Ψ IRES pMIG Insertion: TCR alpha only or alpha_P2A_beta SCID Phoenix cells (293T cells transfected with pCL-Eco) MIG CMV-env (Mo-MuLV) RSV-gag-pol (Mo-MuLV) pMIG pMIG pMIG SCID or Ca-KO BM cells Anti-GAD TCR + or – B Lymphocytes TCR Retrogenic Induction High Levels GAD65 Autoantibodies T Cell Islet Accumulation in Type 1 Diabetes is a Tightly Regulated, Cell-Autonomous Event Lennon et al Immunity 31, 643-653, 2009 Unique autoreactive T cells recognize insulin peptides generated within the islets of Langerhans in autoimmune diabetes James F Mohan,…& Emil R Unanue Nature Immunology March 2010 Insulinoma Only islets + Rag-/- islets Type A type B Type B CD11c islets Insulin granules Conserved T Cell Receptor Alpha Chain Induces Insulin Autoantibodies Kobayashi et al PNAS 105:10090-94 2008 Anti-B:9-23 TCR alpha Transgene No Transgene Nat Immunol. 2010 Mar;11(3):225-31. Epub 2010 Feb 7. Chromogranin A is an autoantigen in type 1 diabetes. Stadinski, …Kappler, Haskins Peptide WE14 bound to the NOD mouse major histocompatibility complex class II molecule I-A(g7) in an atypical manner, occupying only the carboxy-terminal half of the IA(g7) peptide-binding groove. Antigen Presenting Cell Peptide Va V D Ja Chr. 14 J Chr. 6 Antigen Recognition by CD8+ T Cells T cell T cell receptor V Va class I MHC 2m cell T. DiLorenzo Kuby Immunology AA Peptide Side Chains Peptide g7 I-A GROOVE “TEETH” TEETH T Cell Receptor Analogy Child with IPEX syndrome Awaiting Bone Marrow Transplant 9 Months of Age IPEX: Immune Dysfunction, Polyendocrinopathy, Enteropathy, Xlinked • Scurfin gene (Foxp3/JM2) - Controls Regulatory T Cells! • Approximately 80% of children with syndrome develop diabetes! • Bone marrow transplant can reverse “Typical” Insulitis of man differs from peri-insulitis NOD mouse: A MODEL -cells APC ISLET t Ag t t T cells Pancreatic Lymph Node Mathis/Benoist MAN ? NOD MOUSE TRAV5D-04+TRAJ53 Restriction? Insulin B:9-23: SHLVEALYLVCGERG? IAg7 DR3/DR4 Homann 2006,JCI Natural T Regulatory Cells Antigen Specific T Reg IPEX Syndrome MAN: NOD anti-B9-23insulin TCR: foxP3 mutant DM in days of birth! foxP3 mutant DM ENVIRONMENTAL FACTORS Incidence type 1 DM Increasing 3%/year > 30 years! Protective Factor Decreasing -Hygiene Hypothesis – Bach NEJM 347:911, 2002 Triggering Factors -Congenital Rubella-Rubenstein Diabetes 31:1088, 1982 -Kilham Rat Virus (BB-DR rat)-Zipris J. Immunol 174:131, 2005 -Poly-IC Induction Interferon Alpha-Devendra Diabetes 54 2005 -Dietary Factors-Scott Ann Rev Nutr 26:175, 2006 Natural T Regulatory Cells T Cell Receptor Antigen Specific T Reg Amino Acid Sequence of Mouse 1 and 2 and Human Insulin Leader 1: MAL LVHFLPLLALLALWEPKPTQA Leader 2: MALWMRFLPLLALLFLWESHPTQA Human : MALWMRLLPLLALLALWGPDPAAA 20 10 B Chain 1: FVKQHLCGPHLVEALYLVCGERGFFYTPKS B Chain 2: FVKQHLCGSHLVEALYLVCGERGFFYTPMS Human : FVNQHLCGSHLVEALYLVCGERGFFYTPKT B:9-23 25 30 40 50 C-Peptide 1: RREVEDPQVEQLELGGSPG…..DLQTLALEVARQ C-Peptide 2: RREVEDPQVAQLELGGGPGAGDLQTLALEVAQQ Human : RREAEDLQVGQVELGGGPGAGSLQPLALEGSLQ 55 60 70 A Chain 1: KR GIVDQCCTSICSLYQLENYCN A Chain 2: KR GIVDQCCTSICSLYQLENYCN Human : KR GIVEQCCTSICSLYQLENYCN 88 100 80 Lack of progression to diabetes of NOD mice lacking both insulin native genes. % Diabetes Free 100 ins1-, ins2-, Tg+ (n=25, P<0.01) 80 ins1+, ins2-, Tg+ (n=25) 60 40 20 0 0 10 20 30 40 50 60 Weeks of age Ins1-, ins2-: n= 25 Ins1+, ins2-: n= 25 21 23 10 14 2 4 1 1 Life table update 5/19/05 Nakayama Nature 435:220,2005 Insulin is the primary antigen and precedes IGRP in hierarchy of autoantigens Insulin specific T cells Insultis Epitope and antigen spreading, expansion Diabetes Krishnamurthy et al JCI:116:3258, 2006 Is there a primary antigen or immune response to multiple antigens required for autoimmunity? T cells specific for multiple antigens T cells specific for one antigen Insulitis Insulitis OR Epitope and antigen spreading, expansion Diabetes Expansion of T cells Diabetes Krishnamurthy et al JCI:116:3258, 2006 Natural peptides selected by diabetogenic DQ8 and murine I-Ag7 molecules show common sequence homology Suri et al JCI 115:2268, 2005 Structure of Human insulin peptide DQ8, Lee et al Nature Immunology 6:501, 2001 Crystal DQ8;B:9-23: S H L V E A L Y L V C G E R G Wiley Nat Immunol P1 Preferred AA in Bound Peptides I-Ag7 v,e,q 12% DQ8 % amino acid at position E,d P4 I,L P6 P9 A,s D,E 20% 30,11% 45% A,S A,V,s 27,17% 19% 20% E,D 60,25% NOD Mouse anti-islet T Cell Clones/transgenics/retrogenics Clone BDC2.5 BDC10.1 BDC6.9 NY4.1 CD4/CD8 CD4 CD4 CD4 CD4 Source Spleen Islet Islet Islet Antigen TCRα/β 7D-6/2 17/20 5D-4*01/2 5D-4*04/ Tetramer TransgenicRetrogenicComment yes yes yes 10.1 same mimotope yes yes DM+++ retrogenic yes yes Strain specific, chr 6 yes yes yes DM transgenic Phogrin-13 CD4 Phogrin-18 CD4 10.23 CD4 Immun LN IA2β 640-659 Immun LN IA2β 755-777 IA2 676-688 13-2/3 10/16 13-4/4 2H6 CD4 BDC12-4.1 CD4 BDC12-4.4 CD4 BDC 8-.1.1 CD4 BDC12-1.19 CD4 BDC12-2.35 CD4 BDC6-4.3 CD4 BDC12-2.4 CD4 6C5 CD4 Panc LN Islet Islet Immun LN Islet Islet Islet Islet islet 21/31 5D-4*04/1 5D-4*04/5 5D-4*04/15 13-1/19 7-4/13-1 5D-4*04/1 5A CD4 B16.3 CD4 BW5147 CD4 PA15.14B CD4 IA4 CD4 PA17.9G7 CD4 PA18.10F10 CD4 PA18.9H7 CD4 530.45.19 CD4 Immun Spl GAD spleen GAD65 pp286–300 GAD65 pp206–220 spleen GAD pp206–220 spleen GAD pp217–236 GAD pp284–300 GAD pp510–524 GAD pp524–538 GAD pp530–543 G9C8 CD8 Islet insulin B:15-23 yes 8.3 CD8 Islet IGRP 206-214 yes insulin B:12-25 insulin B:12-22 insulin B:12-22 insulin B:12-22 insulin B:9-23 insulin B:9-18 insulin B:9-23 insulin B:9-16 yes yes yes yes yes yes yes yes 9D-4 6-2/5 3/13-2 6D-6/13-3 6-6/2 6-2/4 7-4/4 21/15 (5D-4/2) yes yes yes yes yes yes yes Author Haskins Haskins Haskins Santamaria insulitis retrogenic insulitis retrogenic Hutton Hutton Hutton TGFβ protection DM retrogenic DM retrogenic DM retrogenic DM retrogenic DM retrogenic young NOD Zekzer Wegmann Wegmann Wegmann Wegmann Wegmann Wegmann Wegmann Fathman suppress DM suppress DM no effect retrogenic no effect retrogenic no effect retrogenic no effect retrogenic no effect retrogenic no effect retrogenic Zekzer McDevitt McDevitt Vignalli Tisch Vignalli Vignalli Vignalli Sercarz Wong yes Perforin independent, Fas Santamaria Hafler Peakman DRB1*0401 A1-15 DRB1*0401 C19-A3 Peakman Gottlieb B:9-23 DQ8 Durinovic-Bello DRB1*0401 CD4 73-90 A2 CD8 PPI:15-24 Expanded T cells from pancreatic lymph nodes of type 1 diabetic subjects recognize an insulin epitope Kent et al, Nature 435:224, 2005 • Pancreatic LN: Single cell cloning - PHA • 2/3 Patients Clonal expansion duration diabetes 29 and 15 years • Vbeta29-1*03J2-3(50%)/Valpha8-3*02 J44*01(25%) Vbeta5-1*01 J2-3(52%)/Valpha39*01 J33*01(26%) • DRB1*0401 Restricted Insulin A1-15 • Caveat: High concentration to stimulate 100uM BDC The insulin A-chain epitope recognized by human T cells is posttranslationally modified Mannering et al, JEM 202:1191-1197, 2005 • CD4 T cells cloned with CFSE method from peripheral blood of one patient with diabetes and one child with insulin autoantibodies • Subset of the clones reacted with insulin A-chain 1-13 epitope • T Cells DR restricted and only reacted with peptide with vicinal disulfide bond between adjacent cysteines A6 and A7 • No reactivity with this peptide of clones from two normal controls with DR4 • Oral report by Sally Kent that their A1-15 peptide reactive T cells from pancreatic lymph node do not require vicinal disulfide cross-link Ins2 deficiency augments spontaneous HLAA*0201-restricted T cell responses to Insulin Jarchum and DiLorenzo J Immunol 2010 vol 184 Humanized HLA-A2 Mice lacking Insulin 2! Ins B:10-18 CD8 Elispot Thymus-specific deletion of insulin induces autoimmune diabetes. Fan et al EMBO Journal 28:2812-2824 2009 • Ins1-/- mice (only) with cre mediated thymic mTEC deletion of ins2 develop autoimmune diabetes by age 3 weeks. • Diabetes develops in H-2b mice! • ELISPOT Responses to Insulin B:9-23 though mice do not have I-Ag7. • MYSTERIES: Need for Ins1-/-; Lack protection H-2b; Presentation B:9-23 by H2b. The frequency and immunodominance of Isletspecific CD8+ T-cell responses change after Type 1 Diabetes Diagnosis and Treatment Martinuzzi et al Diabetes 57:1312-1320, 2008 7-16 months post onset most ELSIPOT (HLA-A2) responses decrease PREPROINSULIN PROINSULIN New Responses “Santamria” NRP(IGRP206-214): Class I (Kd)Recognized Peptide • CD8 T cell from NOD islets (e.g. clone 8.3) • Conserved Valpha/ nDn/ J alpha (Va17,Ja42) Vbeta not conserved but contributes • Accelerated diabetes TCR Transgenic • Mimotope Defined-Kd Tetramer Produced NRP=KYNKANWFL; NRP-V7: KYNKANVFL • Higher Avidity Peptide/Tetramer V7 • 30% Intra-islet post 9 weeks >.5% in Blood Predicts Diabetes NOD Mice Tan et al., JCI 1/2003 Female NOD Mice Peripheral Blood Kd Tetramer Analysis NRP-V7 Peptide (KYNKANVFL) Kd Kd Avidin 1.2 1 0.8 0.6 0.4 0.2 0 5 10 14 18 21 Age (weeks) Diabetes 24 27 30 % NRP-V7 tetramer+ CD8+ cells % NRP-V7 tetramer+ CD8+ cells Kd 1.2 1 0.8 0.6 0.4 0.2 0 5 9 12 15 18 21 24 Age (weeks) No Diabetes 27 30 CTLs are targeted to kill β cells in patientswith type 1 diabetes through recognition ofa glucose-regulated preproinsulin epitope Ania Skowera,…. and Mark Peakman JCI 2008:118 3268-3271. Interferon gamma HLA-A2 ELISPOT peripheral blood Patients+ (SI>3) DM vs Controls Screening of Peptide Fractions by 51Cr Release Cytotoxicity Assay Method Used to Discover IGRP CD8+ CTL APC CTL T. DiLorenzo Antigens for CD8+ T Cells in Type 1 Diabetes Patients Antigen Position MHC Why examined GAD65 114-123 A2 MHC binding IAPP 5-13 A2 MHC binding Insulin B10-18 A2 Proteasome cleavage B14-22 A3, A11 Proteasome cleavage B15-23 A24 MHC binding B15-24 A24 Proteasome cleavage B17-26 A1, A3, A11 Proteasome cleavage B18-27 A1, A2, B8, B18 Proteasome cleavage B20-27 A1, B8 Proteasome cleavage B21-29 A3 Proteasome cleavage B25-C1 B8 Proteasome cleavage B27-C5 B8 Proteasome cleavage GAD, glutamic acid decarboxylase; IAPP, islet amyloid polypeptide DiLorenzo Antigens for Islet-infiltrating CD8+ T Cells in NOD Mice Antigen Position MHC T cells How identified DMK 138-146 H-2Db AI4; islet Positional scanning libraries 206-214 H-2Kd 8.3; islet MHC purification and mass spectrometry 21-29 H-2Kd Islet MHC binding 225-233 H-2Db Islet MHC binding 241-249 H-2Db Islet MHC binding 324-332 H-2Kd Islet MHC binding B15-23 H-2Kd G9C8; islet Expression cloning IGRP Insulin 1/2 DMK, dystrophia myotonica kinase GAD, glutamic acid decarboxylase DiLorenzo IGRP, islet-specific glucose-6-phosphatase catalytic subunit-related protein Toma et al. Recognition of a subregion of human proinsulin by class I-restricted T cells in type 1 diabetic patients PNAS 102:10581, 2005 • Selected 8-11mer peptides of proinsulin • PBMCs of 29/32 (90%) recent+long term diabetics responded IFNgamma in ELISPOT assay versus minimal response of normals • Significant Peptides often overlapped insulin B chain peptide B:9-23(=Proins 33-47); Proins 3442(B10-18); Proins 41-50(B17-26);Proins 4251;Prins44-51; but also B chain-C-peptide (49-57) • Multiple class I alleles, including A1 and B8 T cell epitopes on the diabetes autoantigen Phogrin (IA-2beta) are conserved among different species C terminus TM PTP N terminus Peptide 2: Amino acids 643-658 GADPSADATEAYQEL (rat) GADPSADATEAYQEL (mouse) GGDPGADATAAYQEL (human) Peptide 7: Amino acids 762-777 KNRSLAVLTYDHSRI (rat) KNRSLAVLTYDHSRI (mouse) KNRSLAVLTYDHSRV (human)