Recombinant Botulinum neurotoxin type F(botF) Catalog Number: CSB-EP341192CLQ Product Name: Recombinant Botulinum neurotoxin type F(botF) Alternative names: Bontoxilysin-F Catalog Number: CSB-EP341192CLQ Botulinum toxin acts by inhibiting neurotransmitter release. It binds to peripheral neuronal synapses, is internalized and moves by retrograde transport up the axon into the spinal cord Relevance : where it can move between postsynaptic and presynaptic neurons. It inhibits neurotransmitter release by acting as a zinc endopeptidase that catalyzes the hydrolysis of the '58-Gln-|-Lys-59' bond of synaptobrevins-1 and -2. Mol. Weight: 63kD Product Info : His-tagged Source: E.coli derived Images Purity: >90%(SDS-PAGE) Storage Buffer: 20mM Tris-HCl, 0.5M NaCl, PH 8.0,50% glycerol Storage : Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. MPVAINSFNYNDPVNDDTILYMQIPYEEKSKKYYKAFEIMRNVWIIPERNTIGTNPSDFDPPA SLKNGSSAYYDPNYLTTDAEKDRYLKTTIKLFKRINSNPAGKVLLQEISYAKPYLGNDHTPID EFSPVTRTTSVNIKLSTNVESSMLLNLLVLGAGPDIFESCCYPVRKLIDPDVVYDPSNYGFG AA sequence: SINIVTFSPEYEYTFNDISGGHNSSTESFIADPAISLAHELIHALHGLYGARGVTYEETIEVKQA PLMIAEKPIRLEEFLTFGGQDLNIITSAMKEKIYNNLLANYEKIATRLSEVNSAPPEYDINEYKD YFQWKYGLDKNADGSYTVNENKFNEIYKKLYSFTESDLANKFKVKCRNTYFIKYEFLKVPNL LDDDIYTVSEGFNIGNLAVNNRGQSIKLNPKIIDSIPDKGLVEKIVKFCKSVIPRK "Sequence of the gene encoding type F neurotoxin of Clostridium botulinum." References: East A.K., Richardson P.T., Allaway D., Collins M.D., Roberts T.A., Thompson D.E. FEMS Microbiol. Lett. 75:225-230(1992)