UTILITIES ABOUT US: Sierra Infosys Inc, provides IT solutions, specializing in Enterprise Asset Management system (eFACiLiTY) and Enterprise Resource Delete text and place photo here. Planning software’s like SAP, Oracle, Microsoft Dynamics etc. We also provide software development, design and integration; on-site software optimization. Sierra Infosys Inc delivers solutions that address customer’s requirement for a comprehensive asset management system with eFACiLiTY that can be delivered quickly and cost-effectively into complex environments. We provide staffing, managed, life-cycle development, domestic and offshore resource, legacy application development and maintenance, software testing, and infrastructure support services. Sierra Infosys, Inc. Industery Focused Innovative Solution MODULES: ŖAsset Management ŖUtilities Billing System ŖMaintenance Management ŖStores/Inventory ŖDrawing Management Management ŖDocument Management eFACiLiTY can easily integrate seamlessly with any of the leading ERP systems like SAP or Oracle. Furthermore it can incorporate mobile and wireless technologies which enable your organization to capitalize on EAM system benefits that cannot be exploited using traditional, manual processes. Sierra’s eFACiLiTY Facility Management System suite is the only complete set of applications that has inexpensive licensing options and run entirely on the internet, enabling you to cut costs across business intelligence, systems integration and facilities management functions. Sierra Infosys Inc, a trusted SAP services partner in Public Sector domain in the US has incorporated the best practices adopted by SAP into its implementation standards. Sierra and SAP leverage their strengths to jointly address customer’s requirements effectively. CONCEPT: ŖThe main function of facilities management systems was originally focused on the energy conservation and labor savings through the automation of equipment/asset management. ŖToday, facilities management systems are for achieving safety, livability, energy conservation, labor saving and improving ŖHelpdesk ŖVisitor ŖTime & Knowledge Base customer service in an integrated environment effectively managing and controlling information. Management & Attendance ŖProperty Management ENERGY MONITORING & REPORTING: ŖDraw energy consumption trends (weekly, monthly, yearly etc.) ŖAlerts on consumption beyond set limits ŖMail Room Service ŖKey Process Indicators (KPI) ŖBMS Integration ŖEnergy Dash Boards / Pie Charts for easy analysis ŖView detailed consumption data with comparison Ŗ Recording history of reasons for increase or decrease in consumption for future analysis ŖGreen building certification related reports ŖGreen house gas accounting / Enterprise carbon accounting 6001 Savoy Drive, Suite #210, Houston, TX-77036 ŖTel 713.747.9693 ŖFax 713.222.2434 Ŗwww.sierratec-us.com MAINTENANCE MANAGEMENT - FEATURES: eFACiLiTY’s Maintenance Management system provides Ŗ'PVGTRTKUG#UUGV/CPCIGOGPV Ŗ2TQRGTV[/CPCIGOGPVCPF%QORWVGTK\GF/CKPVGPCPEG/CPCIGOGPV HGCVWTGUVJCVHCEKNKVCVGUVJG#UUGV/CPCIGTUVQ ŖVTCEMOCKPVCKPCPFOCPCIGVJGKTCUUGVURTQRGTVKGUHCEKNKVKGU CPFGSWKROGPVU Ŗ&TCYGPGTI[EQPUWORVKQPVTGPFU YGGMN[OQPVJN[[GCTN[GVE Ŗ#NGTVUQPEQPUWORVKQPDG[QPFUGVNKOKVU Ŗ'PGTI[&CUJ$QCTFU2KG%JCTVUHQTGCU[CPCN[UKU Ŗ8KGYFGVCKNGFEQPUWORVKQPFCVCYKVJEQORCTKUQP Ŗ 4GEQTFKPIJKUVQT[QHTGCUQPUHQTKPETGCUGQTFGETGCUGKP EQPUWORVKQPHQTHWVWTGCPCN[UKU Ŗ)TGGPDWKNFKPIEGTVKHKECVKQPTGNCVGFTGRQTVU Ŗ)TGGPJQWUGICUCEEQWPVKPI'PVGTRTKUGECTDQPCEEQWPVKPI CURRENT ROAD MAP: Ŗ#DKNKV[VQEQPVTQNUEJGFWNGGSWKROGPVUQRGTCVKQP Ŗ+PVGITCVKQPYKVJ5EJPGKFGT*QPG[YGNN'$+5KGOGPU,QJPUQPU$/5 Ŗ5KNXGTNKIJVDCUGF/QFWNGYKUG7UGTYKUGEQPHKIWTCDNG&CUJDQCTFU Ŗ5/5'OCKN#NGTVUQP-2+UDCUGFQPVJTGUJQNFU Ŗ#WVQOCVGF 5EJGFWNGFGOCKNKPIQH4GRQTVU Ŗ5KNXGTNKIJVUETGGPUHQTKORQTVCPVCPFYKFGN[WUGFUETGGPU 6001 Savoy Drive, Suite #210, Houston, TX-77036 ŖTel 713.747.9693 ŖFax 713.222.2434 Ŗwww.sierratec-us.com SOFTWARE SPECIFICATION: ŖMicrosoft’s .NET Framework ŖBrowser based thin-client interface ŖSupports Oracle/MSSQL/MSSQL Express ŖLicense free runtimes for reporting ŖEmail, SMS, MMS Messaging ŖCross browser compatible ŖLanguage of your choice ŖSupports MS Exchange, LDAP ŖBuilding Management Systems (BMS) Integration ŖReady for integration with Microsoft Active Directory ŖOracle Single Sign-on ŖPDA extension with Microsoft Pocket PC ŖWAP extension ŖTable, Field, Activity wise Audit Trail ŖSecurity Policy Management To Minimize Costs Maximize Efficiency Enhance Customer Satisfaction Contact us USA : HOUSTON Sierra Infosys Inc. 6001 Savoy Dr, Suite 210 Houston, TX 77036, USA USA : RICHMOND Sierra Infosys Inc. Bywater Drive, Richmond, VA 23233, USA Phone: +1-713-747-9693 Fax : +1-713-222-2434 Phone: +1 480 282 8571 Mr. Senthil Kumar - President senthil@sierratec-us.com Mr. Prasanna Chandran – Account Executive - SAP prasanna@sierratec-us.com