 96 In KtzI-FADox-NADP*-L-orn, the flapped, FADox conformation is observed such that the isoalloxazine faces the protein exterior, but NADP', L-orn, and all active site residues appear as in the fully-liganded anaerobic complex, creating the effect of an NADP cofactor slipping behind the flapped-flavin conformation (Figs. IV.5d and IV.5g). Attempts to reduce these crystals, even upon long incubations with NADPH or dithionite, proved futile as no color-change was observed. However, we examined whether the opposite chemical transformation could occur in the crystal, that is from the fully-reduced, anaerobic species (Fig. IV.5b) to its oxidized counterpart (Fig. IV.5d) through the addition of oxygen. Crystals of the KtzI-FADred-NADP+-L-orn complex were grown anaerobically and then equilibrated aerobically, allowing the flavin cofactor to oxidize. This re-oxidized structure (denoted KtzI-FADred-ox-NADP*-L-orn), is identical (rmsd = 0.13 A) to that of the aerobically grown, KtzI-FADox-NADP+-L-orn state (Fig. IV.9b vs. Fig. IV.5d). Excitingly, this observation means that upon the addition of oxygen to the fully-liganded, anaerobic complex (Fig. IV.5b), the FAD isoalloxazine was able to travel across the active site from its FADred state to arrive at the FADox position observed in the aerobically reconstituted KtzI structures (Figs. IV.5d, IV.5g, and IV.5h), all while contained in the crystal lattice. Clashing of the FAD and NADP cofactors would likely occur in any FADred to FADox conformational change in KtzI, and thus the nicotinamide cofactor would be expected to depart during this re-oxidation process, signaling that more dynamic changes take place in between the equilibrium states that we have observed crystallographically. IV.IV DISCUSSION The flavin-dependent N-hydroxylases are a class of enzymes that have been studied almost exclusively in the context of their role in generating iron-chelating siderophores (12-23). The L-orn-specific N-monooxygenase from Kutzneria sp. 744 (KtzI) does not follow this trend, however, as it instead provides a building block for the biosynthesis of a new class of antifungal antimicrobials called kutznerides (7) (Fig. IV.1a). Regardless of their overarching role, the N-hydroxylases all catalyze the same reaction; using FAD, NAD(P)H, and molecular oxygen to attach a hydroxyl group on the primary-amino side chain of their substrate (Fig. IV.lb). Further, the L-orn N-hydroxylases from Pseudomonas aeruginosa (PvdA) and Aspergillus fumigatus 97 (SidA), which share high sequence homology with KtzI (Fig. IV.2), have been observed to follow a common kinetic mechanism (15-17) (Fig. IV.3). Preliminary structural interpretation of this kinetic mechanism has been made possible by recent crystal structures of PvdA (30) and SidA (29). Here, we add to the structural reaction coordinate by providing novel depictions of this enzyme class, showing KtzI in its anaerobically-reduced, fully-liganded, "pre-turnover" state, and in two oxidized states that suggest a series of conformational changes occur. These proposed rearrangements were shown to be chemically competent in crystallo, indicating that they are an important part of the catalytic cycle for KtzI, and more generally the N-hydroxylase family of enzymes. The anaerobically-reduced KtzI-FADred-NADP'-L-orn structure (Figs. IV.5b and IV.5e), and an accompanying depiction where a bromide ion from crystallization has displaced the substrate (KtzI-FADred-NADP*-Br; Fig. IV.8a), are very similar to the aerobically-reduced depictions of PvdA (30) (Fig. IV.8b) and SidA (29) (Fig. IV.8c). This similarity indicates that reconstituting the enzyme in the absence of oxygen, as was done for KtzI, can be approximated by chemical reduction of the aerobic state, and thus these structures can all be taken together as independent validations of the pre-turnover state of this enzyme family. In this state, NADPH has already transferred its hydride to the FAD moiety (Fig. IV.3, 2->3), such that FADred, NADP*, and the L-orn substrate (or competing bromide ion) are bound in the active site. This redox assignment can be confirmed by the bleached appearance of these crystals (Fig. IV.4a), and the fact that the reactive C4 position of the nicotinamide moiety is pointed away from the site of reduction (N5 of FAD; Fig. IV.5b), and thus is not positioned for hydride transfer. A conserved glutamate residue (Glu212 in KtzI; Fig IV.2) instead poses the nicotinamide such that its carbonyl oxygen can hydrogen bond with the newly-formed N5-H of reduced flavin (Fig. IV.5b). The bound NADP' also makes up a large portion of the protein surface (Fig. IV.5e), effectively sealing the active site with its presence. Therefore, in addition to its role in flavin reduction, this cofactor acts to shield the FADred and FAD-OO(H) intermediates (Fig. IV.3, 3-5) from bulk solvent, protecting these species from being quenched. Indeed, there is kinetic evidence from PvdA (30) and SidA (15, 16) that NADP* remains bound throughout the reaction cycle to perform this role. This protective function is further exemplified by the observation that chemical reduction of SidA, followed by exposure to oxygen in the absence of NADP*, resulted in immediate uncoupling through H20 98 2 production (15) (Fig. IV.3, 'uncoupling'), whereas the reactive C4a-(hydro)peroxy intermediate is stabilized (in the absence of its hydroxylatable target) by NADP' on the order of minutes in both SidA (15, 16) and PvdA (17). There is evidence from kinetic isotope effects and computational studies that suggest the 2'-OH of the ribose of NADP* may be directly responsible for stabilizing the flavin-peroxide intermediate, and further, may act as the proton donor for creation of the C4a-hydroperoxy derivative (26). Taking all these studies together, it is readily apparent that the nicotinamide cofactor is crucial to the entirety of the reaction cycle, well beyond its initial task of reducing the flavin moiety, and this multi-faceted involvement is, indeed, a hallmark of the Class B monooxygenase family (32). In the N-hydroxylases, the protein scaffold acts as an additional barrier to quenching species. As was mentioned for the structure of PvdA (30), if one considers the monomeric unit of an N-hydroxylase, the active site is excluded from solvent by both NADP* (Fig. IV.5e) and the bound substrate (Fig. IV.6d), which would be incongruent with the observation of a stabilized flavin-hydroperoxide in the absence of L-om, as described above. Although the protein backbone provides protection in the form of the conserved Tyr-loop (Fig. IV.5e), departure of NADP' or L-orn would open the monomeric active site to solvent. This concern is alleviated, however, by thinking of the protein in terms of the tetrameric assembly observed crystallographically (Fig. IV.5a and Fig. IV.6a). The interfaces of this tetramer are quite extensive in all three homologues, burying 16-25% of the available surface area, and one of these interfaces guards the active site with its interaction (Fig. IV.5b, wheat-colored protomer and Fig. IV.6c). A tetramer is also consistent with gel filtration chromatography data collected on SidA and PvdA (16, 21), alluding to this species' relevance in solution. Therefore, it can be reasoned that the N-hydroxylase tetramer is formed for the protection of reactive intermediates, and thus is vital for catalysis. These enzymes, like those of the "cautious" monooxygenase family, also manage catalytic specificity for their L-orn substrate, and this task is accomplished using a highly organized active site. L-om is secured in the binding pocket by hydrogen-bonds made from conserved residues to all of its polar groups (Fig. IV.5b and Fig. IV.2), highlighting an environment designed to bind this amino acid. As was shown in crystal structures of SidA, however, this site is also able to accommodate L-lys and L-arg in a highly-similar binding mode (29). There is some evidence that SidA can hydroxylate L-lyS to a certain degree (29), but studies have mostly found L-orn N-hydroxylases to be highly specific for L-orn (7, 16, 20, 21, 24), and thus it is somewhat 99 surprising to find non-substrates binding in the active site. This discordance seems to indicate that although different L-amino acids can bind similarly to L-orn, hydroxylation is controlled by the angle and proximity of the amine group to the flavin-hydroperoxide, such that L-orn presents the only species in prime position for catalysis. The inability of the L-orn N-monooxygenases to hydroxyate L-lys effectively, with the large amount of uncoupling observed in the presence of this amino acid, indicates that the extra methlyene unit of this molecule extends its amine side chain too far into the active site for hydroxylation to occur, but resembles L-orn enough to trigger oxidative uncoupling (Fig. IV.3, 'uncoupling'). Further insight into the oxidative half of the reaction was provided by aerobic structures of KtzI. When KtzI was reconstituted under aerobic conditions, and then crystallized using two different precipitants, the result was two very distinct crystal structures (Figs. IV.5c and IV.5f vs. Figs. IV.5d and IV.5g). Both states share an unprecedented flavin conformation, which we will now refer to as the FADox(out) conformation, that is entirely different from the FADred 'in' state. This 'out' conformation shifts the isoalloaxazine moiety completely across the active site, such that it is now open to solvent (Figs. IV.5f and IV.5g). Aside from this similarity, the aerobic structures are largely divergent: In KtzI-FADox-Br, the new flavin conformation is accompanied by the dissociation of NADP', and the movement of conserved active site residues including insertion of a 'Tyr-loop' (Asn275, Tyr276, Ser277) and swinging of Arg104 such that it takes the place of NADP' by hydrogen bonding with Glu212 (Fig. IV.5c vs. Fig. IV.5b). In KtzI-FADox-NADP'-L-orn, the 'flapped' flavin resides in an active site that is largely unchanged compared to the pre-turnover complex, with NADP', L-orn, and protein residues all adopting similar conformations (Fig. IV.5d vs. Fig. IV.5b). This discrepancy led us to examine the methods used to attain these two structures. The most influential differences between the preparations of these dissimilar states include the presence (KtzI-FADox-NADP*-L-orn) or absence (KtzI-FADox-Br) of substrate during reconstitution, and the salt used in the precipitant solution (KSCN vs. NaBr). Crystallization experiments using NaBr-containing conditions were performed with the same reconstitution protocol used for the substrate-bound, KSCN-crystallized structures (i.e. with 31.8 mM L-om), but a competing bromide ion continually abrogated substrate binding (Fig. IV.9a), likely due to its vast excess (-1 M vs. 31.8 mM). This lack of a direct comparison makes it difficult to assess whether the presence or absence of substrate vs. bromide ions drives the 100 difference between these states. It is tempting to attribute the overarching difference between these two snapshots to the presence or absence of a bound NADP', however, a structure of SidA in the presence of FAD and L-orn (without NADP') adopted a similar conformation to the reduced structures (Fig. IV.10, A (right) (29) vs. Fig. IV.5b), signaling that NADP' binding is not the sole determining factor. Although the hydrogen bond switch from Glu2l2-NADP* (Fig. IV.5b) to Glu2l2-ArglO4 (Fig. IV.5c) observed in KtzI, was also observed in the crystal structures of reduced vs. oxidized states of SidA (Fig. IV.8c vs. Fig. IV.10, A (right)), no precedence exists for the flavin conformational change suggested by our structures. Further, as crystallographic characterization occurs on equilibrium states, our aerobic structures are likely the end-product of some other intermediate state(s). Therefore, we felt it necessary to confirm the chemical relevance of our structural snapshots through in crystallo characterization of KtzI. KtzI-FADox-Br and KtzI-FADox-NADP'-L-orn crystals were subjected to anaerobic reduction by NADPH (25 mM) and sodium dithionite (50 mM). In each case, reduction could be monitored by eye as a color change from yellow (Fig. IV.4b) to clear (Fig. IV.4a), and this change was only observed for KtzI-FADox-Br crystals. The KtzI-FADox-Br state (Figs. IV.5c and IV.5f) was returned completely to its pre-turnover state by anaerobic reduction in crystallo (Fig. IV.8d vs. IV.8a; rmsd = 0.15 A). This transformation displays the chemical competence of this conformational change, and as reduction was elicited using both sodium dithionite and the physiologically-relevant NADPH cofactor, provides evidence for the catalytic relevancy of this dynamic motion. Indeed, sodium dithionite could be acting as a conduit for NADPH reduction of FADox, as its reduction potential (-0.66 V) allows it to either reduce the leftover NADP' in the crystallization drop (which then goes on to reduce FADox), or to reduce FADox directly. In any case, the recapitulation of the reduced, pre-turnover state from this oxidized state using chemical means provides compelling evidence for its general relevance. Further evidence for dynamic motions being required for KtzI catalysis comes from the in crystallo re-oxidation of the fully-liganded, anaerobic state. KtzI-FADred-NADP'-L-orn crystals (Figs. IV.5b and IV.5e) equilibrated in atmospheric oxygen fully recapitulated the structure of their aerobically reconstituted counterpart (Fig. IV.9b vs. Fig. IV.5d; rmsd = 0.13 A). This structure, which is named KtzI-FADred-ox-NADP'-L-orn, began as an aerobic protein solution, was anaerobically reduced by NADPH and crystallized anaerobically, before finally being re-oxidized. The enzyme has undergone multiple 101 transformations during this process, and the snapshots we see are the end-products of these dynamic motions. Indeed, by comparing the structures before (Fig. IV.5b) and after (Fig. IV.9b) oxygen exposure, it becomes apparent that any movement of the flavin moiety to get from the FADred to FADox(out) conformation would be sterically occluded by the bound NADP'. This observation is compelling evidence for the existence of intermediate states as for these flavin motions to occur, dissocation, and then reassociation, of NADP* would be required, which we are unable to observe directly. Further, the L-orn bound in this structure is certainly not the same as the L-orn bound initially, which would be expected to have been hydroxylated upon exposure of the fully-loaded, pre-turnover enzyme to 02, but instead represents another molecule that has re-bound sometime during the re-oxidation process. Given that this re-oxidized structure and its aerobically reconstituted counterpart (Fig. IV.9b vs. Fig. IV.5d) are identical (rmsd = 0.13 A), this same logic can be used to explain both of their unobserved intermediate states. Whether these conformational changes between equilibrium states occur multiple times is unable to be discerned from our studies; however, we believe our data make it clear that they must occur at least once. Taken together, these observations lead directly to the question: why do these conformational changes occur? A conformational change in a flavin-dependent hydroxylase is not a new observation. Indeed, "cautious" monooxygenases control faithful coupling of NADPH reduction to substrate hydroxylation by movements of their flavin moiety (reviewed in (31, 32)). As mentioned previously, "cautious" (or Class A) monooxygenases get their name from the fact that in these enzymes, NADPH will reduce FAD only when substrate is bound, thus limiting oxidative uncoupling (Fig. IV.3, 'uncoupling'). The structural basis for this phenomenon was first proposed for para-hydroxybenzoate hydroxylase (PHBH) (40), where substrate-coupled reduction is controlled by a planar, hinge-like movement of the FAD isoalloxazine ring from the protein interior ('in') to the protein exterior ('out') upon substrate binding (Fig. IV.5i), which allows NADPH access to reduce FADox. Once reduction occurs, the flavin moves from this 'out' position back 'in' to protect its reduced N5-H from solvent. Although this precedence exists for "cautious" enzymes, KtzI is the first Class B monooxygenase proposed to use flavin conformational changes during catalysis, and these movements are even more drastic than those of the Class A systems (Fig. IV.5h vs. Fig. IV.5i). 102 We know the conformational changes observed for KtzI are not correlated in the same way as "cautious" enzymes, as L-orn N-hydroxylases, like "bold" monooxygenases, can just as easily be reduced in the absence of substrate. Further, oxidized SidA and PvdA crystals (whose structures resemble those seen for the reduced KtzI states) were reduced in crystallo without any indication of a conformational change (29, 30), so flavin movement may not be strictly required for the reduction step. To formulate the mechanistic implications of these conformational changes, it is more pertinent to consider another trait N-hydroxylases share with "bold" monooxygenases, that is, NADP' remains bound throughout the reaction cycle, and thus, only dissociates after hydroxylation occurs. This observation means that there must be some signal for NADP' to dissociate, such that another round of catalysis can occur. By combining our snapshots of KtzI, with those of PvdA and SidA, we believe a structural reaction coordinate for Nhydroxylase enzymes (summarized in Fig. IV.l0) can be built that utilizes conformational changes to control catalysis, which may provide further insight into the "bold" monooxygenase family in general. L-orn N-hydroxylases in their resting, oxidized flavin state, could exist in an equilibrium between the FADox(out) conformation observed in KtzI-FADox-Br (with or without insertion of the conserved Tyr-loop), and the FADox(in) of SidA-FADox-L-orn (Fig. IV.10, A). It may be difficult to distinguish these two states spectroscopically, as the Tyr276-stacked, FADox(out) conformation in our crystals of KtzI-FADox-Br (Fig. IV.10, A (left)) still retain the deep yellow color of oxidized flavin (Fig. IV.4b), indicating that the signal is not significantly quenched or altered. In contrast, the flavin signal does appear to be altered by NADP' stacking on the FADox(out) conformation, as crystals of KtzI-FADox(out)-NADP'-L-orn (Fig. IV.10, E) take on an off-yellow appearance (Fig. IV.4c). In any case, we have been able to show that our KtzI-FADox-Br state can be transformed into its reduced counterpart, KtzI-FADred-NADP*-Br (Fig. IV.10, B), by in crystallo reduction with NADPH, displaying the chemical competence of the FADox(out)-Tyr-loop-inserted conformation. Therefore, it cannot be confirmed whether either (or both) state(s) are physiologically relevant for NADPH reduction. A so-called 'sliding mechanism' for NADPH reduction has been suggested for the Baeyer-Villiger monooxygenase (BVMO) class of "bold" monooxygenases, wherein the nicotinamide adopts different conformations during and after reduction. This proposal is largely based on the observation of varied binding modes of this cofactor in crystal structures (41, 42), and the indication from 103 kinetic studies that the reduction process happens in two phases, one of which is consistent with an equilibration step for NADPH in the binding pocket (43). The sliding mechanism has also been proposed for SidA (25), as biphasic reduction kinetics have been observed for both PvdA (17) and SidA (15, 27), and there is evidence from a mutant of SidA (Ser257Ala) that destabilizing a hydrogen-bonding interaction to the pyrophosphate of NADP', actually increases the reduction rate, suggesting that a more dynamic nicotinamide ring is favorable for this step (25). Although our data do not provide further information on this sliding mechanism directly, the FADox(out) conformation we observe, and have shown to be chemically competent, adds an extra layer to consider when thinking about the reduction step. Indeed, the FADox(out) conformation may be a contributing factor to the complicated kinetics of reduction observed for these enzymes. We are able to use structural information to comment more directly on the equilibrium state following this transient reduction step. After FAD reduction and NADP* binding, conserved residues have been observed to rearrange in both KtzI (Fig. IV.10, A4B) and SidA (Fig. IV.10, A (right) vs. Fig. IV.8c), such that Arg104 (Arg144) swings out of the NADP' binding, allowing Glu212 (Glu260) to hydrogen bond to the carboxamide of NADP', orienting this cofactor to protect the N5-H of FADred. Binding of L-orn to the pre-turnover, anaerobic state causes only minor rearrangements of substrate-binding residues (Lys67, Asn245, Ser406), as our structures with bromide or substrate bound in this site are fairly identical (rmsd = 0.3 A), and those of SidA without substrate bound look largely similar (29). The addition of molecular oxygen to this pre-turnover state, whether or not substrate is bound, creates the reactive hydroperoxy-flavin (Fig. IV.3, 4b/5). This transformation is also unlikely to cause any structural deviations, as the binding affinity for L-orn has been shown to be similar in the reduced- vs. hydroperoxide-flavin forms of SidA (15), and NADP' remains bound to both states (15-17), suggesting a similar active site architecture. Once the hydroxyl group is picked up by L-orn, however, the enzyme must be recycled to its resting-state in some way. The hydroxylation step immediately precedes the departure of NADP' in biochemical studies (15, 16, 30), and the structural transmission of this signal may be exemplified by the post-turnover structure of PvdA (PvdA-FADox-NADP'-L-N 5OH-orn; Fig. IV.10, D). In this structure, aerobic reconstitution of PvdA with FAD, NADPH, and L-orn (turnover conditions), followed by crystallization, trapped the product complex in the crystal. The electron density for 104 the nicotinamide of NADP' is disordered in this state, such that this cofactor could not be modeled effectively, indicating this moiety is dynamic in the product-bound state (30). We propose that the act of taking L-orn (Fig. IV.10, C (inset)) to L-N 5OH-orn (Fig. IV.10, 1 'hydroxylation') causes a steric clash with NADP', which propagates to destabilize this cofactor (Fig. IV.10, 2 'destabilization'). The destabilization of NADP' was not enough, however, to actually dissociate this spent cofactor, as it remains bound in this structure (Fig. IV.10, D). This lack of a clear departure signal allows us to propose that for NADP' to leave, the flavin conformational change from the FADox(in) to FADox(out) state that we observe for KtzI, is used to eject the oxidized nicotinamide cofactor in the last step of catalysis (Fig. IV.10, 3 'ejection'). During an interpolation between these two conformations, NADP' and FAD would clash directly, and thus, FAD could act as a steric battering ram to eject NADP' from the active site. This would not be the first time that a flavin has been proposed to act in a steric capacity, as we recently proposed from structural and biochemical studies on the FAD-dependent hydroxylase StaC, that this Class A enzyme uses the 'in' movement of its flavin moiety to sterically-induce decarboxylation of its substrate molecule (44). As mentioned above, NADP' ejection has been linked to the last step in the catalytic cycle of both PvdA (30) and SidA (15, 16) by pre-steady state kinetic studies, and the difficulty in deconvoluting the spectra for this oxidative process in SidA (15), hints that something more complex than mere dissociation of NADP' may occur. Therefore, with all the evidence presented for KtzI, a case has been made for the 'flapping' of the flavin moiety to be an integral part of the catalytic cycle. Further evidence for the relevance of the Tyr-loop and flavin conformational changes is provided by in crystallo studies of the KtzI-FADox-NADP'-L-orn state. The flavin moiety in the FADox(out)-NADP' bound conformation (Fig. IV.10, E) was unable to be reduced by sodium dithionite or NADPH, indicating that the binding of NADP* behind the FADox(out) conformation inhibits this reduction step (Fig. IV.10, E+C). Indeed, reduction of the flavin, without subsequent movement inside the protein, would only be transient in nature as it is completely solvent exposed (Fig. IV.5g). This observation allows us to propose that NADP' is inhibiting reduction by blocking the conformational change from FADox(out) to the 'in' position of FADred (Fig. IV.10, E+C). Further, insertion of the Tyr-loop, as seen for the KtzI-FADox-Br (Fig. IV.10, A (left)), could function to disfavor re-binding of NADP', guarding against this dead-end, inhibited state. As mentioned above, we were able to take 105 crystals of KtzI-FADox-Br back to the pre-turnover state by anaerobic reduction, signaling the chemical competence of this state (Fig. IV.10, A4B), thus making it a good option to disfavor inhibition by NADP'. The dead-end, FADox(out)-NADP' bound state (Fig. IV.10, E), was completely recapitulated by exposure of the pre-turnover, anaerobic state to oxygen (Fig. IV.10, C+E). This oxygen-dependent conformational change of the flavin from its 'in' to 'out' position in crystallo, provides good evidence for the catalytic relevance of this movement, and confirms that the motions necessary to carry out our proposal for the physical ejection of NADP' by FAD are highly plausible. We have observed drastic differences in the active site of a flavin-dependent N-hydroxylase through a series of crystallographic snapshots. Many of these states, which were observed for the first time in our study, were shown to be interchangeable in crystallo, signaling both their chemical competence, and relevance towards understanding the catalytic mechanism of N-hydroxylases. The conformational dynamics during catalysis proposed herein, represent a new way of thinking about flavin-dependent enzymes, and considering the similarities between N-hydroxylases and the other members of the Class B monooxygenases, some of these dynamic motions could be more broadly applicable across the class. This applicability is especially true when considering the 'ejection' of the spent NADP' cofactor, as a hallmark of Class B enzymes is both their ability to stabilize intermediate states using this cofactor, and the necessity for its dissociation before another round of catalysis can occur. We hope that our structural observations will provide a new lense for further biochemical examination of these interesting flavoenzymes. IV.V MATERIALS AND METHODS Protein expression andpurification The ktzl gene was cloned into a pET28a vector (Novagen) and the resulting N-terminal hexahistidine construct was transformed into BL21(DE3) cells (Invitrogen) as described previously (7). For protein overproduction, Luria-Bertani medium (LB) (100 mL supplemented with 50 Rg/mL kanamycin) was inoculated using a glycerol stock of the expression strain and grown overnight at 30*C and 200 RPM. Four l-L cultures of LB containing 50 [tg/mL kanamycin were each inoculated with 20 mL of the overnight culture and incubated at 25*C and 200 RPM until the OD,00=0.5-0.6, at which point protein expression was induced by the addition 106 of 100 gM IPTG. The cells were grown for 16 hr post-induction at 15*C and 200 RPM and harvested by centrifugation (6000 x g for 10 min). Cells were resuspended in lysis buffer (25 mM Tris-HCl pH 8.0, 500 mM NaCl) and lysed by sonication. The lysate was clarified by centrifugation (75,000 x g for 35 min) and incubated with 5 mL of Ni-NTA slurry that had been pre-equilibrated in lysis buffer. This mixture was agitated at 4*C for 1 hr before being loaded into a column for purification. The resin was washed with lysis buffer supplemented with 0 mM (60 mL), 5 mM (60 mL), and 25 mM (60 mL) imidazole. KtzI was eluted with lysis buffer containing 200 mM (10 mL) and 500 mM (5 mL) imidazole and the resulting eluate was concentrated to -1 mL in a 10K MWCO filter (Millipore) by centrifugation (4500 x g for 10 min intervals). The concentrated sample was dialyzed against protein storage buffer (20 mM TrisHCl pH 8.0, 80 mM NaCl, 10% (v/v) glycerol) in a 10K MWCO dialysis cassette (Thermo Scientific) over a period of 16 hr with three buffer exchanges. The dialyzed protein solution (-20 mg/mL by UV absorption at 280 nm; E-cai = 48485 M-'cm-') was flash frozen in liquid nitrogen in 15 pL aliquots and stored at -80*C. The final KtzI protein construct has 21 non-native amino acids (including the hexahistidine tag) at its N-terminus, followed by the wild-type sequence beginning with a valine residue at position 3 (Val3) (Fig. IV.2). Reconstitution of KtzI for crystallization KtzI (10 mg/mL or -212 VM) was reconstituted with FAD (212 pM) and NADPH (4.24 mM) for all crystallization trials. To obtain substrate-bound structures, L-ornithine (31.8 mM) was added to this mixture. FAD, NADPH, and L-ornithine (all from Sigma-Aldrich) were diluted such that the final buffer composition of the reconstituted sample prior to crystallization was 20 mM Tris-HCl pH 8.0, 80 mM NaCl, and 5% (v/v) glycerol. For anaerobic reconstitution, frozen tubes of KtzI protein and aliquots of FAD, NADPH, and L-ornithine powder were degassed and brought into an anaerobic chamber (95% Argon, 5% Hydrogen; COY Laboratory Products, Inc.) prior to dilution with anaerobic buffer. All solutions for anaerobic manipulations had argon bubbled through them to remove oxygen. The final reconstituted samples were incubated in a cold block (-4*C) for 1 hr before crystallization. Under anaerobic conditions, the characteristic color change from oxidized (FADox, yellow) to reduced (FADred, colorless) flavin could be observed in the sample, indicating hydride transfer from NADPH to FAD had occurred. 107 Crystallizationof KtzI Initial crystallization conditions were found using the Phoenix Liquid Handling System (Art Robbins Instruments) to mix 150 nL of reconstituted protein with 150 nL of precipitant in a 96-well, sitting-drop INTELLI-PLATE@ (Art Robbins Instruments) format. Crystals of reconstituted KtzI were optimized using the hanging-drop vapor diffusion method at room temperature by mixing 1 pL of reconstituted protein (containing 212 PM N-His6 tagged protein, 212 pM FAD, 4.24 mM NADPH, (31.8 mM L-ornithine for substrate-bound structures), 20 mM Tris-HCl pH 8.0, 80 mM NaCl, and 5% (v/v) glycerol) with 1 pL of precipitant over a reservoir of 0.5 mL of precipitant. KtzI crystallized with two precipitants: one of which afforded substrate binding (0.4-0.7 M (aerobic) or 0.9-1.15 M (anaerobic) KSCN, 22-25% PEG 3350, 0.1 M Bis-tris propane pH 8.5), while the other precluded substrate-binding due to a competing bromide ion (0.9-1.2 M (aerobic) 1.2-1.4 M (anaerobic) NaBr, 22-25% PEG 3350, 0.1 M Bis-tris propane pH 7.5). Data-quality crystals grew as colorless (anaerobic, Fig. IV.4a) or yellow (aerobic, Fig. IV.4b and IV.4c) rods after 4-7 d with approximate dimensions of 70 x 70 x 200 pm. Crystals were cryoprotected with crystallization precipitant supplemented with 10-20% (v/v) glycerol (and with 31.8 mM L-orn to assure full substrate occupancy in the KtzI-FADred-NADP*-L-orn structure) before being flash frozen in liquid nitrogen prior to data collection. Re-reduction of oxidized KtzI crystals To prepare re-reduced crystals, KtzI was first reconstituted with FAD and NADPH and crystallized aerobically under the NaBr-containing conditions as described above. After the formation of data-quality crystals, the crystallization tray was degassed and left under light vacuum overnight. The next day, the tray was degassed again and brought into the anaerobic chamber. Aliquots of NADPH and sodium dithionite powder were degassed, brought into the anaerobic chamber, and mixed with anaerobic crystallization precipitant to a final concentration of 50 mM and 25 mM respectively. The reduction of oxidized crystals was achieved by the addition of 4 gL of either the NADPH or sodium dithionite solution directly to the crystallization drop. Reduction was monitored visually as a color change from yellow to colorless. Both reductants were capable of eliciting this oxidation state change, but on very different timescales: 30 min for 50 mM NADPH 108 and <10 sec for 25 mM sodium dithionite. After reduction was complete, 4 p1L of precipitant supplemented with 10% (v/v) glycerol was added to the drop for cryoprotection and crystals were looped and flash frozen in liquid nitrogen. Soaking the crystals for 30 min in the 50 mM NADPH solution deteriorated them such that usable data could not be collected. Attempts to perform this same re-reduction protocol on crystals derived from KSCN-containing conditions proved unsuccessful, as evidenced by a complete lack in crystal-color change even during long incubation periods (5-10 min) with either reductant, culminating in the crystals dissolving into solution. Re-oxidation of reduced KtzI crystals To prepare re-oxidized crystals, KtzI was reconstituted with FAD, NADPH, and L-ornithine, and crystallized anaerobically under the KSCN-containing conditions as described above. Once data-quality crystals formed, the crystallization tray was removed from the anaerobic chamber, and the change in oxidation state could be observed visually as crystals turned from colorless to yellow over a period of -1 hr. The crystals were allowed to further equilibrate for ~1 d before cryoprotecting and freezing in liquid nitrogen. Various attempts to partially oxidize these reduced crystals, in an effort to capture the C4a-hydroperoxy (or some other) intermediate state, were unsuccessful and resulted in either the reduced or oxidized equilibrium states described herein. Data collection, structure determination,and structuralanalysis X-ray diffraction data were collected at the Advanced Photon Source (Argonne, IL) on beamline 24 ID-C and processed in the space group P2,2 1 2, using HKL2000 (45) (Tables IV.2-IV.7). The initial structure of KtzI (reconstituted with FAD and NADPH anaerobically and crystallized under NaBr-containing conditions) was determined by molecular replacement (MR) in PHASER (46) with a CHAINSAW (47) constructed search model using the protein coordinates of the N-hydroxylase from Pseudomonas aeruginosa,PvdA (PDB ID 3S5W (30)), aligned to the sequence of KtzI. This hybrid model was created such that any conserved residues between PvdA and KtzI were retained, while all other residues were truncated to their last common atom according to the protein sequence of KtzI. Solvent content analysis suggested that four molecules of KtzI would occupy the asymmetric unit, and after using MR to search for 4 109 copies of the hybrid model, a homotetrameric assembly with extensive protein-protein interfaces was identified. All subsequent structures of KtzI, which adopted the same crystal packing, were solved by either MR or rigid body refinement in Refmac (48) using the initial refined model's protein coordinates. For rigid body refinements, the selection of reflections for the calculation of Rfree was made identical in each model. Each KtzI structure has been abbreviated to signify what is bound to the protein, and the predicted oxidation states of the cofactors. The abbreviations used for these bound entities are as follows: FADred (reduced FAD), FADox (oxidized FAD), FADox-red (re-reduced FAD), FADred-ox (re-oxidized FAD), NADP* (oxidized NADP), L-orn (L-ornithine), Br (bromide ion that occupies L-orn binding pocket). Files to describe ligand geometries were obtained in COOT (49), which uses the REFMAC5 monomer library (50), and included FDA (FADred), FAD (FADox), NAP (NADP), and ORN (L-ornithine). The restraints for these ligands were constructed using eLBOW, and those for FAD/FDA were further modified in REEL (51) from the PHENIX suite (52) to allow the flavin isoalloxazine ring to adopt its bent or "butterfly" conformation. This change was made such that the ring could fit the non-planar electron density observed in our structures (Fig. IV.7). The modification of the flavin restraints involved dividing the isoalloxazine into two planes, or "wings", such that the dimethyl benzene and pyrimidine portions were restrained on separate planes, with each of these planes including the N5 and NlO positions of the central pyrazine ring. The pyrazine ring, however, was not restrained to be planar, which allows bending of the outer "wings" of the isoalloxazine about the central N5-NlO axis (Fig. IV.7). Ligand-fitting and model-building were done in COOT with subsequent refinement in PHENIX, which included rounds of positional, real-space, B-factor, and simulated annealing refinements. The use of non-crystallographic symmetry restraints between protomers, and the optimization of target weights for geometry and B-factor restraints greatly improved model-quality and refinement statistics. Model-building and refinement were continued iteratively until satisfactory statistics were achieved (Tables IV.2-IV.7). Each KtzI protein structure begins at Prol0 of the wild-type sequence (Fig. IV.2) and ends at residue 423 or 424 (of 424), as residues N- or C-terminal to these positions, respectively, lack electron density and are therefore not included in the final model (Table IV.8). Residues that lacked clear electron density for their protein side chain are modeled as alanines (Table IV.8). Composite omit maps were used to verify all final models. 110 For structures crystallized under NaBr-containing conditions, all ion-like densities were filled exclusively with bromide ions due to: 1. The high concentration of bromide used in crystallization (>1.0 M NaBr) compared to other likely ions (e.g. ~0.08 M for CL-) and 2. The fact that all of these ion-like densities disappeared when KSCN was substituted for NaBr in the crystallization precipitant. It is common for halide ions, like bromide, to compete with water molecules for hydrogen bonding sites, as well as to occupy the solvent shell in and around the protein, and these ions are frequently not at full occupancy (53). To determine the most representative B-factor/occupancy combination for the bromide ions, the B-factor of each was set to the average B-factor of the late-stage refined model, while the occupancies were set at 0.8, 0.5, and 0.3 in three separate trials. These models were then subjected to 20 rounds of iterative B-factor and occupancy refinement in PHENIX and found to all converge to the same values, which are those denoted in the final PDB files. All software installation support was provided by SBGrid (54). Sequence alignments were completed using Clustal Omega (55). Structural figures were prepared using PyMOL (56) and Chimera (57) (Chimera is developed by the Resource for Biocomputing, Visualization, and Informatics at the University of California, San Francisco (supported by NIGMS P41-GM103311). Protein surface area calculations were done using the "Protein interfaces, surfaces and assemblies' service PISA at the European Bioinformatics Institute. (http://www.ebi.ac.uk/pdbe/prot-int/pistart.html) (58). All root-mean-square deviation (rmsd) calculations were done for Cu carbons only using the Protein structure comparison service Fold at European Bioinformatics Institute (http://www.ebi.ac.uk/msd-srv/ssm) (59). 111 IV.VI ACKNOWLEDGEMENTS This work was supported, in part, by the US National Institutes of Health Grants GM083464 (to J.R.H.), and GM020011 (to C.T.W.). C.L.D. is an investigator of The Howard Hughes Medical Institute. This work is based upon research conducted at the Advanced Photon Source on the Northeastern Collaborative Access Team beamlines, which are supported by Award RR-15301 from the National Center for Research Resources at NIH. Use of the Advanced Photon Source, an Office of Science User Facility operated for the US Department of Energy (DOE) Office of Science by Argonne National Laboratory, was supported by the US DOE under Contract DE-AC02-06CH11357. Financial support comes principally from the Offices of Biological and Environmental Research and of Basic Energy Sciences of the US DOE, the National Center for Research Resources (P41RRO12408), and the National Institute of General Medical Sciences (P41GM103473) of NIH. Author contributions: J.W.S. and C.L.D. designed the study. J.R.H. developed the ktzI plasmid construct and provided an initial protein purification protocol. J.W.S optimized protein purification, and carried out crystallographic studies and structural analysis. J.W.S and C.L.D wrote the manuscript. 112 TABLES & FIGURES Table IV.1. Structures of KtzI and their respective resolution. Structure Resolution (A) KtzI-FADred-NADP'-L-orn 2.2 2.4 KtzI-FADred-NADP'-Br 2.1 KtzI-FADox-Br 2.4 KtzI-FADox-NADP*-L-orn 2.6 KtzI-FADox-red-NADP'-Br KtzI-FADred-ox-NADP*-L-orn 2.7 113 Table IV.2. Data collection and refinement statistics for KtzI-FADred-NADP*-L-orn. Space group P212121 Cell constants (A) (0) Beamline Wavelength (A) Resolution (A) No. total observations Redundancy Completeness (%) C <I/C(I)> Rsym (%) a, c Model refinement a = 84.2, b = 156.9, c = 163.6 a = = Y = 90 APS 241D-C 0.9792 66 - 2.23 (2.27 - 2.23) 446488 4.2 (4.3) 99.0 (98.8) 20.5 (2.7) 6.5 (57.2) Rwork(%) b 18.9 Rfee (%) 21.9 b B-factors (A2 ) Protein 38.6 FAD 30.8 NADP 30.3 L-orn Ions Water rmsd bonds (A) d rmsd angles (0) d Number of atoms Protein FAD NADP 33.8 55.7 36.4 0.010 1.3 (4 molecules/asu) 12844 212 192 L-orn 48 Ions 8 Water 549 Ramachandran plot (%) most favored 90.3 additionally allowed 9.3 generously allowed 0.4 disallowed 0 residues a: Rsym= IlIhkl - <Ihkl>I/X 'hk, where I is the intensity of a reflection hkl and <I> is the average over symmetry-related reflections of hkl. b: Rwork = 2IFO - FeI/2IFOI in which F0 and Fc are the observed and calculated structure factor amplitudes, respectively. Rfree is calculated from 5% of the reflections not used in the model refinement. C: Values in parenthesis correspond to the highest resolution shell. d rmsd, root-mean-square deviation. 114 Table IV.3. Data collection and refinement statistics for KtzI-FADox-NADP'-L-orn. P212121 Space group Cell constants (A) (0) Beamline Wavelength (A) Resolution (A) No. total observations Redundancy Completeness (%) c (%) c = = Y = 90 APS 241D-C 0.9795 100 - 2.41 (2.45 - 2.41) 350197 4.1(4.2) 99.0 (99.5) 21.3 (2.4) 5.9(56.8) <I/I(()>C Rsym a = 84.6, b = 157.7, c = 165.3 a, c Model refinement Rwor (%) b 18.1 Rfre, 21.8 (%) b B-factors (A2) Protein FAD NADP L-orn Ions Water rmsd bonds (A) d rmsd angles (0) d Number of atoms Protein FAD NADP L-orn Ions Water Ramachandran plot (%) most favored additionally allowed generously allowed disallowed :K'SYM=11 1 hkI - 25.7 22.3 22.6 24.8 47.9 24.5 0.008 1.3 (4 molecules/asu) 12868 212 192 48 7 562 91.0 8.7 0.3 0 residues 4 ' k1Z /ik,,whereI is the intensiy 0f a reflection uI anu <>1is Me average over symmetry-related reflections of hkl. b: Rwork = EIFO - FCI/EIFOI in which F0 and Fe are the observed and calculated structure factor amplitudes, respectively. Rfee is calculated from 5% of the reflections not used in the model refinement. Values in parenthesis correspond to the highest resolution shell. d: rmsd, root-mean-square deviation. C: 115 Table IV.4. Data collection and refinement statistics for KtzI-FADred-ox-NADP'-L-orn. Space group P212121 Cell constants (A) (0) Beamline Wavelength (A) Resolution (A) No. total observations Redundancy Completeness (%) c <I/(C)>C Rsym (%) a = 85.0, b = 156.4, c = 164.5 C = = Y = 90 APS 241D-C 0.9795 100 - 2.74 (2.79 - 2.74) 260313 4.5 (4.2) 97.9 (97.6) 21.3 (2.4) 6.3 (56.7) a, c Model refinement 18.1 Rwork (%) b Rfee (%)b 22.1 B-factors (A ) Protein 2 32.9 FAD 29.4 NADP L-orn Ions Water rmsd bonds (A) d rmsd angles (0) d Number of atoms Protein FAD 37.9 42.3 53.7 27.0 0.012 1.5 (4 molecules/asu) 12771 212 NADP 192 L-orn Ions Water Ramachandran plot (%) most favored additionally allowed generously allowed disallowed a:Rsym= 1hkl - <hk1 48 8 237 91.0 8.7 0.3 0 residues hk, where I is the intensity of a reflection hkl and <I> is the average over symmetry-related reflections of hkl. b:Rork = XIFO - Fc1/XIF.I in which F. and Fc are the observed and calculated structure factor amplitudes, respectively. Rfree is calculated from 5% of the reflections not used in the model refinement. C: Values in parenthesis correspond to the highest resolution shell. d 116 Table IV.5. Data collection and refinement statistics for KtzI-FADred-NADP'-Br. Space group P21212 1 Cell constants (A) (0) Beamline Wavelength (A) Resolution (A) No. total observations Redundancy Completeness (%) c <I/C(I)> Rsym (%) a,c Model refinement a = 81.9, b = 151.7, c = 162.4 c = = y = 90 APS 241D-C 0.9795 50 - 2.39 (2.43 - 2.39) 429887 5.5 (5.6) 96.8 (98.1) 14.7 (2.4) 10.7 (56.9) Rwork(%) b 20.4 Rfr,,ee(%) 23.1 b (A2 B-factors ) Protein 32.6 FAD 23.6 NADP 22.9 L-orn 37.5* Ions Water 26.6 0.006 rmsd bonds (A) d rmsd angles (0) d 1.4 Number of atoms (4 molecules/asu) Protein 12781 FAD 212 192 NADP L-orn Ions 34 Water 369 Ramachandran plot (%) 90.5 most favored additionally allowed 9.1 generously allowed 0.5 disallowed 0 residues a: Rsym= Ihkl - <Ihkl>/X Ihk, where I is the intensity of a reflection hkl and <I> is the average over symmetry-related reflections of hkl. b: Rwork = 2IF 0 - FcI/XIFOI in which F0 and Fe are the observed and calculated structure factor amplitudes, respectively. Rfr,,ee is calculated from 5% of the reflections not used in the model refinement. C: Values in parenthesis correspond to the highest resolution shell. d: rmsd, root-mean-square deviation. e: Average occupancy = 0.65. 117 Table IV.6. Data collection and refinement statistics for KtzI-FADox-Br. Space group P212 121 Cell constants (A) (0) Beamline Wavelength (A) Resolution (A) No. total observations Redundancy Completeness (%) c <I/__(I)> _ Rsym (%) a, c a = 79.8, b= 151.9, c = 161.9 a = = Y = 90 APS 241D-C 0.9795 50 - 2.09 (2.13 - 2.09) 608641 5.2 (5.3) 99.5 (99.9) 16.5 (2.6) 8.9 (53.7) Model refinement Rwork (%) b 22.7 25.6 Rfree (%) b B-factors (A ) Protein 2 FAD NADP L-orn 38.4 31.5 - Ions Water rmsd bonds (A) d rmsd angles (0) d 31.8e 35.4 0.003 Number of atoms (4 molecules/asu) Protein FAD NADP L-orn Ions Water Ramachandran plot (%) most favored additionally allowed generously allowed disallowed 1.0 12715 212 46 412 89.5 9.9 0.5 0 residues 7 11 -: .SYM:- -' [hkl - <'hkPZ 'ukW, wnere I is tfe intensity or a reflection nKi and <1> is the average over symmetry-related reflections of hkl. b: Ror = 1JF0 - FeI/XIFOl in which F and Fc are the observed and calculated structure factor amplitudes, 0 respectively. Rfree is calculated from 5% of the reflections not used in the model refinement. C: Values in parenthesis correspond to the highest resolution shell. d: rmsd, root-mean-square deviation. e: Average occupancy = 0.67. 118 Table IV.7. Data collection and refinement statistics for Ktzl-FADox-red-NADP'-Br. P212121 Space group Cell constants (A) (0) Beamline Wavelength (A) Resolution (A) No. total observations Redundancy Completeness (%) C <I/J(I)>'C14.8 Rsym (%) ac a = 82.4, b = 152.0, c = 163.6 a =1= = 90 APS 241D-C 0.9795 50 - 2.63 (2.68 - 2.63) 300534 4.9 (4.6) 99.2 (99.3) (2.4) 9.7 (55.3) Model refinement Rwork (%) b 19.1 Rfr,,ee (%) b B-factors (A2) Protein FAD NADP L-orn 23.4 Ions Water rmsd bonds (A) d 30.6 23.4 21.9 31.8e 23.7 0.010 rmsd angles (0) d 1.5 Number of atoms (4 molecules/asu) Protein FAD NADP 12727 212 192 L-orn- Ions Water 28 222 Ramachandran plot (%) 90.7 most favored additionally allowed 8.9 generously allowed 0.5 disallowed 0 residues a: Rsym= II/IkI - <Ikl>I/X Ik1, where I is the intensity of a reflection hkl and <I> is the average over symmetry-related reflections of hkl. b: Rwork = 1IFO - Fcl/XIFOI in which F0 and F, are the observed and calculated structure factor amplitudes, respectively. Rfree is calculated from 5% of the reflections not used in the model refinement. C: Values in parenthesis correspond to the highest resolution shell. d: rmsd, root-mean-square deviation. : Average occupancy = 0.65. 119 Table IV.8. List of ordered residues and those modeled as alanine in KtzI structures. Ordered Residues Residues modeled as alanine (of residues 1-424) Structure Chain A: H120, R137, E150, R196, S197, Chain A: 10-424 R199, R221, K261, E282, R289, K314, E420 KtzI-FADred-NADP'-L-orn Chain B: 10-424 Chain B: H120, R137, E150, R196, R199, R289, E295, K314, D318, E357, E367, E420 Chain C: 10-423 Chain C: R137, E150, R158, Q175, E178, D192, R196, R199, R221, K261, E282, R289, K314, R329, E357, E360, E367, R385, E420 Chain D: 10-424 Chain D: E150, R196, R199, R221, K261, E282, R289, K314, D318, E357, E367, E420, S424 Chain A: 10-424 Chain A: E150, R196, R199, K261, R272, E282, R289, K314, R329, E360, E367 Chain B: 10-424 Chain B: H120, E150, Q175, R196, K261, E282, E295, D353, E357, E420, R422 Chain C: 10-424 Chain C: R137, E150, R153, R158, R196, K261, E282, R289, K314, E357, E360, E367, R385, E420, R421 KtzI-FADox-NADP'-L-orn Chain D: 10-423 Chain A: 10-424 Chain A: R137, E150, R153, D194, R196, R199, R221, K261, K272, E282, K314, E357, E360, E367, E420 Chain B: 10-423 Chain B: E150, R196, R199, K272, E282, E295, D353,E357, E360, E367, E420, R422 Chain C: 10-423 Chain C: R137, E150, R153, R158, Q175, E178, R191, R196, R221, K261, K272, E282, R289, K314, R321, D353, E357, E360, H361, E367, R385, E420 KtzI-FADred-ox-NADP'-L-orn Chain D: 10-424 120 Chain D: R105, E150, R196, R199, R221, K261, E282, R289, K314, E357, E420 Chain D: R105, E150, R158, Q175, R191, R196, R221, K261, K272, E282, R289, K314, R321,E331,E357,E367,E420 Table IV.8 (continued). List of ordered residues and those modeled as alanine in KtzI structures. Ordered Residues Residues modeled as alanine (of residues 1-424) Structure Chain A: H120, R137, R196, S197, R199, Chain A: 10-423 R221, E282, K314, D318, R329, E360, E367, E420 Chain B: 10-423 Chain B: R78, H120, R191, D192, R196, R199, R221, K261, E282, R289, K314, D318, E357, E360, E367, E420, R421, R422 Chain C: 10-423 Chain C: H120, R137, E150, R158, Q175, D192, D194, R196, R221, K261, E282, D318, R329,E357,E360,E367,R385,E420,R421, R422 KtzI-FADred-NADP'-Br Chain D: 10-423 Chain D: E150, R191, D194, R196, R199, R221, K261, Q262, K314, D353, E357, E360, E367, H396,E420 Chain A: 10-423 Chain A: E121, R137, E150, R196,S197, R199, R221, R272, E282, K314, D318, R329, E360, E367, R385 E420, R422, K423 Chain B: 10-423 Chain B: H120, E121, D177, R196, R199, K261, Q262, R269, R272, E282, K314, D318, E357,E360,E367,E420 Chain C: 10-423 Chain C: H120, E121, E127, E150, R153, E156, R158, Q175, R191, D192, R196, S197, R199, K261, Q262, R269, N273, K314, D318, E357, E367, R385, E420, R422 10-423 Chain D: H120, E121, E150, Q175, R191, R193, D194, R196, R199, R221, R272, N273, K314, E331, E357, E360, H361, E367, E420 Chain A: 10-423 Chain A: R105, E121, R137, E150, R158, R191, R196, R199,R221, K261, E282, K314, D318, E360, E367, D383, R385, E420 Chain B: 10-424 Chain B: H120, D192, R193, D194, R196, R199, R221, K261, E282, K314, D318, R321, D353, E357, E360, E367, S424 Chain C: 10-423 Chain C: H120, R137, L143, E150, R153, R158, Q175, R191, D192, D194, R196, S197, R199, R221, K261, E282, K314, D318, D353, E357, L358, E360, H361, E362, R385, E414, E420, R421, R422 Chain D: 10-423 Chain D: H120, E150, E156, R191, R193, R196, R199, K261, K314, D353, E357, E360, E367,H396, E420 KtzI-FADox-Br Chain D: KtzI-FADox-red-NADP'-Br 121 Figure IV.1. Kutzneride scaffold cryptically incorporates the product of KtzI. (a) The kutzneride hexadepsipetides are highly decorated natural products produced by nonribosomal peptide synthesis (NRPS). The piperazic acid moiety (red) of this scaffold is derived from the L-Nahydroxy-ornithine produced by KtzI. (b) KtzI uses FAD, NADPH, and 02 to catalyze the production of its hydroxy-product from L-ornithine, which is further processed and inserted into the kutzneride scaffold by uncharacterized downstream enzymes. (c) Many of the kutzneride biosynthetic enzymes are contained in a contiguous gene cluster in Kutzneria sp. 744 (adapted from (5)), including the stand-alone enzyme KtzI (red). a) OH HNI"ine-- / C cl N N H 0 0 \ 0 0 R, = R2 = R3 = R4 = R5 = R5 0 0 N'R N HN (R)-OH, S-(OH) H, OH, CI H, n-bond H, n-bond H, CH 3 R3 HO NH R? H 3CO NRPS kutzneride scaffold b) R4 0 -o NH 2 KtzI-FAD 'o NADPH NADP+ NH 3 02 L-ornithine H20 N OH HN- NRPS HO 2 NH3 N C R3 R2 piperazic acid derivative '""pa L-N 5 hydroxy-ornithine c) 0 10 orf1,2 122 orf3 ktzA-C ktzD ktzE 30 20 ktzF ktzG ktzH 40 50 kb ktzl ktzJ ktzK-M ktzN ktzO ktzP ktzQ ktzR ktzS orf4-6 orf7 orf8 orf9 orf 10 Figure IV.2. Sequence alignment of L-orn N-hydroxylases. A sequence alignment of the three structurally characterized FAD-dependent L-orn N-hydroxylases (KtzI, PvdA, and SidA) displays a high degree of conservation between these enzymes (33% identity between KtzI and PvdA/SidA). The sequence shown for KtzI is that of the protein construct used in these studies, where the first 21 amino acids (red) represent a non-native purification tag. The start methionine and a threonine at position 2 of the wild-type sequence are absent in our construct, but the numbering has been kept consistent and begins with the first wild-type residue, a valine at position 3 (Val3). KtzI PvdA SidA --------- MGSSHHHHHHSSGLVPRGSHMVAHAGESPTHDVVGVGFGPANLSLAVALEE -----------------------------MTQATATAVVHDLIGIGFGPSNIALAIALEE MESVERKSESSYLGMRNMQPEQRLSLDPPRLRSTPQDELHDLLCVGFGPASLAIAIALHD KtzI PvdA SidA SP------------AALTSAFFERRASISWHQGMLLPAAKMQVSFLKDLATFRNPASRFS RAR---------TQGELQVLFLDKQADYRWHGNTLVSQSELQISFLKDLVSLRNPTSPYS ALDPRLNKSASNIHAQPKICFLERQKQFAWHSGMLVPGSKMQISFIKDLATLRDPRSSFT . KtzI PvdA SidA * * * * * . * * .** : .:*:: * . ::* . .* : * . *. *. *: . .* :. . .: : ****** ::* .:* * * :: :: .*:**:. EIVSSIERRKS------------------EISGSLYQHLKPGTAARALHEHALAS-EMVQSIFGEQLERAAVQ---GHQLRAML *: . :** : 249 258 297 :*::.**.*.:: . 309 318 357 : ****: :****.:*** 191 198 237 *::. 356 365 417 ** ELAEHCVQDAEGRWQVDRDYRMVTTPD---LRCGIYLQGGTEHTHGLSSSLLSNLATRSG PMA-DY----LGDFEVDRNYRLITD---QRCQASIYMQGFCQASHGLSDTLLSVLPVRAE KVQ-HLRPTGQDQWKPHRDYRVEMDPSKVSSEAGIWLQGCNERTHGLSDSLLSVLAVRGG . 140 141 180 * VVGAKR------IADDTRVTV-------YSMAREESYDLDVDVLVCATGYDPMDPGDLLG VEKATA--GAEG---- IELAL-------RNTANGELSVQRYDLVILATGYERQLHRQLLE PERKITRVEHHGPQSRMRIHLKSSKPESEGAANDVKETLEVDALMVATGYNRNAHERLLS * 80 82 120 : PAAVDDYFDGSKQAKDAFWRYHRNTNYSVVDDEVIRDLYRRGYDDEVAGAPRLNFVNLAH PEFTDLIYNQEGAERERLVREYHNTUYSVVDIDLIERIYGIFYRQKVSGVPRHAFRSLRS PERVDKFYSQSAAERQRSLLADKATYSVVRLELIEEIYNDMYLQRVKNPDETQWQHRIL : KtzI PvdA SidA .::*:* :::. .::*. KtzI PvdA SidA ::*:**:*** DR--DPRSLRRVAVAGGGQSAAEIVRFLHDNRPDTVVHAIMPSYGYVVADNTPFANQIFD KQPCVNGQPMKVAIIGGGQSAAEAFIDLNDSYPSVQVDLILRGSALKPADDSPFVNEVFA ALLKDKSKPYIAVLGSGQSAAEIFHDLQKRYPNSRTTLIMRDSAMRPSDDSPFVNEIFN * KtzI PvdA SidA **.**:.* .:* .::*.****** KtzI PvdA SidA *: SVLVDVSTP------EATRTVEARNIVISTGLVPRMPAGV---QSDEFVWHSSRFLDHFR --VEALRVTSRNAE-GEELVRTTRSVVVSAGGTPRIPLAFRHLKDDGRVFHHSQYLERML SVVDFFTVRSRNVETGEISARRTRKVVIAIGGTAKMPSGL---PQDPRIIHSSKYCTTLP :. KtzI PvdA SidA ** . FVSFLHERGRLVRFANNHDFFPTRREFHDYLEWAESKLAHEVSYDSEVTAIRPGPGRPVD FVNYLHKHGRLVDFINLGTFYPCRMEFNDYLRWVAGHFAEQSRYGEEVLSVEPMLVERKFLNYLHQKGRLIHFTNLSTFLPARLEFEDYMRWCAQQFSDVVAYGEEVVEVIPGKSDPSS *:.:**::***: KtzI PvdA SidA *::: 32 31 60 * 413 417 476 .*. 424 443 501 *:. 123 Figure IV.3. Proposed kinetic mechanism for L-orn N-hydroxylases. The flavin and nicotinamide cofactors are truncated to their reactive portions and schematic abbreviations are as follows: E, Enzyme; FADox, oxidized FAD; FADred, reduced FAD; FAD-00-(H), (hydro)peroxyflavin; FAD-OH, hydroxyflavin; L-orn, L-ornithine; L-N 5OH-orn, L-Nahydroxy-ornithine. There is biochemical evidence to suggest that the L-orn substrate binds with a protonated side-chain amine (24) (4a), but the neutral form is eventually necessary for catalysis to occur, as it is used to attack the flavin-hydroperoxide to generate the hydroxy-ornithine product (5- 6). E-FAD 'recI-NADP+-L-orn R N \6/ R N N 0 NH N_ L HH N NH N E-FADox H HR NH2 N + 00H3N E-F ADred-NADP- HH 0 P ~ NNH 2 N NH 2 *~~- N NADPH N'I 0 3 NR NH N0 R/ rng N E-FADox N 0 o NH XN HO0 1 0 0 E-FAD-OO-(H)-NADP+ 0-(H) H202 NADP+ ~- R NH 2 NN N NY H20 NADP+ 0H L-NOH-orn H OH N H 0 HN HN N 0 I, H2N O OH NH 2 *-' NH 2 N *H3 N ' 0 -O E-FAD-OH-NADP+-L-N 5 OH-orn 124 + N I H3N 0 ' E-FAD-OOH-NADP+-L-orn Figure IV.4. Crystals of reconstituted KtzI. Crystals of the (a) KtzI-FADred-NADP'-L-orn, (b) KtzI-FADox-Br, and (c) KtzI-FADox-NADP'-L-orn states are displayed. The intensity of the color change between (a) and (b) is readily apparent, signifying the reduced (colorless) and oxidized (yellow) flavin species respectively. In (c), the more subdued, off-yellow color is likely to be a result of the interaction between the yellow FADox species with the bound NADP' moiety, where these cofactors stack on one another. The crystals in (a) and (c) can also be used to represent those of the other reduced (KtzI-FAD(ox-)red-NADP'-Br) and oxidized (KtzI-FADred-ox-NADP-L-orn) states, respectively. a C 125 Figure IV.5. Structure of KtzI in reduced and oxidized states. (a) Overall structure of KtzI tetramer colored by protomer (pale cyan, pale green, wheat, and pale blue) and represented in cartoon overlayed with a semi-transparent surface representation. (b) The active site of KtzI-FADred-NADP'-L-orn with FADred, NADP', and L-orn bound in the active site and relevant protein residues displayed (all in sticks). Carbons are colored gray, marine blue, green, and cyan for these entities, respectively. All other atoms are colored as follows: oxygen (red), nitrogen (blue), and phosphorus (orange). Hydrogen bonds are represented as black dashed lines and a red dashed line shows the distance between the reactive portions of FAD (C4a) and L-orn (N5) during hydroxylation (all lengths denoted in A). The rest of the enzyme is represented in cartoon form and colored as in (a). (c) The active site of KtzI-FADox-Br (aligned by the pale cyan protomer in (b)) shows a large change in conformation from its reduced counterpart. FADox and the same active site residues as in (b) are shown in sticks with carbons colored yellow and salmon respectively. All other representations and colors are as in (b). (d) The active site of KtzI-FADox-NADP'-L-orn is an amalgamation of (b) and (c), with NADP*, L-orn, and active site residues similar to (b), and the FAD conformation similar to that in (c). Active site protein residues are colored in dark pink with all other colors and representations as in (b) and (c). (e) One side of the active site of KtzI-FADred-NADP+-L-orn (shown in surface representation) is capped by NADP* (colored as in (b)) and a protein loop containing Asn275, Tyr276, and Ser277 (the 'Tyr-loop', magenta). All other representations and colors are as in (b). (f) The surface of the active site shown in (e) changes drastically due to conformational changes and the exit of NADP'. All colors and representations are as in (e) except the carbons of FADox are in yellow. (g) The surface represenation of (d) is once again a combination of (e) and (f), following the same color scheme. Aligning and superimposing the FADred (gray carbons) and FADox (yellow carbons) equilibrium states for both KtzI (h) and para-hydroxybenzoate hydroxylase (PHBH) (i), displays the difference between these two proposed conformational changes. Semi-transparent sticks interpolate the movements necessary to link these two states, with the changes in both the angle (0) between the isoalloxazine and ribityl tail, and the distances (A) from N5 to N5 of the isoalloxazine as denoted. 126 4 g) 2) g 45 C s, b c His5 Ile d His5 FADred Ser406 NADP+ 12 Glu Gu 12' 8 . rg104 2 2,7' H i s5 l Arg1lN Ser406 Lys67 FADo x FADox '~3 .5 S) .2.7 . 2 . Lys67 2.7x Tr27 2~ Asn275 2.8~Asn245 Asn275 sn245 S277 Ser277*4 2.5 e 1 GIu 3. Glu212 0 . S [406 y6 AP66 NADP+ 2. 2.9 28 L-OrM Asn275 2 A yr?76 <A.n245 -2.6 f 5-An 9 !MMI275 FADox FADred Tyr-loop' 7FADox LzrTy76 Asn275 rrI4pI L-Of~j h 5* 5.8 A 1 37 6.5A FADox FADox FADred FADred 127 Figure IV.6. Tetrameric assembly of L-orn N-hydroxylases. (a) The structurally characterized L-orn N-hydroxylases (KtzI, PvdA (PDB ID 3S5W (30)), and SidA (PDB ID 4B63 (29))) all adopt the same tetrameric assembly with protomers shown in cartoon and colored pale cyan, pale green, wheat, and pale blue (left). Aligning and superimposing the pale cyan protomers of these tetramers, while coloring the other three chains by protein: KtzI (magenta), PvdA (dark green), and SidA (purplish blue), show these enzymes have high structural similarity (right), but differ significantly at one interface (b). (b) The tighter interface of KtzI allows a cross-protomer hydrogen bond (dashed line in A) from Tyr270 (magenta carbons) to NADP' (marine blue carbons). FADred and L-orn (green carbons) are also shown in sticks and a yellow arrow is used to show the 'clamping' at this interface in KtzI. All other atoms are colored as in Figure IV.5. (c) Neighboring active sites in KtzI-FADred-NADP'-L-orn are shown with cofactors and substrate colored as in (b). The wheat colored protomer (in cartoon and semi-transparent surface representation) interacts with both the pale cyan and pale green protomers (in semi-transparent surface) and caps one side of the pale cyan protomer's active site. (d) Extracting the pale cyan protomer as a monomeric unit shows that without the interactions provided by its neighboring protomer, the active site would be more solvent exposed, with the L-orn substrate (green) at the protein surface. All other atom colors and depictions are as in (c). 128 a OFKtzl 11Z PvdA SidA NADP+ NADP' 4 4 Tyr270 r I FADr L-orn d C ik~om NADP 4FADred tmL-fn ,v-LO NAOP FA-orn FADred FADred NADP*l 129 Figure IV.7. Wall-eyed stereoview of the electron density for bent isoalloxazine ring. Electron density (2mF.-DFc (1.0a, blue) and mF0 -DF, (-3.0y (red), +3.0a (green)) is displayed for a representative flavin moiety from KtzI-FADred-NADP*-L-oM with FADred shown in sticks and colored as follows: carbon (gray), oxygen (red), nitrogen (blue) and phosphorus (orange). Refining this cofactor with its isoalloxazine ring restricted to be planar (a) or allowed to bend along the N5-NlO axis (b), clearly shows that a bent ring fits the 2mF0 -DFc density best, while concurrently removing all difference density (b). The bent isoalloxazine ring is a commonality to all KtzI structures and may result from reduction by either NADPH or X-ray photoelectrons, as described in the text. a b 130 131 Figure IV.8. Wall-eyed stereoviews of the active sites of reduced L-orn N-hydroxylases. The active sites of (a) KtzI-FADred-NADP'-Br (teal carbons), (b) reduced PvdA (PDB ID 3S61 (30)), light pink carbons), (c) reduced SidA (PDB ID 4B65 (29)), light orange carbons), and (d) KtzI-FADox-red-NADP'Br (light purple carbons) (all aligned with the pale cyan protomer of Fig. IV.5b) show these structures to be relatively identical. Bromide ions are displayed as dark red spheres. All protomers, ligands, and other atoms are represented as in Figure IV.5. In (c), asterisks and semi-transparent sticks represent the L-orn and Asn293 conformations from an oxidized SidA structure (PDB ID 4B63 (29)), as the reduced structure (PDB ID 4B65 (29)) does not have substrate bound. 132 af His5l His5 04 F reft04 1~ FADre Ser406O ~ Se46 y 4~~~ As25 -Asn245 y6 A2~~ sn275 "'fAsn245 Tyr276 8b J. ~ Ar 0 F~e Ser41 LOA NA~~ Ari6 FADred Ser4l 04 NADW j7 Lys~g ) Lys69 SGu2 G~u221Asn284 'sn284 ~ Tyr245 Asn254 ArI4 F~rdSer;469 L NAP, Glu26Q. <7 S 6 Tyr285 Y 10 FAra Ser NADP " ;Asn323 4As54 n5 4 3.~~5~Ty324Asn293* Gu260~ ~2 5 <~ i Lysl07 orn Asn323 Tyr324As23 His5lA Arl4 ADred Ser4O6 Lys67 FArr d Ser406 NADI 'AD ~ys67,# luGlu2 jj 1 Asn275 6 7 'yr276 An4 4 fsn4 Tyr276 133 Figure IV.9. Wall-eyed stereoviews of the active sites of oxidized KtzI. The active sites of (a) KtzI-FADox-Br (salmon carbons), and (b) KtzI-FADred-ox-NADP'-L-orn (dark purple carbons) were aligned with the pale cyan protomer in Fig. IV.5b and are displayed with FADox in yellow carbons and all other protomers, ligands, and atoms represented as in Fig. IV.8. a FADox Ys His51 * Arg104 S( r406 Tyr2 Asn275 Tyr276 Lys6 7 Arg 104 FAox s6 .sn275 Asn2 45 er277*-' Se 406 Lys67 .4 Tyr276 Asn245 Ser277 b His51 His5 Sr406 Lys67 FADox S046 FADox NADP+ NADP+ GIu21 GIu21 L-orn GAsn275 yr276 134 Lys67 sn245 L-orn sn275 Tyr276 n245 135 Figure IV.10. Structurally-based proposal for L-orn N-hydroxylase mechanism. (A) L-orn N-hydroxylases with an oxidized flavin could exist in a dynamic equilibrium between the FADox(out) conformation observed in KtzI-FADox-Br (with or without the 'Tyr-loop' insertion) and the FADox(in) of SidA-FADox-L-orn (protein carbons in gold, PDB ID 4B69 (29)). (B) Anaerobic reduction of KtzI-FADox-Br crystals recapitulated its anaerobically reconstituted counterpart, KtzI-FADred-NADP'-Br (protein carbons in teal). (C) Binding of L-orn, as displayed for KtzI-FADred-NADP'-L-orn, causes minimal deviations within the active site of the reduced enzyme. A close-up of the active site (inset) with Van der Waals radii displayed for substrate L-orn (gray spheres) and NADP' (atom-colored spheres) show the fit of these two molecules. After oxygen addition and hydroperoxy-flavin generation, hydroxylation to the L-N 5OH-orn product would occur (1). If this newly hydroxylated product (orange carbons) maintains the same positioning as the substrate, a steric clash between the Van der Waals radii of the newly added N5-OH group (gray spheres) and the bound NADP cofactor would occur, which could lead to a destabilization of NADP' binding (2). (D) This destabilization could explain the poorly resolved nicotinamide portion of NADP' found in the L-N 5OH-orn-bound structure of PvdA (PDB ID 3S5W (30)). After catalysis, the resting state enzyme would need to be reproduced through dissociation of the hydroxyornithine product, spent NADP' cofactor, and water (3). We have shown that a conformational change takes place in crystallo after oxygen addition to the fully-liganded reduced state in (C), in a background of excess NADP(H), which yields the KtzI-FADox-NADP*-L-orn state shown in (E). Crystals of this oxidized state are unable to be reduced by NADPH or dithionite, and thus it appears to be a dead-end, inhibited conformation. NADP' binding to the FADox(out) state in (A) could cause a state similar to what we observe in (E), which could be blocked by insertion of the Tyr-loop. Dotted-lined arrows are shown for steps without direct experimental evidence. Colors for protein, cofactors, and ligands not described above are as in Figure IV.5. Bromide ions were removed from the KtzI structures for clarity. 136 Ax FADox(out) LyS67 02 +NADP+ NADP+,,' NADPH KtzI-FADox-NADP+-L-Orn ©l __ Argl04 Lys67 FADxot Arg14 Ly) NADPH -G KtzI-FADox-Br rg u212 P A~re Lys 31 21 ~FAr A~1 FD~d l Lys67 y NADP FA Asnn323 Asn2 ArglArg# Ktu212 L-or LyS6 NAF o-B G1SidA-FA 6 2x-L-Orn Asn25 As Asn275 Asn2 324 Tyr276 Tyr276 KtzI-FAD KtzFADred-NADP+-L-OM red-NADP+-Br 02 .. 'ejection' H20 NADP+ Lys6s L-NOH-om VF33As284 PvdA-FADox-NADP-L-NH-orn . 2.'destabilization' 1.'hydroxylation' ''...(02) 137 II.VII REFERENCES 1. 2. 3. 4. Newman, D. J., and Cragg, G. M. (2012) Natural products as sources of new drugs over the 30 years from 1981 to 2010., JNat Prod 75, 311-335. Walsh, C. T., and Wencewicz, T. A. (2013) Prospects for new antibiotics: a molecule-centered perspective., J Antibiot 67, 7-22. Pohanka, A., Menkis, A., Levenfors, J., and Broberg, A. (2006) Low-abundance kutznerides from Kutzneria sp. 744., J Nat Prod 69, 1776-1781. Broberg, A., Menkis, A., and Vasiliauskas, R. (2006) Kutznerides 1-4, depsipeptides from the actinomycete Kutzneria sp. 744 inhabiting mycorrhizal roots of Picea abies seedlings, J Nat Prod 69, 97-102. 5. Fujimori, D. G., Hrvatin, S., Neumann, C. S., Strieker, M., Marahiel, M. A., and Walsh, C. T. (2007) Cloning and characterization of the biosynthetic gene cluster for kutznerides., Proc Natl Acad Sci USA 104, 16498-16503. 6. 7. Zolova, 0. E., and Garneau-Tsodikova, S. (2013) KtzJ-dependent serine activation and 0-methylation by KtzH for kutznerides biosynthesis., J Antibiot 67, 59-64. Neumann, C. S., Jiang, W., Heemstra, J. R., Gontang, E. A., Kolter, R., and Walsh, C. T. (2012) Biosynthesis of Piperazic Acid via N(5) -Hydroxy-Ornithine in Kutzneria spp. 744., Chembiochem 13, 972-976. 8. 9. Jiang, W., Heemstra, J. R., Forseth, R. R., Neumann, C. S., Manaviazar, S., Schroeder, F. C., Hale, K. J., and Walsh, C. T. (2011) Biosynthetic Chlorination of the Piperazate Residue in Kutzneride Biosynthesis by KthP., Biochemistry 50, 6063-6072. Strieker, M., Nolan, E. M., Walsh, C. T., and Marahiel, M. A. (2009) Stereospecific synthesis of threo- and erythro-beta-hydroxyglutamic acid during kutzneride biosynthesis., JACS 131, 13523-13530. 10. 11. 12. 13. 14. 15. 16. 17. 138 Neumann, C. S., and Walsh, C. T. (2008) Biosynthesis of (-)-(1S,2R)-allocoronamic acyl thioester by an Fe(II)-dependent halogenase and a cyclopropane-forming flavoprotein., JACS 130, 14022-14023. Heemstra, J. R., and Walsh, C. T. (2008) Tandem action of the 02- and FADH2-dependent halogenases KtzQ and KtzR produce 6,7-dichlorotryptophan for kutzneride assembly., JACS 130, 14024-14025. Bosello, M., Mielcarek, A., Giessen, T. W., and Marahiel, M. A. (2012) An enzymatic pathway for the biosynthesis of the formylhydroxyornithine required for rhodochelin iron coordination., Biochemistry 51, 3059-3066. Robinson, R., and Sobrado, P. (2011) Substrate binding modulates the activity of Mycobacterium smegmatis G, a flavin-dependent monooxygenase involved in the biosynthesis of hydroxamatecontaining siderophores., Biochemistry 50, 8489-8496. Robbel, L., Helmetag, V., Knappe, T. A., and Marahiel, M. A. (2011) Consecutive enzymatic modification of ornithine generates the hydroxamate moieties of the siderophore erythrochelin., Biochemistry 50,6073-6080. Mayfield, J. A., Frederick, R. E., Streit, B. R., Wencewicz, T. A., Ballou, D. P., and DuBois, J. L. (2010) Comprehensive spectroscopic, steady state, and transient kinetic studies of a representative siderophore-associated flavin monooxygenase., J Biol Chem 285, 30375-30388. Chocklett, S. W., and Sobrado, P. (2010) Aspergillus fumigatus SidA is a highly specific ornithine hydroxylase with bound flavin cofactor., Biochemistry 49, 6777-6783. Meneely, K. M., Barr, E. W., Bollinger, J. M., and Lamb, A. L. (2009) Kinetic mechanism of ornithine hydroxylase (PvdA) from Pseudomonas aeruginosa: substrate triggering of 02 addition but not flavin reduction., Biochemistry 48, 4371-4376. 18. 19. 20. 21. 22. 23. 24. 25. 26. 27. 28. 29. 30. 31. 32. 33. 34. 35. 36. Heemstra, J. R., Walsh, C. T., and Sattely, E. S. (2009) Enzymatic tailoring of ornithine in the biosynthesis of the Rhizobium cyclic trihydroxamate siderophore vicibactin., JACS 131, 15317-15329. Pohlmann, V., and Marahiel, M. A. (2008) Delta-amino group hydroxylation of L-ornithine during coelichelin biosynthesis., Org & Biomolec Chem 6, 1843-1848. Meneely, K. M., and Lamb, A. L. (2007) Biochemical characterization of a flavin adenine dinucleotide-dependent monooxygenase, ornithine hydroxylase from Pseudomonas aeruginosa, suggests a novel reaction mechanism., Biochemistry 46, 11930-11937. Ge, L., and Seah, S. Y. K. (2006) Heterologous expression, purification, and characterization of an 1-ornithine N(5)-hydroxylase involved in pyoverdine siderophore biosynthesis in Pseudomonas aeruginosa., J Bacteriol 188, 7205-7210. Thariath, A. M. A., Fatum, K. L. K., Valvano, M. A. M., and Viswanatha, T. T. (1993) Physico-chemical characterization of a recombinant cytoplasmic form of lysine: N6-hydroxylase., Biochim Biophys Acta 1203, 27-35. Plattner, H. J., Pfefferle, P., Romaguera, A., Waschtitza, S., and Diekmann, H. (1989) Isolation and some properties of lysine N6-hydroxylase from Escherichia coli strain EN222., Biology of Metals 2, 1-5. Frederick, R. E., Ojha, S., Lamb, A., and DuBois, J. L. (2014) How pH Modulates the Reactivity and Selectivity of a Siderophore-Associated Flavin Monooxygenase., Biochemistry. Shirey, C., Badieyan, S., and Sobrado, P. (2013) Role of Ser-257 in the Sliding Mechanism of NADP(H) in the Reaction Catalyzed by the Aspergillus fumigatus Flavin-dependent Ornithine N5-Monooxygenase SidA., J Biol Chem 288, 32440-32448. Robinson, R. M., Badieyan, S., and Sobrado, P. (2013) C4a-hydroperoxyflavin formation in N-hydroxylating flavin monooxygenases is mediated by the 2'-OH of the nicotinamide ribose of NADP', Biochemistry 52, 9089-9092. Romero, E., Fedkenheuer, M., Chocklett, S. W., Qi, J., Oppenheimer, M., and Sobrado, P. (2012) Dual role of NADP(H) in the reaction of a flavin dependent N-hydroxylating monooxygenase., Biochim Biophys Acta 1824, 850-857. Frederick, R. E., Mayfield, J. A., and DuBois, J. L. (2011) Regulated 02 activation in flavin-dependent monooxygenases., JACS 133, 12338-12341. Franceschini, S., Fedkenheuer, M., Vogelaar, N. J., Robinson, H. H., Sobrado, P., and Mattevi, A. (2012) Structural insight into the mechanism of oxygen activation and substrate selectivity of flavin-dependent N-hydroxylating monooxygenases., Biochemistry 51, 7043-7045. Olucha, J., Meneely, K. M., Chilton, A. S., and Lamb, A. L. (2011) Two structures of an N-hydroxylating flavoprotein monooxygenase: ornithine hydroxylase from Pseudomonas aeruginosa., J Biol Chem 286, 31789-31798. Palfey, B. A., and McDonald, C. A. (2010) Control of catalysis in flavin-dependent monooxygenases., Arch Biochem Biophys 493, 26-36. van Berkel, W. J. H., Kamerbeek, N. M., and Fraaije, M. W. (2006) Flavoprotein monooxygenases, a diverse class of oxidative biocatalysts., J Biotech 124, 670-689. Entsch, B., Cole, L. J., and Ballou, D. P. (2005) Protein dynamics and electrostatics in the function of p-hydroxybenzoate hydroxylase., Arch Biochem Biophys 433, 297-311. Husain, M., and Massey, V. (1979) Kinetic studies on the reaction of p-hydroxybenzoate hydroxylase. Agreement of steady state and rapid reaction data., J Biol Chem 254, 6657-6666. Krueger, S. K., and Williams, D. E. (2005) Mammalian flavin-containing monooxygenases: structure/function, genetic polymorphisms and role in drug metabolism., Pharmacology & therapeutics106, 357-387. Lennon, B. W., Williams, C. H., and Ludwig, M. L. (1999) Crystal structure of reduced thioredoxin reductase from Escherichia coli: structural flexibility in the isoalloxazine ring of the flavin adenine dinucleotide cofactor., Protein Sci 8, 2366-2379. 139 37. 38. 39. Rodriguez-Otero, J., Martinez-Ndfiez, E., Pefia-Gallego, A., and Vazquez, S. A. (2002) The role of aromaticity in the planarity of lumiflavin., J Org Chem 67, 6347-6352. Zheng, Y. J., and Ornstein, R. L. (1996) A theoretical study of the structures of flavin in different oxidation and protonation states, JACS 118, 9402-9408 Rshr, A. K., Hersleth, H.-P., and Andersson, K. K. (2010) Tracking flavin conformations in protein crystal structures with Raman spectroscopy and QM/MM calculations., Angew Chem 49, 2324-2327. 40. 41. Gatti, D. L., Palfey, B. A., Lah, M. S., Entsch, B., Massey, V., Ballou, D. P., and Ludwig, M. L. (1994) The mobile flavin of 4-OH benzoate hydroxylase., Science 266, 110-114. Mirza, I. A., Yachnin, B. J., Wang, S., Grosse, S., Bergeron, H., Imura, A., Iwaki, H., Hasegawa, Y., Lau, P. C. K., and Berghuis, A. M. (2009) Crystal structures of cyclohexanone monooxygenase reveal complex domain movements and a sliding cofactor., JACS 131, 8848-8854. 42. 43. Franceschini, S., van Beek, H. L., Pennetta, A., Martinoli, C., Fraaije, M. W., and Mattevi, A. (2012) Exploring the Structural Basis of Substrate Preferences in Baeyer-Villiger Monooxygenases: Insight from Steroid Monooxygenase, J Biol Chem 287, 22626-22634. Sheng, D., Ballou, D. P., and Massey, V. (2001) Mechanistic studies of cyclohexanone monooxygenase: chemical properties of intermediates involved in catalysis., Biochemistry 40, 11156-11167. 44. 45. 46. 47. 48. 49. 50. 51. 52. 53. 54. 55. 56. 140 Goldman, P. J., Ryan, K. S., Hamill, M. J., Howard-Jones, A. R., Walsh, C. T., Elliott, S. J., and Drennan, C. L. (2012) An unusual role for a mobile flavin in StaC-like indolocarbazole biosynthetic enzymes., Chem & Biol 19, 855-865. Otwinowski, Z., and Minor, W. (1997) Processing of X-ray diffraction data collected in oscillation mode, Methods Enzymol 276, 307-326. McCoy, A. J., Grosse-Kunstleve, R. W., Adams, P. D., Winn, M. D., Storoni, L. C., and Read, R. J. (2007) Phaser crystallographic software, J Appl Crystallogr40, 658-674. Stein, N. (2008) CHAINSAW: a program for mutating pdb files used as templates in molecular replacement, J Appl Crystallogr41, 641-643. Murshudov, G., Vagin, A., and Dodson, E. (1997) Refinement of macromolecular structures by the maximum-likelihood method, Acta CrystallogrSect D Biol Crystallogr53, 240-255. Emsley, P., and Cowtan, K. (2004) Coot: model-building tools for molecular graphics, Acta Crystallogr Sect D Biol Crystallogr60, 2126-2132. Vagin, A. A., Steiner, R. A., Lebedev, A. A., Potterton, L., McNicholas, S., Long, F., and Murshudov, G. N. (2004) REFMAC5 dictionary: organization of prior chemical knowledge and guidelines for its use, Acta CrystallogrSect D Biol Crystallogr60, 2184-2195. Moriarty, N. W., Grosse-Kunstleve, R. W., and Adams, P. D. (2009) electronic Ligand Builder and Optimization Workbench (eLBOW): a tool for ligand coordinate and restraint generation, Acta CrystallogrSect D Biol Crystallogr65, 1074-1080. Adams, P. D., Afonine, P. V., Bunkoczi, G., Chen, V. B., Davis, I. W., Echols, N., Headd, J. J., Hung, L.-W., Kapral, G. J., Grosse-Kunstleve, R. W., McCoy, A. J., Moriarty, N. W., Oeffner, R., Read, R. J., Richardson, D. C., Richardson, J. S., Terwilliger, T. C., and Zwart, P. H. (2010) PHENIX: a comprehensive Python-based system for macromolecular structure solution, Acta CrystallogrSect D Biol Crystallogr66, 213-221. Dauter, Z., M., D., and K.R., R. (2000) Novel approach to phasing proteins: derivatization by short cyro-soaking with halides, Acta Crystallogr Sect D Biol Crystallogr56, 232-237. Morin, A., Eisenbraun, B., Key, J., Sanschagrin, P. C., Timony, M. A., Ottaviano, M., and Sliz, P. (2013) Collaboration gets the most out of software, eLife 2. Sievers, F., Wilm, A., Dineen, D., Gibson, T. J., Karplus, K., Li, W., Lopez, R., McWilliam, H., Remmert, M., Sdding, J., Thompson, J. D., and Higgins, D. G. (2011) Fast, scalable generation of high-quality protein multiple sequence alignments using Clustal Omega., Molec Syst Biol 7, 539. Schrodinger, LLC. (2010) The PyMOL Molecular Graphics System, Version 1.5.0.5. 57. 58. 59. Pettersen, E. F., Goddard, T. D., Huang, C. C., Couch, G. S., Greenblatt, D. M., Meng, E. C., and Ferrin, T. E. (2004) UCSF Chimera--a visualization system for exploratory research and analysis., J Comput Chem 25, 1605-1612. Krissinel, E., and Henrick, K. (2007) Inference of macromolecular assemblies from crystalline state., J Mol Biol 372, 774-797. Krissinel, E. E., and Henrick, K. K. (2004) Secondary-structure matching (SSM), a new tool for fast protein structure alignment in three dimensions., Acta Crystallogr Sect D Biol Crystallogr60, 2256-2268. 141 142 Chapter 5. Outstanding Questions for AAG and KtzI V.1 SUMMARY In this dissertation, we have examined the human DNA repair protein alkyladenine DNA glycosylase (AAG) (Chapters 2 and 3), and a flavin-dependent enzyme involved in antibiotic biosynthesis called KtzI (Chapter 4). These dissimilar systems are linked by their reliance on conformational flexibility for catalysis, and substantial progress was made on understanding both systems through collaborative efforts. As science is a perpetually evolving endeavor, many unresolved questions remain for these enzymes. In this chapter, we will bring forward what we feel are the most interesting outstanding questions in each system, in hopes of inspiring future generations of researchers to take the lead in answering them. V.11 Repairing DNA with AAG In Chapters 2 and 3, we analyzed the human DNA repair protein alkyladenine DNA glycosylase (AAG). As mentioned in Chapter 1, the most common manifestations of DNA damage are known as DNA lesion bases (1), where a canonical DNA base is altered by endogenous or exogenous factors to create a new chemical entity. These lesion bases occur at a rate of 10,000 per cell per day (1, 2), and AAG is involved in the removal of a structurally diverse group of these lesion bases (3, 4) to initiate a DNA repair pathway. Our lab has collaborated with the Samson Group to solve crystal structures of an N-terminally truncated form of this protein (A79AAG) bound to DNA containing 3,N 4-ethenocytosine (EC) (5, 6). This lesion, caused by lipid peroxidation (7), is rather prevalent and is of specific interest because AAG has been shown, by us (6) and others (8), to bind cC with high affinity, while being unable to excise it. We have snapshots of the enzyme both recognizing the PC inhibitor lesion (Chapter 2 (6)), and interacting with DNA in a lower-affinity, nonspecific manner (Chapter 3 (5)). These studies have provided great insight, but as mentioned above, contain the caveat of using a truncated protein construct. We feel that characterization of the full-length AAG (FL-AAG) enzyme is the most important outstanding structural question for this system. All crystallographic work to date has been with an N-terminally truncated AAG protein, which has been able to give substantial insight into the recognition of DNA (5, 6, 9, 10). This truncated protein, although shown to have wild type catalytic activity (3, 6), appears to be hindered in its overall processivity, especially at conditions mimicking a physiological 143 environment (11). In separate studies, AAG's N-terminus has been implicated in overcoming product (abasic site) inhibition (12, 13) and in recognizing substrate lesions (12). Our truncated A79AAG construct removes this N-terminus (Fig. V.1), such that the wild-type AAG sequence begins with Thr84, and residues left from cleavage of the purification tag add Gly80, Pro8l, His82 and Met83 prior to this residue. Our construct is unperturbed as far as catalysis is concerned (6), so understanding the specific interactions of AAG with lesion bases should be unaffected. In light of the functions attributed to the N-terminus of AAG, however, especially considering the 13 Arg or Lys residues in this region (Fig. V.1) that could be used to bind DNA, a structure showing FL-AAG would greatly increase our understanding. We have collaborated with the laboratory of Patrick O'Brien at the University of Michigan Medical School to attempt structural characterization of the FL-AAG enzyme, but have yet to produce viable crystals. The full-length protein is very active and pure, but can only be concentrated after purification to approximately 5 mg/mL (~150 uM) as determined by active site titration (A2 60/A2 80 = 0.58 by absorbance). This low concentration has made crystallization difficult, but some success has been had in concentrating the protein further after incubating with DNA (unpublished results). A 13-mer DNA duplex containing a pyrrolidine abasic site mimic opposite a thymine (pyr:T) added to FL-AAG prior to spin filter concentration, has allowed for soluble protein up to concentrations of approximately 30 mg/mL by absorbance measurements (A 2 60/A 2 80 = 1.57; E28O = 28150 M-cm' and molecular weight = 32868 (protein-DNA complex)). Complex formation was not confirmed before crystallization efforts, and no viable crystals were produced through these experiments. An optimization of this method, including confirming a protein-DNA complex through another technique like native polyacrylamide gel electophoresis, with subsequent complex purification by size exclusion chromatography, could be used to attain crystal structures of FL-AAG. Another way to obtain a FL-AAG complex structure would be to use the disulfide crosslinking method pioneered by the laboratory of Gregory Verdine at the Harvard University (14). This technique allows physical linking of protein and DNA through a disulfide bond, followed by subsequent purification steps, thus creating a purified covalent complex for crystallization. Indeed, this method has been employed successfully for the homologue of AAG from E. coli, AlkA (15, 16). This disulfide crosslinking is further useful as it can be performed with both lesion-containing, and undamaged DNA, providing insight into both specific and nonspecific protein-DNA interactions. In any case, a structure of FL-AAG in 144 complex with DNA would finally provide a depiction of its functionally important N-terminal region, providing new perspective on this enzyme, such that some current questions could be answered while initiating further research. V.111 Antibiotic biosynthesis with KtzI In Chapter 4, we investigated the flavin-dependent, L-orn N-hydroxylase (monooxygenase) from Kutzneria sp. 744, called KtzI. This enzyme takes L-ornithine to L-N 5hydroxy-ornithine using FAD, NADPH, and 02, and this hydroxylamine product is further incorporated into antifungal antimicrobials called kutznerides. We have been able to structurally characterize KtzI in several states along its catalytic trajectory by using various chemical and environmental manipulations. These states are suggestive of never-before-seen conformational changes of the flavin, which we have been able to recapitulate in crystallo, signaling their relevance to the catalytic cycle. The flavin-dependent hydroxylases have been studied for over 50 years, and although their overarching reaction mechanism is conserved in the majority of enzymes (see Chapter 1 and Fig. V.2; reviewed in (17-20)), there are intriguing differences observed in the N-hydroxylase class. As described in Chapter 4, N-monooxygenases, although formally grouped with Class B enzymes (18), borrow qualities from both major classes of flavin monooxygenases, such that they have the substrate specificity of the so-called "cautious" (or Class A) enzymes (Fig V.2b), but have an oxidative half reaction wherein NADP* remains bound throughout, mimicking that of the "bold" (or Class B) enzymes (Fig. V.2a), which tend to be more promiscuous hydroxylaters overall (reviewed in (17, 18)). Class A enzymes couple substrate binding to NADPH reduction using dynamic movements of the FAD isoalloxazine ring (Fig. V.3b). FAD moves from the protein interior ('in') to the protein exterior ('out') upon substrate binding, allowing reduction by NADPH. Once reduction occurs, the reduced flavin moves from this 'out' position back 'in'. This control point helps guard against unproductive uncoupling of the reaction as the reactive C4a-hydroperoxy-flavin intermediate can only be generated in the presence of substrate. KtzI, and all other Class B flavin monooxygenases, are just as easily reduced by NADPH in the absence of substrate, such that they do not share the same control point as Class A enzymes. Although the precedence for flavin conformational changes controlling catalysis exists for "cautious" enzymes, KtzI is the first Class B monooxygenase for which flavin movement has been suggested (Fig. V.3a), and we propose that 145 these conformational changes could be correlated in both Class A and Class B systems in an effort to control the "flaws" in their respective paths to a hydroxylated product (Fig. V.2). As mentioned above, the Class A monooxygenases couple substrate-binding to NADPH reduction using movements of the bound flavin (Fig. V.3b; (17, 18)). This protective step is necessitated by the "flaw" that Class A enzymes are unable to stabilize the reactive flavin C4a-hydroperoxide to any degree, such that addition of oxygen to the reduced flavin must occur only if and when substrate is present to be hydroxylated. Class B monooxygenases are capable of stabilizing the C4a-hydroperoxide on the order of minutes to hours (the quality from which the "bold" moniker is derived), and they are able to do this due to protection afforded by a bound NADP* molecule (removing the "flaw" from Class A systems) (17, 18). Indeed, 02 addition to a chemically reduced flavin in the absence of this bound NADP', results in immediate uncoupling for "bold" enzymes. These observations display the pivotal role NADP(H) plays throughout the reaction cycle, as both a reductant and a protector of intermediate states. NADP' remaining bound throughout catalysis bring its own "flaw", however, as this cofactor must eventually be dissociated before another round of catalysis begins using a new NADPH reducing equivalent. Therefore, what signals the spent nicotinamide cofactor to leave precisely after the very last step in catalysis? Our proposal for L-orn hydroxylases, as outlined in Chapter 4, is that hydroxylation acts as an intermediate signal through a steric clash between the hydroxy-product and NADP', resulting in a destabilized cofactor. This intermediate signal is currently limited to the L-orn N-hydroxylase active site architecture, but all Class B monooxygenases have the problem of getting rid of a cofactor that has been bound throughout the catalytic cycle. As discussed in Chapter 4, hydroxylation alone was not enough to eject NADP' in L-om N-hydroxylases, therefore, we have proposed a conformational change-induced ejection of NADP' by a flavin movement from an 'in' to 'out' position (Fig. V.3a), which is distinct from the 'in' and 'out' states observed for Class A enzymes (Fig V.3b). This proposal need not be limited to N-hydroxylases, and we believe that similar structural characterization of chemically and environmentally manipulated Class B monooxygenases could tease out similar conformational changes. Further, there is very little biochemical data that support flavin conformational changes in N-hydroxylases, and as mentioned in Chapter 4, this may be due to similar spectroscopic signals coming from structurally dissimilar states. We believe it is worthwhile to re-examine existing pre-steady state kinetic data in light of our observations of varied flavin conformations, 146 but also to design new studies to look specifically for these changes. It will likely be useful to examine Class B monooxygenases using derivatives of flavin, and accompanying active site mutants, in an effort to slow down, or enhance the signal of, what may be very transient flavin movements. In any case, our structural data suggest that movements of the flavin cofactor in both Class A and Class B hydroxylase enzymes could be correlated to address respective "flaws" in their kinetic mechanism, linking these two distinct classes by their reliance on conformational changes for controlling catalysis. 147 148 FIGURES Figure V.1. Sequence alignment of our N-terminal truncation mutant (A79) and full-length (FL) alkyladenine DNA glycosylase (AAG). Positively charged residues in the N-terminus of FL-AAG are colored blue, and the residues left behind after tag cleavage in our A79AAG construct are colored pink. FL-AAG A79AAG MVTPALQMKKPKQFCRRMGQKKQRPARAGQPHSSSDAAQAPAEQPHSSSDAAQAPCPRER ------------------------------------------------------------ FL-AAG A79AAG CLGPPTTPGPYRSIYFSSPKGHLTRLGLEFFDQPAVPLARAFLGQVLVRRLPNGTELRGR GPHMTRLGLEFFDQPAVPLARAFLGQVLVRRLPNGTELRGR -------------------************ *F************************** FL-AAG IVETEAYLGPEDEAAHSRGGRQTPRNRGMFMKPGTLYVYIIYGMYFCMNISSQGDGACVL A7 9AAG IVETEAYLGPEDEAAHSRGGRQTPRNRGMFMKPGTLYVYI IYGMYFCMNI SSQGDGACVL * ******************* * ************************ *************** A79AAG LRALEPLEGLETMRQLRSTLRKGTASRVLKDRELCSGPSKLCQALAINKSFDQRDLAQDE LRALEPLEGLETMRQLRSTLRKGTASRVLKDRELCSGPSKLCQALAINKSFDQRDLAQDE FL-AAG AVWLERGPLEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGSPWVSVVDRVAEQDTQA A7 9AAG AVWLERGPLEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGSPWVSVVDRVAEQDTQA FL-AAG * ******************* ************************* ************* 149 Figure V.2. Kinetic mechanism for hydroxylation in (a) bold and (b) cautious flavin-dependent monooxygenases. Abbreviations are as follows: E, Enzyme; FAD, oxidized FAD; FADre, reduced FAD; FADOO-(H), (hydro)peroxyflavin; FADOH, hydroxyflavin; S, substrate; SOH, hydroxylated product. Light gray states are those that are transient in nature. Green stars indicate proposed control points where flavin conformational changes are vital to the catalytic cycle for each system. a) NA E-FA D - E-FADe-NADP+ -0-2-'- E-FAD APH -NADP+ E-FAD E-FADoH-NADP+-SOH S.DE-FAD -NADP+-S ->E-FAD -NADP+-SH 1.NADPH; 2.S b) ""at E E-FAD-S H20 NADP. NADPH S F :-S NADP+ 150 -TsAE-FAD,-S EF -rpuuX S 02_1E--AV - E-FAD O-SOH SHOH x Figure V.3. Diverse flavin conformations are found in (a) KtzI and (b) para-hydroxybenzoate hydroxylase (PHBH). The 'in' (grey carbons) and 'out' (yellow carbons) conformations in KtzI (a) vs. PHBH (b) suggest very different flavin movements. All other atoms are colored as follows: oxygen (red), nitrogen (blue), and phosphorus (orange). FAD 'out' 90 FADF'in' FAD 'in' FAD Fout' b FAD 'out' 90 FA D ' i n' FAD 'out' FAD 'in' 151 V.IV REFERENCES 1. 2. Lindahl, T. (1993) Instability and decay of the primary structure of DNA, Nature 362, 709-715. Lindahl, T., and Barnes, D. (2000) Repair of endogenous DNA damage, Cold Spring Harb Symp Quant Biol 65, 127-134. Lee, C.-Y. I., Delaney, J. C., Kartalou, M., Lingaraju, G. M., Maor-Shoshani, A., Essigmann, J. M., and Samson, L. D. (2009) Recognition and Processing of a New Repertoire of DNA Substrates by Human 3-Methyladenine DNA Glycosylase (AAG), Biochemistry 48, 1850-1861. O'Brien, P. J., and Ellenberger, T. (2004) Dissecting the broad substrate specificity of human 3methyladenine-DNA glycosylase, J Biol Chem 279, 9750-9757. Setser, J. W., Lingaraju, G. M., Davis, C. A., Samson, L. D., and Drennan, C. L. (2012) Searching for DNA lesions: structural evidence for lower- and higher-affinity DNA binding conformations of human alkyladenine DNA glycosylase., Biochemistry 51, 382-390. Lingaraju, G. M., Davis, C. A., Setser, J. W., Samson, L. D., and Drennan, C. L. (2011) Structural basis for the inhibition of human alkyladenine DNA glycosylase (AAG) by 3,N4ethenocytosine containing DNA, J Biol Chem 286, 13205-13213. Chung, F. L., Chen, H. J., and Nath, R. G. (1996) Lipid peroxidation as a potential endogenous source for the formation of exocyclic DNA adducts, Carcinogenesis17, 2105-2111. Gros, L., Maksimenko, A., and Privezentzev, C. (2004) Hijacking of the Human Alkyl-N-purineDNA Glycosylase by 3,N4-Ethenocytosine, a Lipid Peroxidation-induced DNA Adduct, J Biol 3. 4. 5. 6. 7. 8. Chem 279, 17723-17730. 9. 10. 11. 12. 13. 14. Lau, A. Y., Wyatt, M. D., Glassner, B. J., Samson, L. D., and Ellenberger, T. (2000) Molecular basis for discriminating between normal and damaged bases by the human alkyladenine glycosylase, AAG, Proc Natl Acad Sci USA 97, 13573-13578. Lau, A., Scharer, D., Samson, L., Verdine, G., and Ellenberger, T. (1998) Crystal Structure of a Human Alkylbase-DNA Repair Enzyme Complexed to DNA: Mechanisms for Nucleotide Flipping and Base Excision, Cell 95, 249-258. Hedglin, M., and O'Brien, P. J. (2008) Human Alkyladenine DNA Glycosylase Employs a Processive Search for DNA Damage, Biochemistry 47, 11434-11445. Adhikari, S., Uren, A., and Roy, R. (2007) N-terminal extension of N-methylpurine DNA glycosylase is required for turnover in hypoxanthine excision reaction, J Biol Chem 30078-30084. Roy, R., Kumar, A., Lee, J. C., and Mitra, S. (1996) The domains of mammalian base excision repair enzyme N-methylpurine-DNA glycosylase. Interaction, conformational change, and role in DNA binding and damage recognition, J Biol Chem 271, 23690-23697. Huang, H. F., Chopra, R., Verdine, G. L., and Harrison, S. C. (1998) Structure of a covalently trapped catalytic complex of HIV-I reverse transcriptase: Implications for drug resistance, Science 282, 1669-1675. 15. Bowman, B. R., Lee, S., Wang, S., and Verdine, G. L. (2010) Structure of Escherichiacoli AlkA in complex with undamaged DNA, J Biol Chem 285, 35783-35791. 16. Hollis, T., Ichikawa, Y., and Ellenberger, T. (2000) DNA bending and a flip-out mechanism for base excision by the helix-hairpin-helix DNA glycosylase, Escherichia coli AlkA, EMBO J 19, 758-766. 17. 18. 19. 20. 152 Palfey, B. A., and 'McDonald, C. A. (2010) Control of catalysis in flavin-dependent monooxygenases., Arch Biochem Biophys 493, 26-36. van Berkel, W. J. H., Kamerbeek, N. M., and Fraaije, M. W. (2006) Flavoprotein monooxygenases, a diverse class of oxidative biocatalysts., J Biotech 124, 670-689. Entsch, B., Cole, L. J., and Ballou, D. P. (2005) Protein dynamics and electrostatics in the function of p-hydroxybenzoate hydroxylase., Arch Biochem Biophys 433, 297-311. Dym, 0., and Eisenberg, D. (2001) Sequence-structure analysis of FAD-containing proteins., Protein Sci 10, 1712-1728. Jeremy W. Setser 77 Massachusetts Ave., BLDG 68-688D Cambridge, MA 02139 Tel.: (216) 375-5606 Fax: (617) 258-7847 Email: jsetser@mit.edu EDUCATION June 2014 Massachusetts Institute of Technology (MIT), Cambridge, MA Ph.D., Biological Chemistry May 2008 The University of Akron (UA), Akron, OH B.S., Chemistry, summa cum laude HONORS AND AWARDS Koch Institute for Integrative Cancer Research Fellowship (2009), MIT Chemistry Department Award for Outstanding Teaching (2009), UA Chemistry Department Outstanding Senior (2008), National SMART Grant (2007-2008), Emmanuel and Rose Gurin Scholarship in Chemistry (2007-2008), Oelschlager Pin Oak Scholarship (2004-2008) RESEARCH EXPERIENCE 2008-Present MIT Department of Chemistry and HHMI, Cambridge, MA Position: Graduate Research Assistant, Laboratory of Prof. Catherine L. Drennan Investigating enzyme mechanism through structural snapshots using protein X-ray crystallography. Provided mechanistic insight for a required enzymatic step in the biosynthesis of an antimicrobial and antifungal class of natural products known as kutznerides (collaboration with Prof. Christopher T. Walsh, Harvard Medical School). The enzyme in question, KtzI, uses a bound flavin cofactor, reducing equivalents from NADPH, and molecular oxygen to install a hydroxyl group on the side-chain nitrogen of the amino acid L-ornithine, which is subsequently incorporated into the kutzneride scaffold. KtzI was structurally characterized after being subjected to various chemical and environmental factors, capturing the enzyme in several states along its catalytic trajectory. These states suggest that novel conformational changes of both the protein backbone and flavin cofactor occur during the enzymatic cycle of KtzI, and this drastic rearrangement was recapitulated in the protein crystal. - Collaborated with Prof. Leona D. Samson (MIT) to elucidate the molecular interactions of a human DNA repair protein, alkyladenine DNA glycosylase (AAG), both in complex with inhibitor DNA, and in a low-affinity 'searching state' on DNA. When taken together, these studies allow us to compare how AAG interacts with substrates compared to inhibitors, and also provide evidence for the searching mechanism of this enzyme. SKILLS Technical: bacterial cell culture, recombinant protein expression and purification including selenomethionine derivatization, molecular biology, high-throughput (Formulatrix,TTP Labtech, Art Robbins Instruments) and anaerobic (Coy Lab Products, MBraun) protein crystallization and imaging, single-crystal X-ray data collection and processing using in-house (Rigaku) and synchrotron (APS, ALS, CHESS) facilities, small-angle X-ray scattering (SAXS) sample preparation and data collection (CHESS), solving and refinement of protein co-crystal structures, enzyme assays, UV-Vis spectroscopy. Computer: Linux-based OS, Windows, Mac OS, Microsoft Office, Adobe Illustrator, experienced with most major crystallography software packages including but not limited to: HKL/HKL2000, SCALEPACK, CCP4, PHENIX, CNS, SHELX, SHARP, Coot, PyMOL, UCSF Chimera. 153 PUBLICATIONS 3. J.W. Setser, J.R. Heemstra, C.T. Walsh, C.L. Drennan. Crystallographic evidence for drastic conformational changes in the active site of a flavin-dependent N-hydroxylase. In Preparation. 2. J.W. Setser, G.M. Lingaraju, C.A. Davis, L.D. Samson, C.L. Drennan (2012) Searching for DNA lesions: Structural evidence for lower- and higher-affinity DNA binding conformations of human alkyladenine DNA glycosylase. Biochemistry 51, 382-390. 1. G.M. Lingaraju, C.A. Davis, J.W. Setser, L.D. Samson, C.L. Drennan (2011) Structural basis for the inhibition of alkyladenine DNA glycosylase (AAG) by 3,N 4-ethenocytosine containing DNA. J Biol Chem 286, 13205-13213. ORAL PRESENTATIONS Apr. 2014 Apr. 2013 Feb. 2013 June 2012 Mar. 2010 Interview Seminar at Constellation Pharmaceuticals "Mechanistic crystallography of a flavoenzyme involved in antibiotic biosynthesis" MIT Chemistry Student Seminar Series "Structural investigation of a flavin-dependent N-monooxygenase" Protein Structure Function Supergroup Meeting "Structural investigation of a flavin-dependent N-monooxygenase" MIT Department of Biology Retreat "Structural insight into the searching mechanism of human alkyladenine DNA glycosylase (AAG)" Boston DNA Repair and Mutagenesis Seminar Series "Structural insight into the catalytic and searching mechanism of human alkyladenine DNA glycosylase (AAG)" POSTER PRESENTATIONS July 2012 Aug. 2010 Jan. 2010 June 2009 May 2009 Gordon Research Conference - Enzymes, Coenzymes, and Metabolic Pathways "Structural investigation of a flavin-dependent N-hydroxylase" 240th Meeting of the American Chemical Society "Crystallographic study of a human DNA repair protein: alkyladenine DNA glycosylase (AAG)" MIT Biology Department Research Symposium and Poster Session "Crystallographic study of a human DNA repair protein: alkyladenine DNA glycosylase (AAG)" MIT Biology Retreat Poster Session "Crystal structure of human 3-methyladenine DNA glycosylase (AAG) complexed with 3,N4-ethenocytosine containing DNA" MIT Center for Environmental Health Sciences Poster Session "Crystal structure of human 3-methyladenine DNA glycosylase (AAG) complexed with 3,N4-ethenocytosine containing DNA" TEACHING AND MENTORING EXPERIENCE Dec. 2012 2010-2012 Summer 2011 154 Laboratory Mentor, Drennan Laboratory, MIT - Trained and mentored a rotation graduate student from the Biology Department resulting in the co-crystallization and structural determination of an enzyme-ligand complex. Laboratory Mentor, Drennan Laboratory, MIT " Trained and mentored an undergraduate conducting research in the Drennan Lab. Participant, HHMI-MIT Summer Mentoring Seminar, MIT * Enrolled in an HHMI-affiliated training course at MIT to learn and refine effective undergraduate mentoring strategies in laboratory research. TEACHING AND MENTORING EXPERIENCE (continued) Fall 2010 Spring 2009 Fall 2008 Laboratory Teaching Assistant, MIT Advanced Biochemistry " Supervised and instructed graduate students (10) in biochemical techniques. " Observed and graded overall performance. Laboratory Teaching Assistant, MIT Biochemistry & Organic Lab " Supervised and instructed undergraduate students (14) in standard biochemical techniques. " Observed and graded presentations and lab reports. HHMI Teaching Assistant, MIT Principles of Chemical Science - Taught a twice-weekly recitation class of 23 undergraduates for an HHMI-funded chemistry course focused on bringing medical and biochemical examples into freshman chemistry. - Addressed students' questions and needs on an individual basis and graded assignments and tests. LEADERSHIP AND DEVELOPMENT 2008-Present 2012-Present 2012-2014 2010-2013 2013 2010-2012 2012 MIT Chemistry Graduate Student Committee, President, Treasurer, Member " Advocated for chemistry graduate students' interests by working with the department head and senior department officials to amend departmental procedures (e.g. Ph.D. candidacy exams). " Improved the quality of life for chemistry graduate students (230 students) by organizing and executing various events including forum discussions and socials (e.g. boat cruise, BBQ). " Presided over 15 executive committee members and a $15,000 annual budget. MIT Chemistry Career Panel, Founding Member - Created and secured departmental funding ($1450) for an annual series of 10 career panel discussions. - Recruited and prepared individual panel organizers (10) and panelists (38), receiving a panel-by-panel approval rating of 92%. - Enlisted incoming panel leadership and provided knowledge transfer and guidance. MIT Chemistry Graduate Student Survey Task Force, Founding Member - Formulated survey questions and analyzed responses from chemistry graduate students. - Communicated results through written and oral presentations to the MIT chemistry faculty and students. MIT Graduate Student Council, Representative from the Department of Chemistry " Expressed the sentiments and opinions of the chemistry graduate student body during meetings with 60 graduate student Representatives from across the Institute. - Voted on agenda items on behalf of all chemistry graduate students. Strategic Decision Making in the Biomedical Business, MIT Sloan Course * Explored the product development life cycle for four biomedical industries: smallmolecule drugs, biological therapeutics, medical devices, and diagnostics/personalized medicine. MIT Chemistry Outreach Program " Teamed up with fellow graduate students to perform chemistry demonstrations at local schools. NERCE Medicinal Chemistry and Preclinical Development Workshop, Participant - National Institutes of Health workshop describing resources available for translational research. 155 ADDITIONAL RESEARCH EXPERIENCE 2006-2008 UA Department of Chemistry, Akron, OH Position: Undergraduate Researcher, Laboratory of Prof. Daniel J. Smith Created a polymeric bandage imbued with a functionalized dextran sugar for the release of nitric oxide to aid slow-healing wounds. REFERENCES Ph.D. Advisor Catherine L. Drennan Professor of Chemistry and Biology HHMI Investigator and Professor Massachusetts Institute of Technology 77 Massachusetts Ave, BLDG 68-680 Cambridge, MA 02139 Tel.: 617-253-5622 Email: cdrennan@mit.edu Thesis Committee Chair Elizabeth M. Nolan Pfizer-Laubach Career Development Assistant Professor of Chemistry Massachusetts Institute of Technology 77 Massachusetts Ave, BLDG 16-573B Cambridge, MA 02139 Tel.: 617-452-2495 Email: Inolan@mit.edu Faculty Advisor, MIT Chemistry Career Panel Bradley L. Pentelute Assistant Professor of Chemistry, MIT Associate Member, Broad Institute of Harvard and MIT 77 Massachusetts Ave., BLDG 18-596 Cambridge, MA 02139 Tel.: 617-324-0180 Email: blp@mit.edu 156