! "##$!%! &'(! ")#*+! "##$! ,+-.()/01!2,1,!+0&-#+! .#1,3(!4! Compiled By: A frika Bambaataa, M alika Saphire A nd K ing M ar k L uv 5#+&(+&/! Infinity Lesson One: Basic Moorish Study .................................................................................... 1! Infinity Lesson Two: Prophecies and Hadiths of NDA ............................................................... 16! Infinity Lesson Three: Moorish Science Adept Questionary....................................................... 42! Infinity Lesson Four: Islamism World's First Creed Elihu's Lesson 5 (1973) ............................ 45! ,QILQLW\/HVVRQ)LYH6ZLIW$QJ(/V(OLKX¶V/HVVRQ .............................................................. 47! ,QILQLW\/HVVRQ6L[(OLKX¶V$GHSW/HVVRQ QG(GLWLRQ ................................................... 53! ,QILQLW\/HVVRQ6HYHQ(OLKX¶V$GHSW/esson #240 ..................................................................... 55! ,QILQLW\/HVVRQ(LJKW(OLKX¶V$GHSW/HVVRQ ...................................................................... 57! ,QILQLW\/HVVRQ1LQH(OLKX¶V$GHSW/HVVRQ ....................................................................... 60! Infinity Lesson Ten: 101 Koran Questionary............................................................................... 63! Infinity Lesson Eleven: A look at Moorish Muslims Their Architecture and Influences in Indian Country ......................................................................................................................................... 69! Infinity Lesson Twelve: A message to all members of Sultanates of Murakush ........................ 81! Infinity Lesson Thirteen: An Indigenous Peoples History 101.................................................... 82! Infinity Lesson Fourteen: Black Native American History ......................................................... 84! Infinity Lesson Fifteen: What was you called before 1492? ....................................................... 89! Infinity Lesson Sixteen: Benjamin Banna Ka ............................................................................ 103! Infinity Lesson Seventeen: The Zodiac Constitution ................................................................. 132! Infinity Lesson Eighteen: A Look at the Term Resident ........................................................... 139! Infinity Lesson Nineteen: Basics of Drafting a Suite ................................................................ 143! i -+6-+-&7!1(//#+!#+(8!"0/-5!3##)-/'!/&,97! "If I could just get you all thinking again, you would save yourselves." -Noble Drew Ali . . T hese archaeological finds, are of the ancient natural people in South West Amexem / Central Africa / South America. These lands are all anciently, Old Central Amexem, or anthropologically referred to as 'Old Mex' (Olmec). World Historians and Anthropologists are aware that the land masses (the continents) were all connected. What is known as Africa today, in the east is ancient Tamari. What is known as North, Central, and South America were modernly called Africa. . 31. What is the modern name for the Moabites? Moroccans 32. Where is the Moroccan Empire? Northwest A mexem 33. What is the modern name for Amexem? A frica (Above from the '101 Questions for Moorish Americans' by Noble Drew Ali) . Some E uropean Social E ngineers (and reconstructors of history) have exercised their Demointent to distort history and disclaim many of these ancient artifacts; denying their relationships to the Original Ancient Meso-Americans. Attempts have been made to misrepresent these stone heads and other artifacts, scripts, and instruments as being unrelated to the true forebearers ± being the (now mis-named) natural people, branded as negroes, blacks, and coloreds, etc. These artifacts do not relate to an alleged µRWKHU SHRSOH¶- and stand on their own evidentiary merit. Truth needs no apology. A few misled Asiatics amongst our own continue to support the separation tactics initiated by Europeans, and propagate teachings that separate their brother Moors of Old Amexem (Old Mex / Olmecs) from the peoples known as Asiatics/Africans today. The Mayans, the Incas, and the Aztecs of Ancient Central Amexem / Africa / America are anthropologically known as the Nauhautian (mixed) Moors. They too, are descendants from Ancient Moabites / Africans / Asiatics. . O ther compromised divisionists seek to create divisions amongst their own people. Nevertheless, true world History, and knowledge of pre-Columbian historical evidence consistently proves their claims to be void of validity or truth. Sincere and studious research counters and shows contradictions in their Eurocentric claims, and counter to their failures to acknowledge the Ancient Asiatic / Africans / Moabite / Canaanite Progenitors. These same disclaimers admit, on the other hand, that the so-called Canaanites / Africans are the Mothers and Fathers of Civilization. Note the Clear Contradiction! .. . 1 . A ncient Cosmology T emple Ruins at Palenque These ruins (and others) at Piedras Negras, Yaxchilan, Tikal, etc., and the Ancient People and builders of these Complexes, long predate the later Mayans known today. . . Moors in A merica . The word Moor comes from the Latin word M aures and the Greek adjective M auros, meaning dar k or black (denoting skin color) Circa 46BC. See: The Oxford English Dictionary (New York, Oxford University Press, 1977, p. `846.) The term Moor is also used as a transitive verb (to moor a ship). See: :HEVWHU¶V1HZ:RUOG'LFWLRQDU\ (Third College Edition, 1988), p.881. !" The word Admiral comes from the Arabic word Ameri, meaning commander (Moorish navigator). See: The Rudder and Sextant (Second Revision March 1st 1989), p.6. The root A mir is A mer, meaning A merican! See: :HEVWHU¶V New World Dictionary (Third College Edition, 1988), p.44. The word A merican means a native of America; originally applied to the aboriginals, or copper-colored race, found here by the Europeans; but not applied to the descendants of Europeans born in America. See: 1RDK:HEVWHU¶V2ULJLQDO 1828 ed., of American Dictionary of the English Language. The term American, etymologically is; Commander Loves Riches. Amir Commander (Arabic word), Amor. Love (French word), Rica: Rich (Spanish word) !" C irca 480 A.D., The Monastic Brotherhood (C atholic Moors from Morocco) landed on present day Connecticut (North A merica), near the coast of Long Island Sound. The inscription found on granite outcrops in Cockaponset Forest, C N., and the inscription on H aj M inmoun Rock located in Figuig toward the east of Morocco, confirms the voyage. See: Moroccan daily Newspaper (Le Matin D Sahara Et Du Magred, September 16, 1995). For more info contact The Permanent Mission for Morocco in New York. New York. C irca 700-800 A.D., Several Muslim Schools in North America; Valley of Fire (Nevada), Mesa Verde (Colorado), Mimbres Valley (New Mexico) and Tipper Canoe (Indiana). North African Arabic and Old Kufic Arabic scripts are engraved on rocks, test, diagram, charts including writing, reading, arithmetic, religion, history, geography, mathematics, astronomy and sea navigation. For more info, contact: D r. Bar ry Fell, at H arvard University. C irca 1492 A.D., On Monday October 21, 1492, Christopher Columbus admits in his papers, while sailing near Cuba, he saw a mosque on top of a beautiful mountain. The ruins of mosques and minerats with inscriptions of Quranic verses have been found in C uba, Mexico, 2 T exas and Nevada. The dress of the Indian 0RRULVK ZRPDQ ORQJ YHLOV´ WKH PHQ ³%UHHGFORWKHVSDLQWHG in the style of Moorish GUDSHULHV´LQG renada and T rinidad« See: Precolumbian Musli ms in the Americas by Dr. Yousef Mroueh . The descendants of these North American Moors are the present day I roquois, A lgonquin, A nasazi, Hohokam, O lmec, A pache, A rawak, A rikana, C havin, C herokee, C ree, H upa, Hopi, M ak kah, Mohawak, Naca, Zulu, Zuni« These words also, derive from Arabic and Islamic root origins. See: Precolumbian Musli ms in the America by Dr. Yousef Mroueh. . The word I N D I A N is I N D I A like the I N K it means, Black Pigment. See: :HEVWHU¶V1HZ:RUOG'LFWLRQDU\ 7KLUG&ROOHJH(GLWLRQ 1988), p.686 .. The status of the descendants of the Moorish Inhabitants of Spain and Portugal on American soil is FREE WHITE PERSONS (natural men and women). This status does not apply to the Caucasian Race, Aryan Race, or Indo-European Races under the Naturalization Act (Amended by Act. July 14, 1879), I Stat.103,c.3 See: %ODFN¶V/DZ'LFWLRQDU\ (Fourth Ed. P. 797) !" C irca 711 A.D., The Moors that ruled Moslem Spain and Portugal for centuries were black or dark skinned people. See: Golden Age of the Moors, Edited by Ivan Van Serti ma, pgqe 337. . C irca 1503²1517 A.D., An estimated 3,000 Aborigina-American (Moors) were captured from the eastern seaboard of Terra Nova (North America) some of their names are Ali, Melchor, Miguel, Manne, Juan, Pedro, Antonio and Juan-Amarco. A record of that account can be found in the Slave Books of Seville, Valencia, Catalina Spain. They were classified as Negro (Negro means Dead) and Black (dirty and evil). See: African and Native American by Jack D. Forbes, page 24. . C irca 1676 A.D., The Europeans that arrived in New England (North America) described the Aboriginal-Americans (Moors) to be BLACK AS GYPSIES (E-GYPTIANS). . C irca 1763 A.D., On October 7, 1763, King George R., of Great Britain's, Treaty with the Indigenous People (Indians) regarding land acquisitions and demarcation lines in America. The FOUR Colonies distinct and separate governments are called Quebec, East Florida, West Florida and Grenada. 3 See: Washitaw de Duglahmoundyah E mpire, Newspaper, December 1998, F ront Page. . C irca 1774 A.D., The five pointed green star in the center of a field of red is the Moorish flag was the alleged cherry tree that General George Washington, chopped down. See: Moorish Civic Relations Concepts, Volume 14, Page 37. . C irca 1774 A.D., On October 20, 1774, British-American subjects of the British Empire form the First United Stated of America perpetual Constitutions in the Thirteen &RORQLHVFDOOHG³7KH $UWLFOHVRI$VVRFLDWLRQ´´UHFRJQL]HG Moors as Moors not Negroes or Black-A-Moors. See: Journals of the Continental Congress, 75²78. . C irca 1774 A.D., Noah Webster and his associates branded the Moors Black-a-Moor, Moor was dropped and replaced with the customary term Nigger, Negroe, Colored or black. The use of the word Nigger or Negroe represents the spiritually dead people and not the Nigritian People. Black-A-Moor, n. [For black Moor] A black man or woman, esp. an African negro; any very dark-complexion person. See: New Century Dictionary of the English Language 1927. !" C irca 1775 A.D., The first President of the Untied States of America under the Articles of Confederation was John Hanson, alleged Black-A-Moor, a Maryland Shanwnee Native American patriot who fought in the American Revolution. See: Nuwabic Moors Newspaper, August 7, 1991. . A Moorish-Mason by the name of Ben Bey Emmanuel Mu Ali a/k/a Benjamin Bannaker, was the architect who designed the streets of Washington, D.C., with Masonic codes and astrological glyphs. See: Americas Oldest Secret the Talisman, U.S. Mysterious Street Lines of Washington, D.C. by the Signature of the Invisible Brotherhood. The autobiography of Benjamin Bannaker. . . C irca 1787 A.D., Assisted by England, Scotland, Ireland, Netherlands, France, Germany, Finland and Sweden the United States of America ended their war with the Moors (Moroccan Empire) and signed the Treaty of Peace and Friendship with the Emperor Mohammed III (Moorish-Mason). The aforementioned treaty is the longest unbroken treaty in the history of the United States. See: U.S. Moroccan Relations, by Robert G. Neuman, Former U.S. Ambassador to Morocco (1973--1976). . 4 . C irca 1789 A.D., On December 1, 1789. The Ninth President of the United States George Washington apologizes to his Masonic Brother Emperor Mohammed III, for not sending the regular advices (tribute: a payment by one ruler or nation to another as acknowledgment of submission or price of protection, excessive tax). Also, President Washington asked the Emperor to recognize their newly formed government. The Moroccan Empire (Moors) were the first nation to recognize the thirteen colonies as a sovereign nation. Allegedly the Emperor agreed to their recognition because 25 Moors were members of the first Continental Congress. See: The Writing of George Washington from the Original Manuscript Source 1745²1799, Editor John C. F itzpatrick, Volume 30, pages 474²476. . C irca 1790 A.D., On Wednesday, January 20, 1790, A petition was presented to the House of Representatives from the Sundry (numerous) Free Moors, Subjects to the Prince under the Emperor of Morocco in Alliance with the United States of America. The Sundry Free Moors Act states that all Free Moors may be tried under the same Laws as the Citizens of (South Carolina) and N O T under the Negro Act. See: South Carolina Department of Archives and History: S C House of Representatives Journal, 1789²90, p. xxii, 353² 364, 373²374: In Re. Sundry F ree Moors. . C irca 1857 A.D., The DRED SCOTT Case from the United States Supreme Court; holds that Africans [Moors] imported [captured in an undeclared war of enslavement]. Into this country [Territory of the United States and Several States] and SOLD as [perpetual} Slaves, were not included nor LQWHQGHG WR EH LQFOXGHG XQGHU WKH ZRUG ³&LWL]HQ´ LQ Whe Constitution, whether emancipated or not, and remained without rights or privileges except such as those which the government might grant them. See: Dred Scott v. Sandford, 60 U.S. (How.) 393, 15L Ed., 691, Blacks Law Dictionary 6th, Edition, Page 495. . The reason why Moors/Africans, cannot be U.S. Citizens because the Moroccan Empire has a business arrangement with the British Empire [European Corporate Contract Citizens Caucasian Men]. The United States is a foreignEuropean corporation conducting trade and commerce in foreign lands. See: ,Q5H0HUULDQ¶V Estate, 36 N.Y. 479, Affir med in U.S. v. Perkins 163 U.S. 625. . The Hidden History of the Moorish People with the United States of America is recorded on the back of a Federal Reserve Note. There are two seals on the back of the $1.00, Federal Reserve Note (U.S. Currency) on the left side is the Great Seal of the Moorish Empire and on the right is the Seal of the United States. There are over THIRTY THREE (33) passwords on the $1.00 (Note). The INDIGENOUS SOVEREIGN PEOPLE (Moors) were snaked (betrayed) by some of the European Colonial State Citizens who enslaved the Moors and branded them nigger, negroe, black, colored, afro, hispanic, west indian, etc., In order to conceal their true identify. 5 See: Annointed News Journal, June 1998, Page 23. America is the code word for Africa d Morocco is in Africa. See: AmeRI C A decoded is AfRI C A and MoRoCo decoded is aMeRiCa. . C irca 1913 A.D., Knowledge of our Moorish Heritage would have been lost if it was not for the Moorish-M ason, our illustrious Brother Noble D rew A li, who founded the Moorish Science Temple, in Newark, New Jersey (1913). For the unconscious de-nationalized Moors i.e., negroes, blacks and coloreds, Moorish represents our Nationality. Science represents our Ancestors Spiritual Arts maintained in Esoteric Free Masonry, and the Temple represents our Body the dwelling place of the Creator of the Universe. Also, Noble Drew Ali, is responsible for the Moorish flag flying once again on American (Moroccan) soil in 1913. The State of Morocco was not allowed to fly the Moorish flag until 1956 A.D., after their independence from France. !" N O T E : N A T I O N A L I T Y M UST N O T B E C O M B I N E D W I T H F R E E-M ASO N R Y. . Circa 1933 A.D., The city of Philadelphia, Pennsylvania, recognize the Moors domiciling in America and their Moorish Titles: El, Bey, Ali, AL, Dey, ect. See: House Resolution No. 75 Legislative Journal (Philadelphia) May 4, 1973, page 5759. Prior to C irca 46 B C., the Ancient Moors were referred to by their National names like Washitaw, Almoravides, Almohades, Moabites, Canaanites, Yisraelites, HWF« See: Circle Seven Holy Koran. The copper colour American Hebrews (Yisraelites) kept the Passover called the Green-Corn Dance. See: History of the American Indians by Ja mes Adair (1775) page 80, 101. The Ancient Ones or Mound/Pyramid Builders of North America (over 150 unearthed some Egyptian styled are up and down the Mississippi River) according to the U.S. Bureau of Ethnology was built by copper-hued skin (Asiatics/Moors). See: U.S. Bureau of Ethnology. 12th Annual Report, 1980² 1891. The Aboriginal Americans or Mound Builders of North America built ceremonial mounds that date as far back as 5,400 years ago. The oldest mound in North America to date is found in Watson brake Louisiana, 32 km South-West of Monroe. See: ³-DSDQ7LPHV1HZVSDSHU´6HSWHPEHU 1997, reported by Joe W. S anders. C irca 500 B. C., The above photo is a stone head of copper colored Aboriginal Americans, from the Hopewell Mounds in Ohio, North America. Photo Source: Journal of the Moorish Paradigm by Hakim Bey. 6 C irca 1848 A.D., On June 6, 1848, a Supreme Court Decision read by Theo H. McCaleb (Judge) Declared that the United States DOES NOT own the land of The Ancient Ones (Uaxashaktun) Mound Builders of North America (more than 1,000, 000 square miles of land) Also, the Court declared the lawful land owners are the heirs of Henry Turner (WashitawMoors/Muurs). See: Case No. 191, U.S. Supreme Court, United States vs. Heirs of Henry Turner . C irca 1993 A.D., The present day Empress Her Highness Verdiacee Tiara Washitaw Bey, she is the living heir of the Ancient Ones (Empire of Washitaw de Dugdahmoundyah); they are recognized by the United Nations as the oldest people in the world. Excerpts from: ³$UH<RXin Denial of <RXU$QFHVWU\"´and ³6WLOOin Denial of Your $QFHVWU\"´ By R. V. Bey . It is no longer a question as to whether those who have been branded negroes, coloreds, blacks, etc., are descendants of Moors. Upon reading the Bull Inter C aetera, DQGWKH³1RUWK $PHULFDQ([SORUDWLRQ´ IURP &ROXPELD¶V(QF\FORSHGLD RQHFDQILJXUHRXWZK\WKLVWUXWK has been suppressed from the natural Peoples of the Earth. Upon further review, one can also clearly see that our struggle is within the principles of Law, and not within the farce called racism. Yes, the symptoms of racism and slavery are there, however it has no nickel in the dime in regards to the solution, and the earthly salvation of you or your children. . If we stand, we stand as O N E . If we stand, we stand on the rules of engagement laid out by our ancestors to preserve our posterity. These same rules are embodied spiritually in most written National and International documents, which upon pondering, we find they were written as a µPHVVDJH¶to us, to assist in our awakening. Such as the Universal Declaration of Human Rights 1959, and the 'HFODUDWLRQ RI WKH 5LJKWV RI WKH &KLOG ,W¶V DOPRVW DV LI the International community was reaching out again, since it DSSHDUHGZHGLGQ¶WZDNHXSLQ maybe we would wake up in 1959, if they addressed concerns involving human law through the FKLOGUHQ 7KDW GLGQ¶W H[DFWO\ ZRUN HLWKHU DW WKDW time. Besides, Drew Ali came in 1913, and made wonderful strides regarding Nationality and birthrights, jurisdiction and Law. However, if we don't claim our Status as Natural People, we will remain consciously, yet unconscioulsy, fictitious chattel property, and claimed as such through the 14th, 15th amendment Negro Acts, which is the point and purpose of creating them, to claim a people who don't make claims themselves, as property with privileges, but not with rights. There is a difference between a 'privilege' and a 'right'. If you don't claim yourself and your children, they are devoured! Mothers, if you are in proper person status, your children are in that sames status by default, because the condition of the child is based upon the condition of the MOTHER. . It seems our biggest culprits are ourselves. It is good then, that Drew's work is, as he stated, for ³WKH\RXQJDQG \HWXQERUQ´, as they are the ones who will assist to preserve mother earth, and uplift fallen humanity. It is not that the solution regarding Law, Writs, or written documents, is not availed WRXV7KHSUREOHPLVZHGRQ¶WXWLOL]HWKH written information, and we GRQ¶WHQIRUFHLW0DLQO\EHFDXVH ZHGRQ¶WVWXG\WKHPPRVWKDYHQ¶WHYHQUHDGWKHP<HWWKH\ 7 were left for us, they pertain to us, and they do preserve our RIGHTS OF BIRTH. Hopefully information provided on this site, which is only a portion of the information now readily available worldwide, will help us to move in unison toward meeting the ends of the struggle we so proudly say we are LQ\HWZHGRQ¶WVHHPWREHDEOHWRFODLPRUUHFRJQize the resolve. . W e already have the biggest weapon there is ² T he T R U T H . ,I LW GLGQ¶W VHHP WR PDWWHU before, it matters NOW. For those of you who say nay, you are probably the very ones who claim you are spiritual, and say you have the spirit of the ancestors with you, and probably go through the rituals pointing out the truth that we manifest our own realities. If this is you, you must recognize your own contradiction. You may also want to take into consideration the population we have, and the population of our people across the globe, who are waiting for us (the Mothers and )DWKHUVRI&LYLOL]DWLRQ WR³ZDNH-XS´DQGJHWWKLVKRXVH (earth) in order. As far as concerns about bloodshed, if we pay close attention, we recognize there is already much degradation and bloodshed, across the entire planet. So GRQ¶WZRUU\WKDWWKHUHmay be bloodshed -- there already is. . W e cannot continue to be ar rogant, self righteous, while all along are acquiescing and blindly " believe " Law is not meant for us; when in fact we are the Law. We either authored, or authorized the information that others are crookedly, dishonestly using to suppress us. That is what makes it such a travesty. . You may ask then, How are they doing that? It is simple; they are making false claims, and putting it in writing, (which is a spell, as in spelling). They are making false claims that we GRQ¶WUHEXW0D\EHLWLVEHFDXVHZHWKLQNZHFDQ WVSHOO The irony to that is, if we continue to let our children be erroneously educated, and purposely dumbed down, ZH FDQ¶W KDYH PXFK expectation to change their ability to spell ² can we? The fact that we have been mis-educated is unfortunately no excuse, even if we want to use it as an excuse, because ³,JQRUDQFHRIWKH L aw is no excuse " -- a statement which is very real. It is a sad scenario, and a lack of our willingness to take responsibility, when we recognize we taught the world math, how to spell, to read, and, we taught Law, we taught the 7 Liberal Arts. Yet, we don't know that Law is eloquently reserved for us, expressed, implied, verbal and written, as in the " Book of L aw " . . M any of us use ignorance of the law as an excuse and add insult to the injury when we say /DZLVWKH³VR-FDOOHG´ ZKLWHPDQ¶V/DZ,WLVQRW:KDWKHLVH[HUFLVLQJXSRQXVLV "color-oflaw", a semblance of that which is real. Thus, it doesn't matter what he is doing, what matters is what we are doing for us, and consequently for the World. Besides, all along the so-called ³ZKLWH-PDQ´LVWDNLQJDYHUEDODQGZULWWHQ Oath to the principles of Law our ancestors left to preserve our Rights, and the perpetual Rights of our progeny. They are universal principles, which apply to all natural people. If anyone takes the Oath, and then steps outside of it, the Divine Constitutional Principles, then he has absolutely no JURISDICTION over you. And there is remedy (See Title 'RQ¶WWKLQNKHGRHVQ¶WNQRZWKDW:KDWKHGRHVNQRZ is, he can continue to take the Oath, and break the Law, EUHDN WKH 2DWK EHFDXVH ZH GRQ¶W NQRZ WKH difference. Without him taking the Oath, he has no authority of L aw, although he portends to. Suddenly, or rather hopefully, if not already known, the issue of jurisdiction becomes a very real issue -- doesn't it? 8 . W e ought to be ashamed to allow anyone to make a mockery over that which our ancestors preserved for us. This is why we must unite, and we will, but it appears not until we have had a great deal more pain. To ask one to µVWXG\ZHOO¶is an overstatement at this point. By studying a little, we can find answers. The information exist, however it is cloaked, meaning you must seek and you shall find, and you must have 'keys', key words, key phrases--knowledge. (My people suffer for a lack of knowledge, as stated in the scriptures by Yeshuah (Jesus). Bits of information act as keys upon which you can study, research and unveil the truth, even in an attempt to disprove it, one finds they affirm it to be so. We all know that truth is the light that shines and sets us free. At the very least, a knowledgeable and conscious people certainly cannot be enslaved by lies, unless willfully. So we speak to those who really want to be free, and at the very least want their children to be free. If that is not the desire and intent, then they need not talk about, complain, or say they are in a struggle to fix the abuses and mis-uses bestowed upon us all, as they continue to identify the problem and the solution incorrectly. If we know the root causes, then we can exercise the cure. Correction cannot come about without accurate knowledge of the problem. If this describes you, it is necessary for you to know you are not in "the struggle". You are however steeped in emotions and how you "feel" about it, thus you may be struggling to come to terms with the truth. You are spinning your wheels, being led to think you have made some victory, but have not, as is evidenced by the condition we are in, which by the way has gotten worse, as evidenced by the condition of your life, and the life of those around you, even those who " thought they had it all together " . Save those who do. . W e are the Mothers and F athers of C ivilization across the planet, we are World History. I will prove this with a few easy questions in the test that follows at the end of this Article. The answers prove we have been written out of history, yet only because the ones who have taught us, and, who we allow to continue to teach us and our children, have decided by the stroke of the pen, to write us out of that which they put before us to learn from. This happened after they burned the books, reconstructed the history, and would punish us if we were caught reading; thus we did know how to read. . ³7KH3HQLV0LJKWLHUthan WKH6ZRUG´² another profound statement. Veiled behind it, is the sword, which is translated into the written word, and the spell-ing is caste. . E xcerpt from: " Are You in Denial Of Your Ancestry?´ . L et's look at information that came from an encyclopedia regarding World H istory, regarding Moors. T his information is in reference to C harlemagne NQRZQDV³&KDUOHV the +DPPHU´ and A lphonso the 1st thru 6th. T here were actually 12 generations of $OSKRQVR¶V,KDYHRQO\UHVHDUFKHGKHUHZLWKRU generations of them fighting Moors to gain power and rule over the land, and the people. Notice the dates are as far back as ¶V ¶V ,Q IDFW E\ GRLQJ WKH PDWK wherein the Moors C ivilized Spain in 832, and reigned IRURYHU\HDUVLWEULQJV\RXWR¶VRUVRDQGWR &KULVWRSKHU&ROXPEXV¶ YR\DJHQHDULQJWKH¶V 9 LET THE STUDIES BEGIN! . . C harles Martel² (mar tel) [O.FR. = Charles the H ammer], 688? ²741, Frankish ruler, natural son of Pepin of Heristal and grandfather of Charlamagne. After the death of his father (714) he became mayor of the palace in Austrasia and Neustria, having previously crushed all opposition. He extended his rule to Burgundy, Aquitaine, and Provence. Having subjugated many of the German tribes across the Rhine, he encouraged the activities of St. Boniface and other missionaries among them. Charles Martel halted the Moslem invasion of Europe by his victory over the Moors of Spain in the battle of Tours or Poitiers (732), one of the decisive EDWWOHV RI WKH ZRUOG¶V KLVWRU\. Although he never assumed the title of king, he divided the Frankish lands, like a king, between his sons Pepin the Short and Carloman. $XWKRU¶V 1RWH If this is one of the most important battles in WORLD HISTORY, Why KDYHQ¶WZHOHDUQHGRILWLQVFKRROV"$Q\SHUVRQSDUWLFXODUO\ Scholars, clearly know about this battle with the Moors, they don't mention it, nor do they come back from their studies and call us Moors, as we rightfully and historically are by heritage. . Moors: nomadic people of the northern shores of Africa, the original inhabitants of Mauretania. They mixed with successive conquerors and are now a dar k-skinned race chiefly of Berber and Arab blood. In the 8th cent. They were converted to Islam and became Moslems. $XWKRU¶V1RWHthis indicates that Arabs and Berbers are Moors and Moors are associated with the creed of Islam and Moslems. Islam is a way of life, not a religion. I Self Law Am Master. 711²Under Tarik they crossed into Spain in 711 and without difficulty overran the crumbling Visigothic kingdom of Roderick. $XWKRU¶V1RWH: indicates these same dark-skinned (melanated) people are in fact the Moors of Spain. The Visigoths are Christian Crusaders. 732² They spread beyond the Pyrenees into France where they were turned back at Tours by Charles Martel (732). $XWKRU¶V1RWH2QFHDJDLQWKH³%DWWOHRI7RXUV´is mentioned, the most decisive world battle fought between the Moors and the Christian Crusaders. 756² In 756 Abdur-Rahman I, established the Omayyad dynasty at Cordoba. The emirate became under Adur-r-Rahman III the Caliphate of Cordoba. The court there grew in wealth, splendor, and culture. The regent Al Mansur in the late 10th cent. waged bitter warfare with the C hristians of N. Spain, where, from the beginning, the Mohammedan conquest had met with its only opposition. The cities of the south, Toledo, Cordoba, and Seville, speedily became centers of the new culture and were famed for their universities and architectural treasures. (See Moslem Art and Architecture) $XWKRU¶V1RWH: indicates: 1. The Moors taught high civilization principles and established the well-known best universities ie. Cordoba and 2. Christians (Christiandom, then a political term, 10 later turned to a religious order), were and still are, the only opposition of Moors. With the exception of brief periods, there was, however, no strong central government; the power was split up among dissenting local leaders and factions. $XWKRU¶V 1RWH indicates the Moors fought with each other for ruling power. .1031² The caliphate fell in 1031, and the Almoravides in 1086 took over Mohammedan Spain, which was throughout the whole period closely connected in rule with Morocco. $XWKRU¶V1RWHindicates an Empire was in place and Moors continued to fight with each other. Almoravides are Moors. 1174² Almoravid control slowly declined and by 1174 was supplanted by the Almohades. These successive waves of invasion had brought into Spain thousands of skilled artisans and industrious farmers who contributed largely to the intermittent prosperity of the country. They were killed or expelled in large numbers (to the great loss of Spain) in the Christian reconquest, which began with the recovery of Toledo (1085) by Alfonso VI, king of Leon and Castile. $XWKRU¶V1RWHindicates the fall of the Moors. Almoravides and Almorahades are both Moors who fought each other for political control. A lmoravides² A lmoravids, Berber Moslem dynasty that ruled Morocco and Moslem Spain in the 11th and 12 th century. Its real founder was Abdullah Ibn Yasin, who by force of arms converted some Saharan tribes to his own reformed religion and then advanced on Morocco. After his death (1059), Yusuf Ibn Tashuffin and his brother Abu Bakr came to power. Marrakesh was founded in 1062 and was the center of a powerful empire. Yusuf was called by the Moors in Spain to help stem Christian reconquest. Ysuuf entered Andalusia and defeated (1086) Alfonso VI of Castile. Later he subdued the local Moslem rulers and governed Moslem Spain with N. Morocco (Abu Bakr had S. Morocco). The Almoravides were rough and puritanical, contemptuous of the luxurious Moslem culture in Spain Their rule was never entirely stable and in the 12th cent. Was attacked by the Almohades, who finally (by 1174) won both Morocco and Moslem Spain. . A lmohades² Berber Moslem dynasty that ruled Morocco and Spain in the 12th and 13th cent. It had its origins in the puritanical sect founded by Mohammed Ibn Tumart, who (c.1120), stirred up the tribes of the Atlas to purify Islam and oust the Almoravides. His successors, AbuL-Mumin, Yusuf II, and Yakub I, succeeded in conquering Morocco and Moslem Spain, and by 1174 the Almohades had completely displaced the Almoravides. With time the Almohades lost some of their fierce purifying seal; Yakub had a rich court and was the patron of Averroes. Yakub defeated (1195) Alfonso VII of Castile in the battle of Alarcos, but in 1212 the Almohade army was defeated and Almohade power in Spain was destroyed by the victory of the Spanish and Portuguese at Navas de Tolosa. In Morocco they also lost power, there to the Merenide dynasty who took Marrakesh in 1269. $XWKRU¶V1RWHThe above shows that Moors fought against Moors. Both the Almoravides and the Almohades are described as being of Berber Moslem dynasties. The definition of Moor is those who are Berber and Arab with an Islamic and Moslem creed. Take note read the lines of all the other political names of the for anyone to say they don't know who Moors are would be 11 an out an out untruth. Lots of information has been burned, yet with that, one can still find reference to Moors being in the most decisive world battle, as well as many other historiacl events, which by the way, still go on today. Moors are sleep, ye tthey exist in body on the planet. The purpose was that they would forget who they are, and fail to recognzie they are the aboriginal, indigneous inhabitant of this earth, the amothers and fatehrs of civilziation on this planet, and forget what that means, what to do to preserve themselves and their progeny. . . Alphonso Led The Reconquest Now OHW¶V ORRNDWZKR³$OSKRQVR´DQGKLVSHRSOHZHUH\RX will find this most interesting. The first define will show that the Moors were in strife as a result of fighting. Alphono's family spent at least 6 generations conquering the Moors. The lands, castles, estates, etc., of which hey conquered were obviously the Moors. This also led to the Magna Charta Codes of 1200, and the reason we have Landlords. This is why no one ever owns their property. (unless they have an Allodial Title) Moors are the Title holders. The Titles are El, Bey, Dey, Al, and Ali. Translated as the 5 civilized so-called Indian tribes during the battles on the Western Frontier, here in North America. . A lfonso I (Alfoso the Catholic), 693?-757, Spanish king of Austurias (739-57). He was the sonin-law of Pelayo. Strife among the Moors facilitated his conquest in parts of Galicia, Leon, DQG6DQWDQGHU$IWHUKLVIDWKHU¶VGHDWK his mother, Countess Theressa, ruled the county of Portugal with the help of Fernadno Perez, until in 1128 young Alfonso, allying himself with discontented nobles, took power and drove her into Leon with the still-faithful Perez (Alfonso did not in spite of the popular legend, put her in chains at Guimarais) Beginning a little more than a quasi independent guerrilla chief, Alfonso spent his life in almost ceaseless fighting against the kings of Leon and Castile and against the Moors to increase his prestige and his ter ritories. In 1139 he defeated the Moors in the battle of Ourique (fought not at Ourique but at some undetermined place). . A lfonso I I (Alfonso the Chaste), 759?-842, Spanish king of Austurias (739-842), grandson of Alfonso I. He continued the struggle against the Moors and established his residence at Oviedo, which his father, Fruela I, had founded. His alliance with Charlemagne and Emperor Louis I met opposition among his nobles. Alfonso II built the first church on the site of Santiago De Compostel. His reign was spent in struggles with the Church and his brothers and sisters. His measures against the Church holdings and the bishops led to this excommunication (1210). Though he was himself most unwar-like, Portugeuese soldiers took part in the battle of Navas de Tolosa and pushed conquest against the Moors. . A lfonso I I I (Alfonso the Great) 838?- 910?. Spanish king of Austurias (866-909), The kingdom was consolidated in his reign, though after his forced abdication it was divided among his sons. . A lfonso V (Alfonso the Noble), 994?-1027, Spanish king of Asturias and Leon (999-1027). While he was still a minor, the Moors under Al-Mansur were defeated. Alfonso gave Leon its 12 fuero {charter} and was killed in the siege of Viseu. Alfonso V I, 1030-1109, Spanish king of Leon (1065- 1109) and Castile (1072-1109). He inherited Leon from his father Ferdinand I. Defeated by his brother, Sancho II of Castile, he fled to the court of Al-Mamum, Moorish ruler of 7ROHGR$IWHU6DQFKR¶VDVVDVVLQDWLRQ KHVXFFHHGHG to the throne of Castile and took Galicia from his brother Garcia (1073), thus becoming the most powerful Christian ruler in Spain. He raided Moslem territory and penetrated as far as Tarifa. After the conquest of strategic Toledo (1085), he took many other cities and reached the line of the Tagus. Aroused by his advance Abbad III (see Abbadides) and his Moslem allies called to their aid the Almoravide Yusuf Ibn Tashuffin, who defeated Alfonso in 1086 and again in 1108, when $OIRQVR¶V RQO\ VRQ ZDV NLOOHG LQ EDWWOH $OIRQVR¶V UHLJQ gave a tremendous impulse to the reconquest of Spain and was also notable for the exploits of the Cid. His court at Toledo became the center of cultural relations between Moslem and Christian Spain, while French influence also grew strong through his many French followers. At this time the Cluniac reform was introduced into Spain. Alfonso was succeeded by his daughter Urraca. $XWKRU¶V 1RWH The references to the Alfonso I thru Alphonso VI shows that they spent lifetimes fighting the Moors for the purposes of converting them and taking over their land and resources. It also shows that even though Moors may have fought each other, they would often come together to fight the Christian Crusaders when called to each others aid. 1212² The great Christian victory (1212) of Navas de Tolosa prepared the way for the downfall of the Moslems. $XWKRU¶V1RWHcontinued fall of the Moors, noted here as Moslems fighting Christians. 1236²Cordoba fell to Ferdinand II of Castile in 1236. The wars went on, and one by one the Moorish strongholds fell, until only Granada remained in their hands. $XWKRU¶V 1RWH indicates that Granada was the last Moorish stronghold. And after it fell the Treaty of Granada gave Columbus the authority to travel West to this North American continent and conquer the Paradise, the Algonquian Civilizations here in the Americas, North, South and Central. This is when 0RRUV E\ QDPH ZHUH FDOOHG ³%ODFNV´ KHQFH WKH QDPHV %ODFN 1HJUR Colored have been made part of history and the connection to the name Moor was ended, and the descendants took on the slave brands, just as they did in Spain, prior to coming here when they conquered and called them Morescos or Moriscos and then called them Spaniards. 1487² Milaga was taken (1487) after a long siege by the forces of Ferdinand and Isabella, and in 1492 Granada was recovered. Many of the Moors had accepted Christianity; these, called Mudejares, were now joined by new converts, the Moriscos. They were allowed to stay in Spain, but were kept under close surveillance. $XWKRU¶V1RWH: Moors were forced to convert to Christianity, edicts were put out by Queen Isabella of which one was that they were not to wear Moorish Garb, etc. Moors were and still 13 are known in Spain as the Moriscos, those who converted to Christianity out of force, the mighty melanated dark-skinned people who fell²the great Fall of Humanity. 1568² They were persecuted by Philip II, revolted in 1568, and in the Inquisition were virtually exterminated. In 1609 the remaining Moriscos were expelled. Thus the glory of the Moorish civilization in Spain trailed out. Its contributions to Western Europe and especially to Spain were well-nigh incalculable² in art and architecture medicine and science and learning. $XWKRU¶V 1RWH As you can see again, the Moriscos were the Moors. This above paragraph indicates the persecution and extermination of the Moors in the eastern hemisphere (holocaust). Many status quo scholars have written this as a complete extermination when in fact it was not. This is intentional for the scholars to write this to make the descendants think they are in fact not descendants, to make them think there are no more Moors, and that is exactly what has occurred. The descendants are still today, lost for their identity. This holocaust they are speaking of happened in the eastern part of the globe. However, Moors were in all corners of the earth and the descendants have not been virtually exterminated. They have been fruitful and have multiplied. This is why studying is so important. The Moors that they labeled indians when they came here did not just vanish off the earth. Some survive today, intact with full melanation in their skin. Some were murdered over the years, other were amalgamated into fair skin, and amalgamation is how they will return as they are aboriginal and indigenous to this land. They are you! King Alfred Plan ²´6LOHQW:HDSRQV For a 4XLHW:DU´ In reference to the extermination or holocaust, it is important to know that this is not without possibility today. I would think that when the people of this land realize how they are still enslaved, they may, because of their emotionalism, resort to the usual gatherings of marches and protest, a typical signature of revolt for change. I however, urge that they do not turn to these emotional activities that are absent of fact and not founded in proper civics, as there is a plan IRUFRQWURORIVXFKDFWLYLWLHV7KDWSODQLVFDOOHGWKH³.LQJ $OIUHG3ODQ³5H[´,WKDV been in effect for a long time, GRFXPHQWHG LQ DQG LV FRLQHG WKH ³6LOHQW :HDSRQV IRU D 4XLHW:DU´7KHKRmeland Security Act is an extension of that plan. Do not resort to marching in the streets against these inequities. Do resort to nationalizing yourself and your country. Much like Castro did when he nationalized Cuba. This is why the American demos/democracy GRQ¶WOLNH Castro. They are more than aware that you are bound to this continent by heritage. The King Alfred Plan is a presidential executive order #11490, that began its written instructions approximately 1947. . The following are excerpts from that plan: . Memo: National Security Council: ...The Minority has adopted an almost military posture to gain its objective, which are not clear to most Americans. It is expected, therefore, that, when those objectives are denied the Minority, racial war must be considered inevitable. When that Emergency comes we must expect the total involvement of all 22 million members of the 14 Minority, men, women and children, for once this project is launched, its goal its to terminate, once and for all, the Minority threat to the whole of the American society, and, indeed, the Free World.² Chairman, National Security Council . Preliminary Memo: Department of Interior.... Under King Alfred, the nation has been divided into 10 Regions (see accompanying map) In case of Emergency, Minority members will be evacuated from the cities by federalized national guard units, local and state police and, if necessary by units of the regular Armed Forces, using public and military transportation, and detained in nearby military installations until a further course of action has been decided. . Preliminary Memo: Department of Defense: «7KHUH ZLOO EH PDQ\ cities where the Minority will be able to put into the street a superior number of people with a desperate and dangerous will. He will be a formidable enemy, for he is bound to the Continent by heritage and knows that political asylum will not be available to him in other countries. The greatest concentration of the Minority is in the Deep South, the Eastern seaboard, the Great Lakes region and the West Coast. . F O R T H OSE W H O H A V E A L W A YS T H O U G H T T H E R E W AS A C O NSPI R A C Y A G A I NST M I N O R I T I ES ²Y O U A R E SO C O R R E C T. . T he operative question to ask is: A re You a M inority? People who are not a M inority, GRQ¶W WKLQN with M inority minds, and upon discovering that M inority is a legal terminology for those who cannot think for themselves or handle their own affairs, they ZRXOGQ¶WDOORZWKHLUULJKWVDQGWKHLUFKLOGUHQ¶V rights to be abridged. . Nobody likes ignorance²not even you. I urge that you do not confuse religious creeds and belief or solace systems, cultural philosophies or blind faith, with Nationality which is bloodline, pedigree, consanguine issues. The names negro, colored, black, indian, latino, white, indicate people who are ignorant of their true historical, lawful, contributions to society and it indicates persons who are property of the European slaveholders, a compromised people, subordinate to European psychology² a bureaucratic slave. . It is certainly time, now, to reconsider your social and political position! . Here is the undertone of what is happening today: T R U T H A N D F A C TS A R E C O L L I D I N G W I T H B E L I E FS A N D F A LSE H O O DS. H O N O R Y O U R M O T H E RS A N D F A T H E RS! 15 -+6-+-&7!1(//#+!&*#8!:)#:'(5-(/!0+9!'09-&'/!#6!+90! T he Moorish A mericans A re a T rue Nation of People x I forgive you of everything that you did before I came; now you are responsible for your deeds now. Moors are not held accountable for the oaths taken and deeds done while they were in a coma and without knowledge of self. But now T he Holy Prophet has come, returning to them their free National Name and Old Time Religion, they are as responsible as all other true Citizens. x The Holy Prophet Noble D rew A li told the Moors, ³,EURXJKW\RXHYHU\WKLQJLWWDNHV WRVDYHDQDWLRQQRZWDNHLWDQGVDYH\RXUVHOI´Look at the saving powers owned by all other nations of the Earth, e.g. Free National Name, Flag, Emblem, Constitution, /DQG )DPLO\ +HULWDJH HWF 1RZ ORRN DPRQJVW ÄHYHU\WKLQJெ H e brought us and find yours like other nations have; Now take the things that are yours and save yourselves. x %\ \RX EHLQJ ERUQ KHUH GRHVQெW PDNH \RX D FLWL]HQ. Negroes, Blacks and Colored People are names given to slaves during the time of slavery. Those born under the powers RI WKH WK DQG WK $PHQGPHQWV DUH QRW WUXH &LWL]HQV EXW DUH GHFODUHG ³3HUVRQV´ (Commercial property) under the assumable jurisdiction of U. S. Congress. The word ³3HUVRQV´DVXVHGLQWKHVH$PHQGPHQWVGRQRWOHJDOO\WUDQVODWHLQWR0HQDQG:RPHQ x Moors, be yourself. To be your self is to be Moorish American, a true nation of People, bearing your one free national name. x Moors, study yourself. The Moorish must study self to know self and know self in order to be yourself. x A beggar nation cannot attain to its highest degree of spirituality. A prosperous nation must be economically sound. x Imitate I, T he Prophet. Moorish L eaders, live a life of love, so that you will be loved as I the Prophet is loved. x T his is the uniting of Asia. ³7KLV´ UHIHUV WR 7KH 0RRULVK 'LYLQH DQG 1DWLRQDO Movement in North America. x In the year 2,000 the Moors will come into their own. x O ne day, when seven bridges cross in the sky, there will be Red F ezzes and T urbans for as far as the eyes can see. In 1924 when T he Prophet stated this prophecy there were no bridges crossing in America. Today, the Los Angeles freeways and expressways form seven bridges of highways overlapping each other above ground. 16 x I had to go around my elbow to get to my thumb to get what I wanted established in this government. He wanted to establish T he Divine and National Movement in North A merica to save His People from the wrath (NBC) of Allah. And The Holy Prophet had to go through the fire (the United States assumable laws of jurisdiction) in order to prepare a table before us in the presence of our enemy. x T he only way out of the fire is through the fire. The only way out of slavery is through the very laws that enslaved you. x A Moorish leader is not to get up to speak under the influence of liquor, or any harmful motive that will seek to break up the families of men. x I come to set you free from that state of mental slavery that I found you in. The Moors were enslaved by reducing their mentality to that of Negroes, Blacks and Colored People. As a man thinketh, so is he. x You are from M issouri. I have got to show you. By 1928 the Moors have endured such a mental beat-down here in the west until they did not believe they are a nation of people so Drew Ali went to the Pan-American Conference in Havana, Cuba and declared them as a clean and pure Nation before the United States and other National and Tribal Delegates in attendance. x Moors, you sleep too much. W ake up and see the seven bridges crossing in the sky. C an you see you are a People? x W ake up Moors and GRQ¶W go to sleep any more. The Moors have been so Dumb-down until they have become mentally complacent with a Slave psychic. x W e need to have warehouses because one day the E uropeans are going to let you down. x T he times that have been, ZRQ¶W be no more. x If I were you, I would get ready before you are made to do so. If you are ready, stay ready; if you are not ready, get ready. x Some of you Moors are going to throw away your name, just for a morsel of bread. 17 A bout A merica and the E uropeans x Before the E uropean came here, the bananas were large, and the grapes were fourin-hand. It took two men with hand-sticks to car ry one bunch of grapes. x T he Moors were living up and down the M ississippi River before the E uropean man came here (To Northwest Amexem [Africa], later to be named America. x T he E uropeans went to the Moroccan government, and asked for permission to come over here (to Northwest A mexem) to develop this land. T hey were given a 50 year mandate to do so. T hen the E uropeans went to an old Sheik and asked him to give them some people to help them to develop this land. T he Sheik told them to: ³7DNHWKRVH0RRUVEHFDXVHWKH\DUHQRWJRLQJWRGRDQ\WKLQJ´ It was the officials e.g. Sheiks, Caliphs, and Sultans of the various governments of the Moorish Empire (All Kingdoms, Countries, tribes and Nations of Northwestern and Southwestern shores of Africa) who permitted the Arab Slavers to capture and sell Moorish Nationals to the Europeans. x T he E uropean is going to have to pay our people off for the wor k that they did in slavery, and pay off in compounded interest. x O ne day, the E uropeans are going to lock the food up in warehouses, put soldiers around them to guard them, and you will go anywhere he says to get something to eat. x O ne day you will go to the store, and there will be soldiers there with guns with bayonets on them, and they will not let you enter. T hey will order you to move on. x O ne day the E uropean is going to let you down. You are going to have to put up a 90 day supply of food to last you until your brothers come to your rescue from the E ast. x The Holy Prophet WROGWKH0RRUV³C hildren, you are at home, and the E uropean is PLOHVIURPKRPHDQGKHLVJRLQJWRKDYHWRWDNHVRPHZDWHU´ (The Moorish are indigenous to America, by inheritance and birthrights. Our Forefathers civilized this continent 10,000 years before the Europeans discovered millions of us already using it. When the Moorish reclaim this land the European must return to Europe, the land our Ancient Ones set aside for them. x O ne day, you are going to smell the E uropeans before you see them, in boxcars, going back to E urope. x T he E uropean will not be able to remove all the wealth from the land. A fter he goes back to E urope, mountains of gold will be revealed to the Moors. 18 x W hen the E uropeans go back to E urope, the climate will go back to what it used to be. x I like good peas and beans. I am going to save 8% of the E uropeans, because they are good farmers. x If the E uropean be just, they would have an Asiatic V ice-President, and if they had an Asiatic President, they would have a E uropean V ice-President. x I am going to stop the E uropean from thinking, and start you (The Moors) to thinking for your own good. x O ne day your biggest trouble ZRQ¶W be getting with E uropean women, it will be fighting them off. x G et a good E uropean education and I can use you. Education is for Citizens to enhance their prosperity. Training is for property. x T he Holy Prophet while speaking would jump up in the air and laugh and say, ³5RPH \HDUVDJR\RXJRWPHEXW,JRW\RXWRGD\´ x I am going to leave the E uropean here, just long enough to teach you how to run a government. Today, the Moorish have been trained and well educated into every aspect of National, State and Municipal Governments. Moors need only to be themselves in order to form a more perfect government and be recognized by the nations of the Earth. x W atch the newspapers and listen to the ratio, I am going to make the E uropean tell the truth. x 7KH(XURSHDQDVNVWKH+RO\3URSKHW³:LOOZHEHVDYHGWKLVWLPH"´ T he only way you (E uropean) can be saved this last time will be through the help of the Moors. x T he E uropeans were not going to give up until H e looked death in the face. x C hildren, when you get on top, treat the E uropean nice. x T he E uropean is our fellow man. x T hey (The Europeans) will seek peace, but none shall be found. The warlike nature of Europeans seeks peace through war but peace cannot be found by those means. 19 x I am going to stop the E uropeans from thinking. If two or three of them get together on something, they will go back, and tear it up. x If you want E uropean G rand Sheiks, I can give them to you. The Holy Prophet got tired of the Moors always running to the Europeans and accepting their verifications over H is lessons of freedom and salvation. x In 1929 there was a European man, his wife and daughter outside the meeting of the 2nd Annual National Convention that asked Bro. Kirkman-%H\³:KHUHLVWKDWOLWWOHPDQWKDW XVHGWREHDURXQG"´%UR&.LUNPDQ-Bey let them know that He was no longer with us. These Europeans started crying. They were looking for the Holy Prophet. That man was able to save his money during the bank crash, because he obeyed the Holy Prophet, and took his money out of the bank. x I have got the Romans in the palm of my hand. x O ne day, the United States will not be able to do any business, unless they do it through the Asiatic. x I am going to make the E uropean enforce my law. The duty of a Prophet is to save nations from the wrath of Allah. The Holy Prophet brought the Moorish their Nationality and their Divine Creed so they can be law abiding. And He is going to make the Europeans enforce these National and Divine laws. Holy Instructions to the Moorish x L et all old business stay as it is, and all new business, do it in your free national name. x L et your good deeds out number your bad deeds, and when you pass away, you ZRQ¶W have anything to wor ry about. x M y good Moors are going to live. x W e, the Moors, have the blood of every nation flowing through our veins, thereby EULQJLQJDERXWDFURVVVSLULW´ x T he Italians have our blood (The blood of the Moors) mixed in their veins, that is why they are so mean. 20 x I GLGQ¶W WHOO DQ\RQH ZKHUH , ZDV ERUQ RU ZKR P\ SDUHQWV ZHUH EHFDXVH , GLGQெW want people to make a shrine out of the place or make over my parents like was done with Joseph and M ary. x W e (The Moors) are a hard-head, stiff-neck, mean set of people that have never done anything except at the point of a sword. x You tore up everything that was brought to you, but I brought you something that you FDQ¶W tear up. It will tear you up. 7KH0RRULVK$PHULFDQVKDYHWRUQXSWKH³2QH 7HPSOH´LQWRKXQGUHGVRIFRQIXVHGVHFWVWKHVDOYDWLRQRIWKHLUQGDQGUGJHQHUDWLRQV and their rightful place in the affairs of men but they could not tear up their free national name or their Divine and National Movement. x T he same truth that will draw you will drive you. x I brought you something that you can shout about. x C hildren, you are just plain rich. x L et all old business stay as it is, and all new business, do it in your free national name. x It will take you 50 years to find out what I brought you, and if you are not careful, 50 years after I am gone, you ZRQ¶W know that I have been here. x C hildren, one day, you are going to love me. x T he biggest fool is the educated fool. Property can only be trained and never educated. 7KHVODYHPHQWDOLW\PLVQRPHUHGDVÄ1HJURHV%ODFNVDQG&RORUHG3HRSOHெLVWKDWRIDQ educated fool. x Moors should learn Spanish as a second language. x 'RQ¶WHYHQFDUU\DSRFNHWNQLIH During the 3URSKHW¶V time, Moors still under mental slavery were arming themselves with small hand-carry weapons but no free national principles. x If it were not for that little piece of red flannel, we would not get into so much WURXEOH´$0RRU¶s tongue is what gets him in so much trouble. He talks more than he thinks. x 7KHRQO\WKLQJWKDWKXUWVDGXFNLVKLVELOO´Talking too much. 21 x A good Moorish leader must study his Holy K oran and Divine Constitution and Bylaws. These holy and divine laws are for the guidance and protection of a pure nation of people. A good Moorish Leader realizes finite mind cannot comprehend those things infinite so they must study in order to lead a right. x T he Holy Prophet SRLQWHG +LV ILQJHU DQG VDLG ³M y sheep know the sound of my voice; a stranger will not follow. x I have come just before the fire. W hen the fire comes I will be your water and if you do not get behind me you will not make it through. x ,DPJRLQJWROHWWKHILUHWRXFKVRPHRI\RXROG0RRUVெVKLUW-tails. x I am going to let the fire scorch some of my good Moors. x 2QHGD\\RXDUHJRLQJWRORRNIRUWKHJRRG0RRUVDQG\RXZRQெWEHDEOHWRILQG them. x Stay out of the alley with your turbans and fezzes on. During those days many Moorish would put on their headdress of freedom (turbans and fezzes) on their heads but had Negro thought-patterns in their heads. They would frequent bars, dives and alleyways as though they had brimmed hats and caps on their heads. x C ar ry your fez to the temple. To keep the public from knowing of their doings unbecoming of a Free Person, The Holy Prophet called out this executive order. It is to stand until the Moorish know how to act like a redeemed People. x T he only thing that would surprise me is if a Moor would do right. D rew A li¶s W arnings and Prophecies x For the various lynchings and murders that were committed in the South; the South is going to have to pay off, and pay off in blood. x If you have people in the South, get them out, because that is where destruction is going to start. x 7KHWLPHVWKDWKDYHEHHQZRQ¶WEHQRPRUH x E very word that I speak is spirit and you (Moors) had better heed. x Look around, and where you see people; one day, wild animals will be roaming down the streets. 22 x W hen the fire comes, I will be the water. x W hat are all these Moors doing here? T here are only going to be a handful saved. I can count them on my fingers, and have fingers left over. x I have airplanes, zeppelins, and apparatus. I am going to take my good Moors up in DQDSSDUDWXVRQDQLQFOLQHXQWLOLW¶VDOORYHUZLWK x 'RQ¶WHQGDQJHU\RXUOLIHZLWKDIRRO x O ne day, they are going to tear down all the churches and take the bells and melt them down, and make bullets to fight with. x O ne day, every wheel of industry is going to stop, and when they start up again, it will be in the Asiatics favor. x W hen destruction comes, I am going to leave enough fine buildings, so that my good Moors will be able to enjoy them. x O ne day, some of you old Moors are going to be so hungry that you are going to bite into your own flesh, and blood will skeet out, and you are going to get angry with \RXUVHOIEHFDXVH\RXGLGQ¶WSXWXSHQRXJKIRRG x T he Moors were once a sea-faring people and fed the world, the time is going to come, when we will go back and feed the world again. x I placed a ball on Babylon, and it is rolling down, and anyone that gets in the way, is going to be ground to powder. x I am going to repeat myself. x T hings are going back to the horse and buggy days. x I have detectives everywhere. x :KHQ,UDLVHP\IORRGJDWHLW¶VJRLQJWRWDNHVHFUHWDULHVWRZULWHGRZQWKHQDPHV When the time is ripe, about the year 2000, the eyes of the Moors will open and see what T he Holy Prophet has brought to them. x I am due in the E ast right now. I am going to have to go and straighten out the E ast, and then I will end up in the W est. T his (T he W est) will be the easiest. You will be able to lie down and sleep, and wake up in peace. T his will be, just a breakfast figh t. By the time you eat breakfast, it will all be over with. 23 x I was given a high name over there (In Mecca) but you cannot use it over here. Be good Moors and I will hand it down to you. H e DUULYHG LQ $UDELD DV DQ ³$QJHO´ (Moslem) from Egypt. There (In the Holy City of Mecca) He, Timothy Drew, was given the Holy Attribute through the Head of the Holy City, Sultan Abdul Aziz Ibu Suad, a GLUHFWGHVFHQGDQWRI+DJDUZKRQDPHGKLP³E l H aj j Sharif A bdul A li´ x O ne day, blood is going to flow in the streets up to a KRUVH¶V brow. x O ne day, bombs are going to fall so that they ZRQ¶W miss a spot as wide as my shoe. You are going to need a basement to hide in. x I have the world in a jug, and the stopper in my hand. I have the Asiatic, and I have the E uropean. I have the silver and I have the gold. x O ne day, people are going to be so hungry that the only way that you will be able to turn them away, will be at the point of a gun. x I have mended the broken wires, and have connected them with the higher powers. x +RZ PDQ\ RI \RX FDQ GR VRPHWKLQJ"´ (Work magic). Some of the Moors stood up. The Prophet pointed His finger at them and said, ³,DPJRLQJWRNLOO\RXDOO´(When a 3URSKHWVSHDNVWKDWLVDPHVVDJHIURP$OODK7KH+RO\3URSKHW0RKDPPHGVDLG³7KH sorcerer ZLOOQRWHQWHU3DUDGLVH´ x T here are going to be new Moors that are going to come in with their eyes wide open, seeing and knowing, that are going to take you old Moors, seat you in the back, and car ry out my law. x I can throw out a spirit that would make the Moors want to fight, and then throw out another spirit that would bring them back to peace. x T he climate is going to change. T he cold weather will be in the South, and the warm weather will be in the North. x I brought you your nationality, your religion, and title to your vast estate. W hat do you want me to do; kill you? x I am going to burn up sin, both root and branch. x Money will be burnt in the streets, and we ZRQ¶W be able to buy much; and when I put my spirit in the streets, you ZRQ¶W be able to sell your car for 25 cents. x A llah alone guides the destiny of this Divine and National Movement. 24 x T he Moors once ruled the world; now get ready to rule it again. But this time LW¶V going to be done under Love, T ruth, Peace, F reedom and Justice. x O ne day, all of the property is going back to the government. x I would like to save half of the people, but I am going to try to save a fourth of the people. T here is just going to be a handful saved. I can count them on my fingers, and have fingers left over. x Before the E nd of T ime, I am going to lower down the evil spirits, and let them incarnate. x If someone assaults you, flee from him. If you cannot flee from him, turn around, and drop the world on him. x W e are going to be taxed to death. (See: 3URSKHW¶V Warnings Today) x If you are not careful, your own brothers will try to put you in slavery. Some Moorish Brothers attempted this immediately after T he Holy Prophet left His body. 2IILFLDOVEHJLQE\PL[LQJ0HPEHUVKLSUHJLVWUDWLRQVZLWKÄ1DWLRQDOL]DWLRQ&HUHPRQLHVெ Note: Noble D rew A li QHYHU³1DWLRQDOL]HG´DQ\ PDQZRPDQRUFKLOG7KHVHUHF\FOHG Western Masonic Rituals alone mislead the public to think Moorish American was not a Nationality but a membership in a religious cult and the Moorish Science Temple itself was assumed to be their Religion. This self-enslavement practice set off mass confusion and division within the ranks of the Moors that would last over seven decades. x A t the end of time, those that will be in the apparatus will be able to look down on earth, see people that you know, fleeing for their life. x You are going to be saved but in a conflict that cannot be told in words. x I could tell you some things that would turn your brain to water. x I am going to save you all, if I have got to kill you all. x If I cannot teach you here, I will teach you on the soul-plane. x I have come, and taken away all the excuses. x If you GRQ¶W leave here right with me this time, you ZRQ¶W make it back here in human form. x A tlantis is going to arise again. 25 A bout Moorish Men and Women x O ne day, women are going to be chasing men like a hound running a rabbit. x T he Holy Prophet told the Moors to try to live close together. x T he Moors are the off-springs of K ings and Q ueens. x T he third and fourth generation will see the good of my wor k. x O ne day, there are going to be so few people, that when you see an old Moor, you will run up to him, and kiss him all on top of his head. x T here will be so few men, that a child will go to the store, and return home, and tell KLVPRWKHU³0RWKHU,VDZD PDQ´ x I have got two wives. O ne day, you will be able to have two, or as many as you can afford. x O ne day, you are going to look out into the streets, and the streets are going to be filled with men with turbans and fezzes, and the highways are going to be blocked. x T he Moors are a dangerous people. I am not going to wake you all up at once. If I do, I ZRQ¶W be able to do anything with you myself. x W hen you get mar ried, go before your G rand Sheik, and let him perform the ceremony. Some of the Moors did not obey T he Holy 3URSKHW¶V order, so H e told the Moors, go downtown, and buy your wives (Get a Marriage License) from the (XURSHDQV´Moors did not comprehend their free national status brought by T he Holy Prophet. They simply did not believe in the capacity of their own People. Noble Drew A li knew every nation has their marriage laws and customs for their citizens. A free national Being does not need sanctioning from a former slave master or another JRYHUQPHQWWRPDUU\2QO\WK$PHQGPHQW3HUVRQVVHHNÄ'RZQWRZQ2.VெIRUWKHPWR jump-da-broom. x Money does not make the man, and clothes do not make the man. It is character and free national standards that make the man. Ä1DWLRQெLVWKHURRWZRUGLQÄQDWLRQDOெDQG ÄQDWLRQDOLW\ெ. To be a man with power, he must have free National Standards and principles. These kinds of power only exist within the constitution of his; own free national government. x If you try to tell what a man is by looking at him, you are burnt up from the start. 26 x If your brother wants something, give it to him so that he ZRQ¶t sin. x O ne day, there are going to be so many women, a man is going to have to run for his life. 7RGD\ WKHUH DUH QHDUO\ HOHYHQ PLOOLRQ ³6LQJOH 0RPV´ DPRQJ WKH 0RRULVK people in the Corporate United States. x C hildren, sow good seeds. x If you have a wife, and she does not belong to the T emple, instead of giving her one apple, give her two. The duty of a husband is to educate his wife upon the straightway to Allah. Allah is love. The apple is symbolic of educational contributions. The Holy Prophet is saying love her twice as much by educating her with truth, peace, freedom and justice. x 'RQ¶W put the E uropean on your brother. x If your B rother does something wrong to you, GRQ¶W FDOOKLPDÄQLJJHUெ&DOOKLPD dirty Moor. x Use kind words towards your wife. x C ats are evil spirits, and if you knew what a black cat was, you would not want one around. x 'RQ¶W keep dogs in your house, because if you inhale one of its hairs, it could cut your throat. x I am not going to wake up all the Asiatics at once, because they may tear up something. x If my own mother is not right, I am not going to let her get by. x Pray that you GRQ¶W have to make your flight in the winter time. x If you put your hand to the gospel plow, and turn loose, it would be better, if you never took Holt. x You can walk down the street by yourself now, but one day, you ZRQ¶W be able to do that. x O ne day, you will see a $20.00 bill in the street, and would not bend over to pick it up. 27 x 7KH0RRUVெZDWFKGRJLVQRWDGRJEXWDQHOHSKDQW x I have come for the children, and the unborn generations. x T he only one that wor ks all the time is a coolie. x %URWKHUVGRQெW mar k your fez, it shows you are free. Be the (plain) T ruth like me, your Prophet. The fez is the infinite Headdress of the African God-Man. Neither he nor it can be limited, enslaved or bound. Marking the fez makes it finite, territorial and binding. x Sisters wrap your turbans in the colors of the rainbow. Turbans can be any color found in the rainbow. Sisters should not wear black turbans because she is a Giver of life. x Moors look your best. E xperiences GXULQJWKH3URSKHW¶V/LIHRQ E arth x W hen I was born, it turned black dar k in the day-time. T he people put their hoes down, and came out of the fields. x The Holy Prophet Noble D rew A li showed some Moors one night, a spot in Chicago, Illinois, where a Moabite Queen ruled from. Her name was Queen Netha, and she waged war against five Pharaohs. At that spot, the Holy Prophet dug down into the ground, and dug up a metal bar with foreign writing on it. x If you have a dream and you forget what you dreamed, to remember it, place your forehead face down on your pillow, and you will remember it. x If you dream of me, it is like seeing me for true, because the devil cannot steal my appearance. x At a meeting where the Holy Prophet was present, He saw 10 Arabians, 5 Turks, 2 Chinese and 1 Japanese join the Moorish Science Temple of America. The Secretary asked the Holy Prophet, ³Prophet, these people have their nationality, what should I put RQ WKHLU 1DWLRQDOLW\ &DUG"´ ³T he Moors were the first people, and all other people WKDWXVHRXUQDPHZHUHDGRSWHGLQWRRXUWULEH´Give all members a Tribal Name of the Moorish to let them know they have rejoined the Founders of the Human Family. The MST of A do not have the power to issue nationality or change man from the descendant nature of his Forefathers but here everyone must proclaim their free national name as we are teaching our people their nationality. 28 x , JRW KHUH MXVWLQ WLPH´ 7KH 3URSKHW said the Europeans were looking for Him with airplanes and with dread-naughts. When the Holy Prophet returned to The United States +HZDVDVNHG³:KHUHDUHWKRVHERRNVWKDW\RXKDYH"´7KH Holy Prophet just smiled, but He told the Moors that He had the book in His head. When the Holy Prophet dictated the Holy Koran of the Moorish Science Temple of America to the printer, He did it from memory. The printer was amazed. x T ake a good look at me, so that you will know me when you see me. W hen you see PHGRQ¶WVSHDNWRPHXQOHVV,VSHDNWR\RXILUVW x Some dirty Moors paid hit men to kill the Holy Prophet. When the hit men went to the temple, where the Holy Prophet was teaching, they opened the door and found the temple building full of soldiers. The hit men went back to the people that hired them and tROG WKHP ³'RQ¶W \RX SD\ XV WR GR DQ\WKLQJ WR DQ\ RI WKRVH 0RRULVK $PHULFDQV´ (During the life of the Holy Prophet, there were many members of the National Guard, both officers and enlisted men that were members of the Moorish Science Temple of America in Chicago, Illinois. x T he Holy Prophet gave a party for the Moors. The Prophet had everything fixed up nicely. H e even had pool tables for their enjoyment. The Moors were happy and the Holy Prophet said, ³, DP KDSS\ ZKHQ P\ 0RRUV DUH KDSS\´ But some unconscious Asiatics tried to break up the party. When they tried, some of the Moors, who were members of the National Guard, went to the Armory, and came back to the party with army tanks, trucks and guns. When the Asiatics saw this, they took off with such fright that some of them ran into buildings, and knocked themselves out. The word got out, ³'RQ¶W PHVV ZLWK Prophet Noble D rew A li, because He is connected with the government. x T he Holy Prophet told the Moors before the bank crash in 1929, ³,f you have money in WKHEDQNJHWLWRXW´³3XW\RXUPRQH\LQWKHSRVWRIILFH´Those that obeyed the Holy Prophet saved their money. Those that did not lost their money. x W ake up you sleepy headed Moors. I am going to take you up above the sun, moon and VWDUVDURXQGWKHWKURQHRIWKH0LJKW\$OODK´7KH+RO\3URSKHWtook the Moors XS DERYH WKH EOXH HWKHUV DURXQG WKH WKURQH RI $OODK $Q HOGHU EURWKHU VWDWHG ³0RRUV \RXU3URSKHWLVWUXO\D3URSKHW´ x I have fixed everything; I have stopped up every rat hole. x Members in the temple sat and watched as a dirty Moor, full of rage, went after the Holy Prophet a knife. The Moors just looked and would not protect their Leader. After DYRLGLQJWKHDVVDLODQWெVDJJUHVVLRQV T he Holy Prophet turned, faced him suddenly and as quick as a thought, H e cast out the spirit of anger from the Moor. The would-be assassin became meek as a lamb and apologized for his wrong doing. T he Prophet said 29 ³I know you did not know and I forgive you son´$IWHUWKHHYHQWWKH Holy Prophet told the Moors, ³,KDYHJRWDJRRGPLQGWROHDYH\RX´ Then the Moors got down on their knees, and begged the Holy Prophet not to leave them. About that time a man suddenly appeared between the members and T he Holy prophet. He was dressed in Turkish Garb and by the mysterious way he came he had to be an Angel. He never looked at D rew A li EXW WROG WKH 0RRUV ³,I \RX KDUP D KDLU RI +LV KHDG ZH ZLOO FRPH DQG GHVWUR\\RXDOO´7KH0RRUVKDYH\HWWROHDUQKRZWRSURWHFWWKHLU+RO\SURSKHWRQ(DUWK as He is in Heaven. x I took the cover off all the secret organizations. This statement alone proves D rew A li was not a Freemason (See: $XWKRU¶V Commentary). x In two weeks, I am going down South. W hen I get down there, the K u K lux K lan is going to stop me. A t first, it is going to look like they are against me. T hen they are going to lead me to where I am going. x &KLOGUHQLI\RXZDQWWRFRPHXSWRVHHPH\RXFDQ´Simply be yourself, the Logos Circle Seven and meditate beyond the Blue Ether Plane. There Man, Spirit Man, can visit the Prophets of all times and climes. T he Holy Prophet in U. S. C ities and O ther Countries x C hicago, Illinois is going to be our new Mecca. x C hicago is doomed and Detroit must go down for what they have done to I, your Prophet. During His Divine Ministry, the Holy Prophet was unduly arrested in both Detroit, Michigan and Chicago, Illinois. x O ne day, grass is going to grow up in Detroit. One day the famous industries will leave Detroit and grass would reclaim those sites. x T he Holy Prophet asked the Moors in Detroit, Michigan, ³+RZZRXOG\RXOLNHWRKDYH \RXU RZQ 0D\RU DQG &KLHI RI 3ROLFH"´ 7KH 0RRUV VDLG ³<HV´ 7KH 0RRUV ZHUH blessed to have an Asiatic Mayor and Chief of Police in that same city. x T here is going to be an earthquake that will split the United States in two. x If my Principles of Love, T ruth, Peace, F reedom and Justice are car ried out, the United States will be the richest and most prosperous country on the earth. If not, the worst is yet to come. x W hen the Moors ruled Spain, we had street lights in Seville, Spain 400 years before they had them anywhere else in E urope. 30 x W hile I am talking to you Moors, my spirit is over in India with them, and those old sisters are jumping this high, (as high as He was holding His hand) because of my coming to them. x Money will be burnt in the streets, and we ZRQ¶W be able to buy much; and when I put my spirit in the streets, you ZRQ¶W be able to sell your car for 25 cents. x A ll nations will turn against the United States one day. x O ne day, the United States will not be able to do any business, unless they do it through the Asiatics. x Moors that were in the Temple during the lifetime of the Holy Prophet Noble D rew A li said that when the Holy Prophet came to town, you would have to go to the temple early to get a seat, and you could not get a seat in the front row, because the foreign Moslems would be sitting in the front row to see and hear the Holy Prophet. x C hicago is going to be your new Mecca. x T he Holy Prophet and Bro. Kirkman-Bey had gone to school together. T he Holy Prophet asked C. Kirkman-%H\³&DQ\RXVSHDNKLJK*HUPDQ"´Bro. C. Kirkman-Bey UHSOLHG³<HVEXW,DPDOLWWOHUXVW\´ T he Holy Prophet reached into a trunk, pulled out a book, and dusted it off with a feather duster, and handed it to Bro. Kirkman-Bey, and he read from it. T he Holy Prophet was satisfied, and told him that He had to go down to Cuba, and He wanted him to go with Him. Bro. Kirkman-Bey told the Prophet that he had a wife and children. T he Holy Prophet let him know that they would be provided for. T he Holy Prophet took Bro. C. Kirkman-Bey to the Pan American Conference in Cuba in 1928. x In 1928 T he Holy Prophet and Bro. Kirkman-Bey went to Havana, Cuba for the Pan American Conference. The Holy Prophet and His Cabinet of Moorish Officials attended the Conference to represent, for the first time, the Moorish Americans as a clean and pure Nation of People. It should be noted H e and the Moorish Vanguard did not go to this Conference of Nations as members of a religious organization (MST of A). There was an Indian Chief representing the American Indians. The nations of North, South, Central America and some Atlantic Islands were present. Secretary of State Hughes of the United States represented the United States at this conference. Bro. C. Kirkman-Bey, who spoke 92 different languages, was the interpreter for the Holy Prophet at this conference. Bro. Isaac Cook-Bey said that when the Holy Prophet and Bro. C. Kirkman-%H\ெVVKLp was tied up at the dock, the Cuban army was standing on the dock, and Bro. Kirkman-Bey announced the presence of E l H aj j Sharif A bdul Ali and said something to them in Spanish which caused the army to stand at attention. It was then he and the Holy Prophet came down the ramp of the ship. Kirkman Bey addressed the conference in both Spanish and Arabic, and when the Secretary of State of the United States heard Bro. Kirkman-Bey 31 VSHDN KH VDLG Ä7KDWெV D GDQJHURXV PDQெ 7KH 8QLWHG 6WDWHV KDG ORVW LWV 6RYHUHLgn Power in 1871 and subsequent 50-year Mandate for this land had expired in 1921. At this conference, the mandate for this land was returned to the Moorish, original indigenous owners of the land, through Prophet Noble D rew A li. The Prophet reportedly showed the mandate to His officials in the Adept Chamber. T he Prophet L ineages of Noble D rew A li x I remember when I was on the soul-plane. I remember when I was Noah. Noah was a carpenter and he built the A r k. W hen the flood came, men swam out to the A r k, DQGNQRFNHGRQWKHGRRUDQGVDLG³1RDK1RDKOHWXVLQ´DQG,WROGWKHP³7KH GRRULVORFNHGDQGDQDQJHOFDPHDQGWRRNWKHNH\DZD\´ x People left the G arden of E den, and died by the thousands, but it was the Moors that were able to traverse the desert, and go into other parts of the world to inhabit. x T hose that were with me 2,000 years ago are with me today, and those that were against me 2,000 years ago, are against me today. D rew Ali often told the Moors when He appeared on Earth as Yehoshua (Yehoshua). x C hildren, your hair is not kinky. It is wooly like your B rother Jesus. x ³-XVWDV-RKQZDVWR-HVXVLQWKRVH days, M arcus G arvey is to me today. You should have taken heed to every word he said. I am just getting back from pulling my brother (Marcus M. Garvey) from WKH OLRQ¶V den (U. S. P. in Atlanta) DQGKHKDVJRQHRQ´ x W hat you do not know can build another world. x W hen the wild beast roamed the earth in large numbers, and you could hear the large birds flapping their wings at a long distance, it was the Moors that took the sword and went out and splayed the beast so that civilization could come in. 32 x ³%HIRUHRQHMRWRUWLWOHRIP\ZRUGIDLOVWRFRPHWRSDVVKHDYHQDQGHDUWKZLOOSDVV DZD\´ x One of 'UHZ $OL¶s Divine Ministers told of a time when he had set up a meeting of Christian preachers to council with the Holy Prophet to see whether these preachers would follow the Holy Prophet. The Preachers and Pastors were assembled and the Divine Minister was addressing them before the Holy Prophet came to the meeting. One RI WKH SUHDFKHUV VDLG ³LI +H Noble D rew Ali) could do what Moses could, I would IROORZ+LP´ T he Holy Prophet was not present in the room when this statement was made, and the meeting place was on the third floor of the building that they were in. When the Prophet DUULYHGDWWKHPHHWLQJ+HWROGWKHSUHDFKHU³I can do what Moses did, but if I came walking into the meeting with a lion on a chain, you would jump out of the window and kill yourself.´ x Asiatic Preachers and M asons will be the last to come home. T hey will fight me tooth and claw but cannot win. x I was Mohammed. Mohammed defeated the Roman E mpire. W hen I conquered Rome, we went in with the sword. You could hear the swords swinging. I cut the head of Rome off; pulled down the flags; sent letters to the other E uropean JRYHUQPHQWV DQG DVNHG WKHP ZDV , ULJKW 7KH\ VDLG ³<HV 0RKDPPHG \RX DUH ULJKW -XVW OHW XV KDYH D SODFH WR OLYH´ 7KH +RO\ 3URSKHW VDLG³,ZHQW LQWR 5RPH with 72,000 men. W hen I ran out of men, I reached down, and picked up a hand full of sand, I threw it up in the air, and when it came down, there were soldiers seated on camels. x I am the fifth and last Prophet, and I am five times more powerful than I was before. We, as a people, were buried five times deeper in sinful ways than any nation enslaved before us. The Holy Prophet was ordained by the great God to be five times greater and more powerful than the Prophets before. Mohammed was the seal of the Prophets to bring the tenants of Islam. Yet, every major Prophet is the last Prophet to be raised from amongst those of his especial nation to be redeemed. Some Asiatic Muslims KDYH LQWHUSUHWHG WKLV ³6($/ RI 7KH 3URSKHWV´ LQWR WKH 0RRULVK EHLQJ XQZRUWK\ RI $OODK¶V /RYH and Mercy. After enduring the worst system of Chattel Slavery ever imposed upon a people and sanctioned by the religions of the Earth. Having been denationalized and stripped of Divine Creed some think the Moorish to remain the rejected corner stone of the Human family. The Moorish have earned the divine right and is most deserving of a Holy Prophet. No Messenger would be apt enough to save us. Surely Allah knows what men know not. x I can do what Yehoshua did, but you (T he Moors) are not in the condition that those people were in. x If I tell you that I am going to do a thing, I have done it already. 33 Religion x <RXU )RUHIDWKHUV DUH WKH )RXQGHUV RI WKH VWUDLJKW DQG QDUURZ WKH ZRUOGெV ILUVW religious creed and salvation. To this day it is called Islam. x Islam is that O ld T ime Religion. x Before the end of time, every knee will bow to Islam. x 'RQ¶W wor ry about how you are going to be saved. It will be done in a conflict that cannot be told in words. x A llah alone is perfect. x Some of my best Moors are still in the church. x Moslems are not made, they are born. A Moslem is made with the Will of Allah who made them. A Moslem is with or without a garb of flesh. x A nytime a Moslem goes into a church for any reason; it ceases to be church, and it is a temple. x 'RQ¶W throw away your Bibles, because I am going to use them to condemn the government. x Woe upon the man that calls himself a Jew. x O ne day, there is going to be a holy war. x You (Moors) GRQ¶W recognize Islam because it is yours. x Your religion is Islamism, something you live every day. T he Moorish Science T emple x T he Holy Prophet warned³:KHQ\RXPLVVWKHUHDGLQJRIP\ODZV\RXKDYHPLVVHG P\SDUWRIWKHPHHWLQJ´ x 7KH067RI$ெVPHPEHUVKLSLVJRLQJWRGZLQGOHGRZQWRDKDQGIXOEXWNHHSWKH GRRUVRSHQDQG,ZLOOGULYHWKH$VLDWLFVLQ:KHQ,GULYHWKH$VLDWLFVLQLWெVJRLQJ to take 10 secretaries, just to write the names down. 34 x O ne day, men are going to be running so fast that their coat-tails will be standing straight out. You will be able to shoot dice on their coat-tails. T hey are going to be running to get into the T emple. T he last ones to make it into the T emple will be the preachers, and the E uropeans are going to be beating them over the head, driving them in. x Woe upon the one that scatters my flock. x During the First Annual National Convention in 1928, one of the Grand Governors of a State failed to appear at the Convention. The Prophet sent a telegram to the Grand Governor informing him, that if he did not attend the Convention, the Holy Prophet was JRLQJWRKDYHWKH³*-0HQ´ 8QLWHG6WDWHV*RYHUQPHQW$JHQWV DUUHVWKLP x Your Nationality Card is going to change on you in your pocket. The Moorish will get a greater understanding of their One Free National Name as time goes on. They will realize membership and national status, though similar in structure, are worlds apart. x ,I\RXKDYHPRQH\DQGGRQெWJLYHLWWRPHWo uplift our people I am going to get it anyway. x 'RQெWOHWDQ\RIWKRVHIRUHLJQ0RVOHPVJHWXSLQ\RXUURVWUXPThese Moslems, who once enslaved their African Mothers and Fathers while holding the Great Quran behind their backs, are not strong enough to free the Moorish or lead them to paradise. x An elder Moor said he was walking down the street in Chicago, Illinois, and an Arabian came out of a store, and asked him to come into the store. He went with him. The Arabian pointed to a picture of Noble D rew A li DQGDVNHGKLP³'R\RXNQRZZKRWKLV LV"´7KHHOGHU0RRUVWDWHG³7KDWLVP\ Prophet.´ T he Holy Prophet said, ³$OOULJKW VRQ´ The store was full of Arabians, and the elder Moor said that all of them had Identification Cards for membership in the Moorish Science Temple of America. x <RXFDQOHDGDKRUVHWRZDWHUEXW\RXFDQெWPDNHKLPGULQN,DPJRLQJWROHDG some of you Moors all the way up to salvation, and you are going to turn around and go the other way. x At the First Convention in 1928, Prophet Noble D rew A li said, ³7KHJDUPHQWWKDW, have on represents power and if you obey my voice, you will have power with me. I DPJRLQJWRIUHH\RXWKRXJKLWெVKDUGEHFDXVHRI\RXUPL[WXUHZKLFKEULQJVDERXW many different spirits. W hen you fail to hear my voice, you are lost. It is against the law to stand up in any audience intoxicated. T he leader is not to stay out all night, giving earnings away to someone else. You who are heads of T emples, it is easy for you to destroy the influence of the T empleQRZODFHXS\RXUVKRHVDQGJHWULJKW´ ³<RXVWRSILJXULQJRXW\RXUZD\KRZ\RXUVDOYDWLRQVKDOOFRPHMXVWIROORZPH<RX 35 can say one thing Moors, you have made a start for the kingdom. If you want VXFFHVV \RX PXVW IROORZ WKH 3URSKHW´ ³+XVEDQGV WDNH care of your wives, and IDPLOLHV:LYHVNHHS\RXUKRPHVDQGFKLOGUHQFOHDQ´³,KDYHGRQHPRUHWKDQ\RX think. I want you to help me by your good deeds of living at home, and abroad. It is through your good, not with your lips, trying to be the front seat in everything, always standing in my face. Moors, be careful of your steps, leaders of T emples must be careful how they walk. T hey must be an example. I am not asleep; it will take you Moors a long time to find out what I did today. W hen you all go home, dRQெW VWDUW QR VWXII IRU , ZLOO EH ULJKW WKHUH OLVWHQLQJ DW \RX´ ³7KLV LV QR VRFLDO RUJDQL]DWLRQ LWLVD GLYLQHDQG QDWLRQDO PRYHPHQW %\\RX EHLQJERUQ KHUH GRQெW make you a citizen (one must proclaim his nationality before his Government to be recognized as a citizen). Look what I have on, now this was handed to me by the JRYHUQPHQW ,W UHSUHVHQWV WKH UR\DO SULQFH´ (T he Holy Prophet wore a mantle of power.) ³,KDYHPHQGHGWKHEURNHQZLUHVDQGKDYHFRQQHFWHGWKHPZLWKWKHKLJKHU SRZHUV´ x T he Holy Prophet was at a meeting speaking at the temple in Detroit, Michigan. An Asiatic got up while T he Prophet ZDV VSHDNLQJ DQG VDLG ³,I WKDW PDQ LV D SURSKHW , ZRXOGEHZLOOLQJWRJLYHXSP\OLIH´7KLVDQJHUHGVRPHRIWKH0RRUVWKDWKHDUGLW6RPH of the Moors started moving up on this man with their hands in their pockets, and they were going to cut him to death, but the Holy Prophet held up His hand, and said, ³&KLOGUHQ GLG \RX KHDU WKDW ,W LV WRR EDG´ After the Holy Prophet spoke those words, this Asiatic fell back into his seat, and slumped down. When the Moors carried him out of the building, he was dead. x T he G rand Sheik of a T emple should go to the Temple, hang the C harter on the wall, say the Moorish-A merican prayer, when it is time for the meeting to open, and if no one comes to the meeting after he sits and waits for one and a half hours, then take the C harter down off the wall and go home. x T here is but one A llah, one Prophet of the T emple, and one Moorish Science T emple of A merica. As there is but one Allah, there is just one Prophet of the temple and he came to save one Moorish American Nation. x W hen you take care of T emple business go in numbers of two, three, five and seven. x 0RRULVK /HDGHUV GRQ¶W EXUGHQ P\ 0RRUV Moorish Leaders are to lead Moors to uprightness, freedom and independence. Anything short of truth is a burden. x :KHQFKLOGUHQVWDUWFU\LQJLQDPHHWLQJWDNHWKHPRXWRIWKHPHHWLQJ´ x Do not bring children to an adept meeting or in the building wher e an A dept meeting is taking place. 36 x ,I\RXJRWR$GHSW0HHWLQJGRQ¶WWHOODQ\RQHZKRGRHVQRWJRZKDWKDSSHQHGDWWKH meeting. x T ry to have your temples in buildings, where the meetings are on the second floor. Your services can be better secured and held without inter ruptions of trafficking peoples. T he Holy Prophet Speaks O n H ealth x T he Holy Prophet Noble D rew Ali used to heal people, and people came to Him for counsel. An elder Moor said that when he was in Baltimore, Maryland the Holy Prophet was healing people. The elder Moor went to the head of the stairs, and told the people, ³7KHProphet is tired. He has been healing people all day long. Go home. x T his food here is, just E uropean poison. x People are going to be dying like hogs with the FKROHUDDQGWKHGRFWRUVZRQெWNQRZ what is wrong with them. T he only thing that is going to save them is my remedies. x ,I\RXVWHDOP\PRQH\LW¶VJRLQJWREXUQXSLQ\RXUSRFNHW x 0\UHPHGLHVZLOOFXUH\RXRIDQ\WKLQJWKDW\RXZHUHQ¶WERUQZLWK x O ne day, some of you Moors are going to be walking around with skippers (those DUHPDJJRWV IDOOLQJRXWRI\RXSUD\LQJWRGLHDQGZRQ¶WEHDEOHWRGLH x Boil your drinking water. This warning was given in 1924. Today, the water pockets and air of the earth has been contaminated by the European Rulers. Drinking water is as The Holy Prophet prophesied. x 7KHUHLVJRLQJWREHIDPLQHLQWKHODQG´Today in The United States and other parts of Africa there is a man-made A.I.D.S. Epidemic claiming millions of lives annually. This DQGRWKHUGLVHDVHVZHUHXQKHDUGRIDQGXQIRUHVHHQGXULQJWKHSURSKHW¶VWLPH x %R\VZK\GRQ¶W\RXEHOLNH,\RXU3URSKHW",GRQ¶WGULQNDQG,GRQ¶WVPRNHEut if \RX GR GRQ¶W VWRS LW DOO DW RQFH ,I \RX GR \RX PD\ KXUW VRPHWKLQJ During the 3URSKHW¶V WLPH PDQ\ 0RRUV IUHVK RXW RI VODYHU\ KDG EHFDPH DGGLFWHG WR SRLVRQRXV smoking and drinking. There is a corrected mental process to follow when breaking away from these physical addictions or one may cause harm to self and others. Nonetheless, RQHPXVW³6WRS´LQRUGHUWRLPLWDWHWKH Holy Prophet¶VKHDOWK\DQGKROLVWLFZD\RIOLIH x 'RQ¶WGULQNDQGFRPHWRWKHWHPSOHDQGVLWGRZQQH[WWRSHRSOHZLWKOLTXRURQ your breath. 37 x If you have to drink, go into your room. Harness your weakness to yourself and conquer it to gain strength. x You say that you want some pure meat to eat; no one is going to kill a camel for you to eat over here. x An elder sister went to the Holy Prophet because she had been sick. T he Holy Prophet listened to her and said, ³6LVWHU \RX DUH JRLQJ WR JHW ZHOO , ZDQW \RX WR JR WR WKH 7HPSOHLI\RXKDYHJRWWRFUDZO´ 3URSKHW¶V:DUQLQJV7RGD\ ³:H$UH*RLQJ7R%H7D[HG7R'HDWK´ Today, the DYHUDJHKDUGZRUNLQJ$PHULFDQKDVEHFRPHVRDFFXVWRPHGWRSD\LQJ³7D[HV´XQWLO WKH\ FRLQHGWKH SKUDVH ³7KH RQO\ WKLQJVFHUWDLQ LQOLIH LV GHDWK DQGWD[HV´ <HWOHVV WKDQ <HDUV $JR :KHQ 1REOH 'UHZ $OL ZDUQHG ³W e are going to be taxed to death´ 1RQH RI These Accepted ex post facto Taxes Existed: Accounts Receivable Tax Building Permit Tax CDL License Tax Cigarette Tax Corporate Income Tax Dog License Tax Federal Income Tax Federal Unemployment Tax (FUTA) Fishing License Tax Food License Tax Fuel Permit Tax Gasoline Tax (42 cents per gallon) Hunting License Tax Inheritance Tax Interest Expense Inventory Tax Liquor Tax Luxury Taxes Marriage License Tax Medicare Tax Property Tax Real Estate Tax Service Charge Taxes Social Security Tax Road usage Taxes Sales Tax Recreational Vehicle Tax School Tax State Income Tax State Unemployment Tax (SUTA) Telephone Federal Excise Tax Telephone State and Local Tax Telephone Usage Charge Tax Utility Taxes Vehicle License Registration Tax Vehicle Sales Tax Watercraft Registration Tax Well Permit Tax Workers Compensation Tax Telephone Federal Universal Service Fee Tax Telephone Federal, State and Local Surcharge Taxes Telephone Minimum Usage Surcharge Tax Telephone Recurring and Non-Recurring Charges Tax 38 1863 marked the first time the United States filed bankruptcy resulting from a total national debt of $2,682,593,027.00. This introduced the 1863 Taxation on Income to finance the Civil War but actually began an unlimited range of unlawfuOGLUHFWWD[HVDQGWKHQRZIDPRXV³,56 )2506´ ,URQLFDOO\ 7KH 8QLWHG 6WDWHV KDG QR QDWLRQDO GHEW SULRU WR WKLV HYHQW 7KLV National Debt also vented the re-institutionalization of Slavery under the 14th Amendment and FLWL]HQெV Ä6WUDZPDQெ %\ WKH UNITED STATES HAD lost her Sovereignty and had returned to its colonial Corporate Status. Today, for what was once the most prosperous nation in the world but have over taxed its citizens, has now turned every nation against it ... just as prophesied by Noble Drew Ali. Still do not believe he is a Prophet? Continue to watch his prophesies. PR O O F W ho O ur Prophet Is Not and W hat He Did Not Say (A B rief A ddendum by the A uthor) Like most Readers of the day, the author was not physically manifested during the actual life time of T he Holy Prophet. Yet, any Kemetian Adept, Theologian or Historian of the Human Family would clearly surmise that most of the public opinions of D rew Ali derived from those who saw no need to protect the sanctity and Divinity of his Prophethood. He was an Angel of Allah to say the least. He came in due time. But His Holiness has been obscured due to standard doubts of His People. There have been slanderous remarks, loose talk and unsubstantiated western Islamic philosophies about the authenticity of Noble D rew A liெs ordination to the station of Prophet. This Author is compelled to add this commentary to the above Moorish Hadiths of Noble D rew A li. Some of thH³2UDO6WDWHPHQWV´VSRNHQGRZQE\VRPHRIWKH(OGHU Moors, have been omitted as unsubstantiated social hearsay because their comments did not balance with the sacred preparations, status or duties required in the linage of Minor and Major Prophets in the Holy Likeness of D rew A li. The following three subjects are examples which have lead to much of this confusion: W hat Did T he Holy Prophet Not Say A bout: 325.,WZDVUHSRUWHG³$6LVWHU´VDLGWKDW³VRPHRQH´LQ&OHYHODQG2KLRVDLG³7KH3URSKHW condones the eating of pork. This great Islamic dietary injustice do not balance with T he Holy Prophet ZKRKDGHDUQHGWKHQDPHRI³F aithful´ EHLQJGHFODUHGD³Moslem´ DQGJLYHQWKH ,VODPLFDWWULEXWHRI³E l H aj j Sharif A bdul A li´XSRQFRPSOHWLRQRIKLV+DMMLQ7KH+RO\&LW\ of Mecca in 1912. Why does my Prophet have to be the only one, in all the history of SURSKHWGRPWRPDNHVZLQHNRVKHUHQRXJKWRHDW"":RXOGD0RVOHP/HDGHUHYHUVD\³0RRUVLW LVDOULJKWWRHDWSRUN"´1R+HGLd not say that. It does not balance. THINK MOORS! THINK! FREEMASONRY: Noble D rew A li was not a Mason. During H is life time T he Holy Prophet named all H is stations and not once did He say H e was a Mason. Examine his life: He was born Timothy Drew on January 8th, 1886 and left the United States at the age of sixteen. A man must be at least 21 years of age to join any Masonic Lodge. Drew was too young to be made a Mason before He left these shores. He spent the next ten years in Egypt learning the same duties of a Prophet as Abraham, Solomon, Yehoshua and Mohammed before him. Upon passing all the 39 tests and completing his Adept education, Timothy Drew made his pilgrimage to Mecca where H e received further authorization to teach old Islam in the West. By the time he returned to America, at the age of 27, H e ZDVDIXOO\FRQVFLRXV³Moslem´ 2QHZKR is the Will of Allah). H e was then too wise to become a Freemason and too high with infinite wisdom to lower his will to the human knowledge of a Most Worshipful Master. Not only that but He had to become a Moslem BEFORE being accepted into the Holy City of Mecca. Had he not been divinely prepared to make the required Hajj, he may have made it in the gate but certainly would have not come out without carrying his body in a bag and head in a sack! Besides, what, pray tell, could any Negro-Colored-Christianized Mason possibly teach a Free National Man? Why would He submit to a mankind when He is an Angel of the Most High God? Again, no balance. THINK MOORS! THINK! ³, $P $ &,7,=(1 2) 7+( 86$´ 'UHZ $OL QHYHU GHFODUHG KLV SHRSOH LQWR WKLV KRD[ RI ZHVWHUQFLWL]HQU\)LUVWDQGIRUHPRVWD86Ä&LWL]HQெRUÄ3HUVRQெLVSURSHUW\DQGVXEMHFWWRWKH jurisdiction of Corporate USA. The Moorish Americans cannot be a Sovereign, free, independent nation of people while under the yoke and laws of the very people who 2236,(6 DFFLGHQWDOO\HQVODYHGWKHPIRU\HDUV0RUHGLUHFWO\WKH\FDQQRWEH³$&LWL]HQ RI 7KH 86$´ 6HFRQGO\ WUXH IUHHGRP LV 6RYHUHLJQ DQG LQ WKH PHPRU\ RI QDWLRQDO consciousness. and not in the power of the captors. T he Holy Prophet VDLG³H is nationality is Moorish A merican and our nationality is Moorish A mericans.´ H e often referred our nationality as our one free national name$PDQெVQDWLRQDOLW\LVKLVWUXHLGHQWLW\Dnd proper VWDWXV1DWLRQDOLW\LVWKURXJKWKHGHVFHQGDQWQDWXUHRIRQHெVIRUHIDWKHUVDQGKDVQRWKLQJWRGR with his religious affiliation. You are either born Moorish American or to one of the other nationalities in the Human Family. Now, exactly what part RI³0RRULVK$PHULFDQ´GR\RXUHDG Ä8QLWHG6WDWHV&LWL]HQV"ெ+HDOVRVDLG³Just because you were born here do not make you a citizen´ 'R \RX KHDU 86$ LQ DQ\ RWKHU IUHH QDWLRQDO QDPH H J ³&KLQHVH´ ³*HUPDQ´ RU ³*KDQDLDQ"´:K\ZRXOGRXUProphet be the first of the prophets to return his People back into the iron hand oppression of former slave masters where he had found them? In fact it was the Congressional ratification of assumable jurisdiction held in the 14th & 15th Amendments which re-enslaved the freed Moors that prompted Allah to raise H im from amongst us. If making 14th Amendment Citizens of the Moorish Americans was in order, Drew Ali would have never ZDUQHGKLV3HRSOH³7KHUH is no redemption in these A mendments for my people´)XUWKHU there would have been no need for 40 million Moors praying for the coming of Noble D rew Ali had they been freed by being made true citizens of the USA. Besides, when did Drew Ali ever work for the United States Department of Immigrations with the authority to issue USA Citizenship Papers? Why would He teach the Moorish to be themselves only to return them back into the ironhanded oppression, Jim-Crowism, Segregations and racism they suffered before he came? And would that have saved his people and fulfilled his duty as a Prophet? Hell, if this was in any ways true, Drew Ali could have stayed beyond the blue ethers because his coming would not have made a difference. There again is just no balance. This is why He said ³If I could just get you Moors to thinking, you would save your selves.´ 40 41 -+6-+-&7!1(//#+!&')((8!3##)-/'!/5-(+5(!09(:&!;,(/&-#+0)7! From: (OLKX¶V/HVVRQ Q . W hat is the Science of the Moorish People? A. The Science of the Moorish People is a Power that exerts itself for the individual at the will of its user. Q . W hen is the Power active? A. When the Moor is fully conscious of himself. Q . W hat do knowledge of H istory and the Reliance upon A llah do for a Moor? A. The knowledge of History and the Reliance upon Allah supply a Moor with strength that he may act in the cause of Justice. Q . W hat is this called? A. This is called functioning on all points. Q . How many degrees does each point represent? A. Each point represents 72 degrees and is functioning with maximum efficiency. Q . W hy do we Moors Love the E arth? A. We love the Earth because it is our home. It is our home as long as our bodies remain in its present form. We know the futility of trying to escape our environment. Q . W hat is our Science? A. Our Science is a living Manifestation. Q . Name some of the fields throughout the world that have been influenced by the Moors. A. To name a few we have: Navigation, Medicine, Agriculture, Philosophy, Mathematics, Textiles and Architecture. 42 Q . A re Food, Shelter and C lothing the main jewels in Moorish life? A. No, these are the last of twelve. Q . W hat are the T welve C rown Jewels of L ife? A. Knowledge, Wisdom, Understanding, Love, Truth, Peace, Freedom, Justice, Equality, Food, Shelter and Clothing. Q . W hat did Prophet Noble D rew A li say concerning the W est? $³7KH:HVWPXVWEHPDGHWRSD\WKHLUGHEWWRWKH0RRUV´ 4:KDWDUHWKHLQKHUHQWIDFWRUVLQD0RRU¶V1DWXUH" $/RYHRI$OODK6HOIDQGIHOORZPDQDQGDOORI$OODK¶VFUHDWXUHV Trustworthiness and fidelity in all affairs. Peace always first and foremost, Freedom and expression in all constituted and righteous acts, Equality to promote the Noble qualities of mankind. Q . W hat is the symbol of Islam? A. The Olive Tree. Q. W hat is the E mblem of Islam? A. The Crescent Moon and Star. Q . W hat is the G rand National Seal of the Moorish People? A. The Logos Circle Seven. The Circle is the perfect symbol, Seven is the Perfect number and Allah is the perfect word. Our National Seal is a single expression of how the Moorish are recognized. Q . W hat is the Scripture of Islam? A. The Holy Koran and all books that contain Truth for the guidance of man. Q . W hat is the Moorish National? A. The Morning Star. The Star of Solomon: the African God Man. Q . W hat does the Morning Star Symbolize? 43 $,WV\PEROL]HV³7KH*UHDW*RGLQ0DQ´DVDERYHVREHORZ DQG³7KH6SLULWRIDQDWLRQERWK LQPRUDOUHFWLWXGHDQGSK\VLFDODFKLHYHPHQW´ Q . W hen did this banner come into O rbit? A. The Banner sprang into Orbit after the Circumnavigation of Africa by the Moors; (Over 100 thousand years ago). Q . W hat type of Star is the Morning Star? A. The Morning Star is a Five pointed (open) Star. Q . W hat does the singleness of the Star Represent? A. It represents the oneness of Hue-Man-ity, which precludes the Grand idea of Monotheism. Q . W hat are the points of the Star called? A. Pentagrams! Q . W hat are the Pentagrams? A. They are an expression of the Science that breeds into the thought of Ancient Moors Mind. Q . W hat do these Pentagrams describe? $7KH\GHVFULEH0DQ¶VHYHU\SKDVHRIOLIHLQDVLQJOHH[SUHVVLRQ)RUWKLVFDXVHWKHLQILQLWH line of the circle also transcribes the never-ending openness of our pentagram. Q . W hen did the Moorish F lag change from pure white to Red? A. When it reached the rate of atmosphere. 44 -+6-+-&7!1(//#+!6#,)8!-/103-/3!*#)19</!6-)/&!5)((9!(1-',</!1(//#+! %!=>?@AB! 45 This Diagram Expresses The World's First Creed, Man's Only True Pathway To Return To +LPVHOI $V *RG &DOOHG ³,VODPLVP´ E\ 7KH /DVW 3URSKHW 7R 6LW ,Q 7KH (DVWHUQ &KDLU 2I Ancient Kemet,, Prior To its Transliterations From Africa Into The Four Major Nations 'HSLFWHG+HUH%HFDPH0DQ¶V2QO\%HDFRQ/LJKW7KH2QO\7UXH6WUDLJKWZD\7R7KH*UHDW God Is Through The Divine Self. The Highest Principle Of 0D¶DW &RPPDQGV³:LOO6HUYH1R god Outside Of The Self. All Other God-Roads And High Ideals Of Man Only Subject The Worshipper To Manifestations Of Slavery. ,VODPLVP 0DUNV 7KH 2ULJLQ 2I ³8QLYHUVDO +DUPRQ\ $QG 3HDFH )RU /LIH´ ,W ,V $ 7KRXJKW $FWLYLW\&RPPRQO\&DOOHGµ+HDYHQ¶µ3DUDGLVH¶2Uµ,VODP¶3HDFH,V7KH7KRXJKW-Activity And Breaths The Only Natural Breath Of Life For Man. Islamism Is The Active Name Of The World's Very First Religious Creed And Has Been Returned To The New Moorish American Nation In The Form Of God-In-Man. More In-'HSWK 6WXGLHV :LOO 5HYHDO ,VODPLVP $V µ7KH $QFLHQW.HPHWLDQ0\VWHU\6\VWHP´2U³6($8721*127+, 0DQ.QRZ7K\6HOI ,W:DV )RUPHG$V7KH:RUOG¶V)LUVW5HOLJLRXV&UHHG)RU7KH6DOYDWLRQ2I0DQNLQG2Q(DUWK,W+DV %HHQ5HWXUQHG)URP7KH$QFLHQW)RUHIDWKHUV2I7RGD\¶V0RRULVK$PHULFDQV7KURXJK7KHLU Avatar, El Hajj Sharif Abdul Ali. This Is Their True Way Of Life And Predates The Great Earthquake (Often Misnomer $V ³7KH )ORRG´ $QG 7KH 'LYLQH &LYLOL]DWLRQ 2I $WODQWLV $QG /DPXULD ³7KLV 2OG 7LPH 5HOLJLRQ´ ,V 7KH 2QH &UHHG 2I $PH[HP +DV %HHQ 0DVWHUHG ,QWR The Above Quadrant Of Sacred Schools. Islamism Is Revealed ³In the Creation And Fall Of Man´ %\'UHZ$OL$QG,V0RUH&RPPRQO\3RUWUD\HG,Q7KH3DUDEOHV2I³,VVD$QG,VKD´2U µ$GDP $QG (YH¶ $OO 2WKHU 5HOLJLRQV ([LVWLQJ ,Q 7KH :RUOG 7RGD\ $UH %XW 3RUWLRQV DQG Variations From The Bountiful Table Of Islamism. Peacefully Submitted, )URP³(OLKX¶V/HVVRQ´ (Lewisburg Moorish Preparation Center 1973) Dr. Elihu N Pleasant-Bey, Swift Angel #1 46 ,1),1,7</(6621),9(6:,)7$1*(/6(/,+86/(6621! (Revised 1977 ± 2010) W hat Is A n A ngE l? Have you ever ask yourself why nearly all Africans, born in the modern Americas, have physiological tribulations equating themselves as Gods, Angels and Prophets? Instead it is considered normal for most of them to serve various European-made gods, symbols and other graven images found outside of themselves. Of all the Kemetian metaphysical titles, words, and SKUDVHV GHVFULELQJ D XQLW\ RI GLYLQLW\ DQG PDWWHU WKH ³$QJHO´ UDQNV KLJK DPRQJ WKRVH PRVW misunderstood and misused. Like the words God, Prophet, Messenger, Sheik and Adept the VWDWLRQ RI DQ Ä$QJHOெ LV XVXDOO\ WUDQVODWHG WKURXJK FDJHG WKRXJKW SDWWHUQV RI WKH ZHVW 7KLV limited comprehension was forced into a new profundity in the Black Age of the West African Moors during their era of U. S. Constitutional Slavery (from 1779 to 1865) coupled with their militarily diagnosed subsequent 145 years of Post Traumatic Mental Slavery. The European miseducation of subjugated Asiatics, joined with the built-in etymological weakness in their bastard language, created a comfort zone of doubt, ignorance and self-hatred. It was not until the advent of Prophet Noble Drew Ali, born Timothy Drew, January 8, 1886 in the state of NC, when the truth was finally revealed about these noble African titles. 47 0DQ¶V)LUVW8VHRI:LQgs The Ancient Lamurians and then Kemetians were the first Gods in human flesh. The heart or center of all God-Men is the consciousness of the Self and The Great God. These first Men used the wings of various fowl deities to depict or symbolize their own transmutations between divinity and matter. They would often draw wings on various manifests to still their rate of thought and power of flight transmission. The ancients, being more God than flesh, would often delve into the constitution of other thinking things, humans, birds and beast. This gave rise to the graphs, statues and monuments as part human and part animal e.g. The Sphinx HWF'XULQJWKHUHLJQRI&RQVWDQWLQHெV,VWDQEXO &RQVWDQWLQRSOH FDPHWKHILUVW(XURSHDQWRXVH wings to portray their deceased men as still having greater government powers to control fear in the hoi poloi. These wings often symbolized men in a heaven beyond the sky after death on earth. In more modern days Europeans used wings on paleskinned infants to illustrate lovers, good deeds and gifts. To this day most superstitious pagans have set aside economic-based holidays of these celebrations ranging from flying Cupids, Tooth Fairies to a Fat Guy with Keyhole Powers and Eight Flying Reindeers. The people of China apply wings to serpents and dragons while many Native Americans attach bird feathers to headdress, spears and horses. All these uses of the wings illustrates a manifest moving too fast for the carnal eye to comprehend or the mind can believe. Rarely are these European beliefs attributed to their gross misconceptions of ancient Kemetic teachings demonstrating all life is thought activity from The Great God in and among us. But then again it is in the nature of the paleskin race, the only people without a center and no alter fires, to not identify the essence of all life is in realms unseen. T he Divine O rigin of A ngels 38 - W hat is an A ngE l? A n A ngE l is a thought of A llah manifested in human flesh. Of all the 99 Divine Attributes of the Great God, He is the force that C reates (El) and to Govern (Bey) that which has been created are the most encompassing of them all. Most of the +RO\FUHDWLRQVRI$OODKHLWKHUEHJLQRUHQGZLWK³(O´ SURQRXQFHGOLNHWKHOHWWHU³/´QRW³HHO´ e.g. MichaEL, NathaniEL, SamuEL, El Salvador, El Cid, GabriEL and our topic-matter AngEL. 7KH³(O´DORQHDWWDFKHVWKHQDPHWRWKH&UHDWRULQVRPHIRUPRUDQRWKHU)RUH[DPSOH³$QJ(O means God¶V 0HVVHQJHU DQG WKH QDPH ³1DWKDQLHOெ PHDQV ³*RG¶V *LIW´ HWF 7KLV LV ZK\ WKH most popular Tribal Names among tKH0RRULVK3HRSOHVDUH³(O´DQG³%H\´ 7KHUH DUH PDQ\ forms of Angels yet they all come from the same celestial source. Rain, Sun, Death, Love, Truth and Justice, Cherubim and Seraphim are among the many angels about us every day but are seldom associated with our divinity. All true Angels come as thoughts from the Great God. Like all thoughts of Allah, Angels are not measured by time but by infinite reason. Like all true Creations Angels also think and have a will. However the common bound uniting all Angels is they are duty-bound and their wills are never strong enough to go against the ordinances of the universal Creator, Allah. 48 Pay attention; All ANGELS (In human flesh) are ME SS ENGERS only. Angels are not Administrators, managers nor officials. They do not make decisions about anything, any place nor any being. Angels do not make determinations from where their holy instructions derive. They are never biased, prejudice or judgmental. The interest of an Angel is only in the direction of the message they are sent to carry. The best way to compare the qualities of an Angel is to study the divine constitution of rain. Rain is a stage of water which carries within it life giving properties (H2O) the essence of healing, growth and nutrition. Yet when the condition commands for the rain to fall, it falls. Rain does not question the command to go down nor does it determine where it is to descend; whether it falls upon the forest, sea or desert. Rain does not make decisions because it is an $QJHODQGLWVPHVVDJHLVWR³IDOO´ The foundations of angels were initiated in Egypt (Kemet). The ancient Kemetians of Africa held steadfast to the universal blueprint of Cycle Ages which illustrates the creation, fall and rise of perfected man as God. But Spirit-Man, as a perfect seed from the heart of Allah, was EXW RQH RI WKH VHYHQ WKRXJKWV RI 7KH *UHDW *RG ZKLFK FDUQDO PDQ FROOHFWLYHO\ FDOOV Ä7KH (ORKLPெ1RZDOOFUHDWXUHVWKLQNDQGHYHU\FUHDWXUHDUHSRVVHVsed of a will and in its measure, has the power to choose. And in their native planes all creatures are supplied with nourishment from the ethers of their especial plane. The power of the will rest well within the consciousness of God and Man as one. This is why, although man was among the five creatures that fell, (with protoplast and earth and plant and beast), he could never die while in the grave of carnal evolution. While in human form the will of man gained strength in carnal desires and he lost sight of himself as God. In science, every Spirit-Man is an angel but he must learn how to master his will to live as God again. This is why an Angel is a thought of Allah manifested in human flesh. Noble D rew A li Is an A ngE l 40 - W hat is our Prophet to us? He is an A ngE l of A llah sent to bring us the everlasting gospel of Allah. Holy Prophets are the most prayed for of all saviors during the history of every nation while it was suffering slavery. Yet rarely are any of the Major or Minor Prophets expected by the wretched, accepted by the nationals they are born into or lifted up before the nations of the earth. The Holy Illustrious Prophet, Noble Drew Ali is the last major Prophet in these days yet even he is not an exception to this doubtful and sinful illusion of mankind. Few of his native brothers and sisters understand Drew Ali is an AngEl of Allah. He was ordained by the Great God Allah, in due time, to redeem his people from their sinful ways of being Negroes, Blacks, Colored People etc. He brought the everlasting gospel (Unchanging Truth) of their Nationality and Divine Creed. The question arise: But where did Noble Drew Ali, named Timothy Drew in the State of North Carolina on January 8, 1886, as a young 16 year old Negro boy arrive unescorted in Kemet to get these Saving Powers? 49 39 ± W hat are A ngE Ls used for? To car ry messages to the four corners of the world, to all nations. 41±W hat is the everlasting gospel? It is a saving power that comes from A llah through our ancient F athers by H is Prophet. Noble Drew Ali received his ordination from the Great God of his ancient forefathers. A prophet was prophesied to be born under the western skies at the change of the era from the cycle age of Pisces into the age of Aquarius. Although born among his people and disguised as a Negro boy, He received his education to be a Prophet while in the Ancient Kemetian Adept Schools, known today as Egypt. True history will reveal his education in Kemet conforms to the synchronicity of every prophet before Drew Ali e.g. Adam, Noah, Abraham, Lot, Moses, Buddha, Confucius, Jesus and Mohammed. Every Prophet sent between Adam and the great Ali each either went to Kemet to receive their Title of Prophet or an Angel of Allah (Kemetian Adept Master) was sent to bring the education of Prophetdom to that especial Being; e.g. It took The AngEl (Gabriel) 23 years to teach the Everlasting Gospel to Mohammed Ibin Abdullah before He was able to transliterate Islamism from Kemetian (Aramic) into His Native Arabic. Upon completion of his African Studies, taught by this Angel of Allah, it was then that Prophet 0RKDPPHG VWDWHG ³, KDYH SHUIHFWHG 7UDQVOLWHUDWHG IRU \RX WKLV GD\ \RXU UHOLJLRQ 6DYLQJ 3RZHU DQGLWLVFDOOHG,VODP´$IWHU\HDUVLQSDVVLQJWKHUHTXLUHGWHVWVRI6HOI0DVWHU\ in .HPHWLDQ 6WXGLHV 7LPRWK\ 'UHZ QRZ ³6KDULI $EGXO $OL´ OHIW (J\SW DQG VRMRXUQHG LQWR WKH Holy City of Mecca in Saudi Arabia where naturally he was recognized as the Western born awaited Kemetian Adept Prophet. Ali received the highest support and allegiances from his kindred, a direct descendant of Hagar, Sultan Abdul Aziz Ibu Suad. 60 ± W ho is guarding the holy city of Mecca today to keep the unbelievers away? A ngE Ls. 61 ± W hat is the modern name for those A ngE Ls? Asiatics 62 ± W hat is the shade of their skin? O live. The 6XOWDQ¶V allegiances with Egypt, Morocco Great Britain and the United States lead to JLYLQJ6KDULI$EGXO$OLWKHWLWOHRI³(O+DMM´IRUFRPSOHWLQJWKHVDPHMRXUQH\DVWKHLU3URSKHW 0RKDPPHG$V³1REOH'UHZ$OL´WKH/DVW3URSKHWZRXOGODWHUWHOOKLV0RRUVDERXWKLV ³+LJK 1DPH´³I was given a high name over there (In Mecca) but you cannot use it over here. Be good Moors and I will hand it down to you.´,QWKHQHZO\UHFRJQL]HG3URSKHW(O Hajj Sharif Abdul Ali, was thereby endorsed by the head of the Islamic World, Sultan Saud, as an Angel of Allah sent to carry the messages of Truth to the United States and all Nations. Prior to this event the teachings of Islam and the Great Quran of Mohammed had been forbidden upon the shores of the USA. 63±A re the Moorish A mericans any relations to those A ngels? Yes, we all have the same F athers and Mothers. 50 W hat Is A Swift A ngel? All Swift Angels (SA¶s) are descendants of the ancient Moabites and are Messengers of The Great God Allah through His Holy Prophet, Noble Drew Ali. These Moorish American Men and Women are dedicated Citizens of Moorish America. Swift AngELs are well educated in the sciences of perpetual life and the mysteries of death. Upon assignment from their government their wills become the chief distributors for any of their Principles (love, truth, peace, freedom or justice). Swift Angels are the return of the Chief Protectors of ³,VODPLVPெWKH :RUOG¶V First Religious Creed. Security is what gives value to all manifests. All Swift AngELs give their nation divine value because the peace of society depends upon justice through their faithfulness. In the semblance of the Angels of rain and $OODK¶V Angels of death, Swift Angels too just deliver the message they are assigned to fulfill. They are the same thoughts of Allah as Ninjas are to the Nation of Japan. Swift Angels are thoughts of Allah manifested in the flesh yet they are more God than flesh because their thoughts are raised to infinite wisdom. These Angels see all things from the power of their holy instructions. They obey the commands and ordinances of Allah, the Prophets and the government in which they live. Yet Angels do not alter the voice or silence of their command. The Actions of a Swift Angel are soundless, timeless and in accord with the harmonies of life. All SA¶s are not necessarily Divine Ministers or Sheiks. It must be remembered; Noble Drew Ali introduced these internationally recognized stations and titles to the sleepy MSTA Membership fresh out of slavery. It would take three to four generations later before they could see the good of this great work. His members were to LQVSLUHWREHFRPLQJ³EHWWHU&LWL]HQV´RIWKHLU RZQ JRYHUQPHQWLQZKLFKWKH\FDQOLYHLQRUGHU for these national Titles to become realized. Divine Ministers are Missionaries, Builders and $GPLQLVWUDWRUV IRU WKHLU 0RRULVK $PHULFDQ 1DWLRQDO *RYHUQPHQW 0$1* $V IRU ³6KHLNV´ worldwide, for over five millenniums all Sheiks are ambassadors, Attaches, diplomats and National Representatives of their especial nation, country or Kingdom. No one can become a official Sheik as a mere member of a religious/civic Non-Governmental Organization. Organizations are a never nation. But one nation can own millions of organizations. When The Holy Prophet introduced these fortunes of a Nation to the Moorish, as Members, it was for their education and practice in what to do when they become greater. In essence, not being recognized as a Nation means the station of Sheik will not be honored by the nations of the earth. As for Swift Angels their wills are dedicated solely to the obedience of their Government. The qualifications of a SA are to be ready to submit their will into the deific Will and be a Chief Protector of the MANG through the Last Prophet, Noble Drew Ali. T he Sacred G enealogy of Swift A ngE Ls (O ur H istory in the W estern H emisphere) Drew Ali became the first Swift Angel because of the brief amount of time (10 years) it took to master the self and become a Kemetian Adept Master with no prior education in any land. Ali was ordained by the Great God of His ancient Forefathers and later prepared by the Sacred Brotherhood of Kemetian Adepts to be five times greater than the five Prophets before him. His new era message marks the end of PDQ¶V finite duration called time and fulfilling to 51 the fruition PDQ¶V Circled Seven. The last message charts the final leg of perfection in every PDQ¶V journey of the race and must be delivered to all men in every nation on earth. He later anointed Divine Minister Rufus German Bey of Baltimore as his Swift Angel. The Prophet SODFHG D UHG IH] XSRQ KLV KHDG DQG WROG *HUPDQ %H\ ³1RZ \RX DUH IUHH 'RQ¶W forget the 3URSKHW¶V 3UD\HUDQGWHOOP\0RRUVWKHWUXWK´\HDUVODWHULQ-XQHRI'U5*HUPDQ Bey anointed Divine Minister NathaniEL Pleasant-Bey as Swift AngEl #1. This sacred genealogy which began in Kemet lasted about another 35 years (2009-2010). In these modern days the Grand Anointing to a Band of Swift Angels enlightened the western skies. Dr. Elihu N Pleasant-Bey, Grand National Chairman, Swift AngEl #1, through this sacred family tree alone has the power to anoint Swift Angels. This empowerment can and will be handed to other Moorish in due time. Meanwhile as a matter of National Security, the totality of these new names and numbers can only be known by the Executive Rulers and Grand Body of the 0$1*6$ெVDUH DOZD\VVHWDWWKHUHDG\IRUWKH\GRQRWVHOHFWWKHWLPHRIGHSOR\PHQWDVD matter of defense of the Gospel. 68 ± W hat people represent the H igher Self? T he A ngE Ls who protect the Holy C ity of Mecca. Swift AngELs are the Chief Protectors of Moorish America, their divine citizenry and Theocratic Government. Love Divine, D r. E lihu N Pleasant-Bey, Swift A ngE l #1 52 -+6-+-&7!1(//#+!/-C8!(/,+86$'(37/(6621 1'(',7,21 ! CHAPTER XXVI HOLY INSTRUCTIONS OF UNITY = [You-&-I-Tie] ( U N I TY is: A ll are in harmony of the one, agreement, unison, unanimity and oneness. T hese holy instructions of U N I T Y are the perpetual teachings and sole premeditated bonds between M an and H is C reator. Right U N I T Y is when the W ill of M an and the W ill of the G reat God are one. U N I T Y is witnessing the living oneness of the universal harmonies of life. U N I T Y is eternal oneness of what the L ife of M an is truly spent to build.) 1. The gifts (Plural meaning many / Rewards, Endowments, Presents, Contributions: Aids without debt, obligation or expected return) of the understanding (Knowledge, Comprehension, Insight, Perception, Conception) are the treasures (Resources, riches, assets, stored wealth) of Allah (Love, Universal Harmonies, Spirit, Husband Man, The Great God) and He appointed [F rom the H eart of A llah let man learn wisdom] (Covenant, agreed, fixed, prearranged, allotted) to everyone (Spirit with soul, souls made manifest, Thinking Things with Wills) his portion (share, quantity, lot, quota), in what measure (amount, degree) seemeth (give the impression, appear, look as if) good (moral, worthy, satisfactory) unto H imself (Human knowledge, carnal self). 2. Hath He endowed (gifted, provided) thee (your soul) with wisdom (understanding, insight, prudence, judgment, perception)? Hath H e (The Great God, Higher Self, Consciousness) enlightened thy mind (actions of the soul, thoughts) with the knowledge (information, facts, data, education, experience) of truth (that which is immutable, unchallengeable, absolute, and indisputable)? Communicate Converse, exchange words, correspond, interconnect) it to the ignorant, (the uninformed, unaware) for their instruction; communicate it to the wise, for thine own improvement (self cultivation, practice). 3. True wisdom is less presuming than folly (foolishness, ignorance, silliness). The wise man doubteth often, and changeth his mind; the fool is obstinate (stubborn, determined, adamant), and doubteth not; he knoweth all things, but his own ignorance. 4. The pride of emptiness is an abomination (disgrace, hateful, atrocity); and to talk much, is the foolishness of folly; nevertheless, it is the part of wisdom to hear with patience their impertinence, and to pity their absurdity (meaninglessness, illogicality, ridiculousness). 5. Yet be not puffed up in thine own conceit, neither boast of superior understanding; the clearest human knowledge (carnal nature, Beliefs, perhaps, maybe) is but blindness and folly. 53 6. The wise man feeleth his imperfections, (Human nature, body of desires, weakness, insufficiencies) and is humbled; he laboreth in vain for his own approbation (approval, admiration, esteem) but the fool peepeth in the shadow stream of his own mind, and is pleased with the pebbles (ego, self-image, human frailties, mundane nature, carnal character, ordinary and what the thoughtless thinks), which he seeth at the bottom; he bringeth them up and showeth them as pearls and with the applause of his brethren delighteth himself (Self-Inflated ego). 7. He boasteth of attainments (achievements, realizations, accomplishments; There are no attainments in being NBC or Nationless) in things that are of no worth; but where it is a shame to be ignorant, there he hath no understanding. 8. Even in the path of wisdom (all other nations of the Human Family), he toileth after folly (remaining in Organizations, NGOs, Chattels of Citizens); and shame and disappointment are the reward of his labor. 9. But the wise man cultivates his mind with knowledge; the improvement of the arts is his delight, and their utility to the public crowneth with honor. 10.Nevertheless, the attainment of virtue he accounteth as the highest learning; and the science of happiness 7KHVRXO¶VUHVHDUFKDQGH[DPLQDWLRQRIFRQWHQWPHQWVDWLVIDFWLRQ and peace) is the study of his life. )URPWKH3URIHVVRU(OLKX¶V$GHSW/HVVRQ W hen man speaks of uniting with his brothers he must first speak from the gifts of the understanding where the resur rection of H e and A llah resides as a fact. O nly when M an knows this sacred covenant in U N I T Y can he be the A ngE l of oneness which he has been created to bring. U N I T Y must come from the heart of man to the heart of Allah. O nly then will it be attainable. T he Holy bond of Unity is the final victory over the self. T hy Soil Is thine O wn, L et It Not W ant C ultivation. 54 -+6-+-&7!1(//#+!/(.(+(/,+86$'(37/(6621! C H APT E R X X X H O L Y I NST R U C T I O N F R O M T H E PR O P H E T T he (M aster, O neness, Foremost, a definite) Social (communal, public, group, collective, common, societal, community) Duties (responsibilities, task, sense of obligation, job, due, what one must do) 1. When thou considereth (Think, Contemplate, deem, reflect on) thy wants (requests, wishes, desires), when thou beholdeth (observe, watch consider, view, regard) thy imperfections (lacking, inadequate, insuffiencies, limitations, flaws, faults, unsatisfactory, weaknesses), acknowledge his goodness UHFRJQL]H $OODK¶V LQWHJULW\ FRQFHGH$OODK¶VNLQGQHVVDGPLW$OODK¶VULJKWHRXVQHVVVDOXWH$OODK¶VGHFHQF\ O (Now wisdom Speaking from the heart of Allah) son of humanity (product of humankind, people, civilization, charity), who honored thee with humanity, endowed thee with speech (language, words, communication, talking, native tongue, discourse, vocalizations), and placed thee in society (citizens, culture, social order, humanity, people, the public) to receive and confer (bestow, grant, give, award) reciprocal helps (equal assistance, the same aid, joint facilitation, shared support) and mutual obligations (joint commitments, communal responsibilities, reciprocated duties), x protection from injuries (Parental security from harm, community Mufti from wrongs), x thy enjoyments of the comforts (protected rest, secured relief, safe wellbeing, ease0 x and the pleasures of life; happy development, joys of progress, contentment of growing) A ll these thou oweth to the assistance of others and couldst not enjoy but in the bands of society. 2. It is thy duty, therefore, to be a friend (companion, ally, supporter, helper to humanity) to mankind, as it is thy interest (concern, important, consequential, advantage, benefit, gain, profit, rewarding) that man should be friendly to thee. 3. As the rose breatheth sweetness from its own nature, so the heart of a benevolent man produceth good wor ks. (AOOPHQDQGZRPHQZKR¶V:LOOKDVMRLQHGZLWKWKHGHLILF Will, are conscious of their perfected state as Gods and by divine Holy Nature are Creators of goodness, peace and happiness). 4. H e (Perfected Man) enjoyeth the ease and tranquility of his own breast, and rejoiceth in the happiness and prosperity of his neighbor (Those who, like himself as God manifested LQKXPDQIRUPDUHDOVRVWULYLQJWRZRUNRXWWKHLUOLIH¶VVXP 55 5. H e openeth not his ear unto slander (Carnal man too often make the mistake of reacting to the noises listened to by the human ear rather that counteracting, deciphering or measuring with discretion what the Inner {Spiritual} Ear has heard. Now the God-Man has two ears. (1) The human, earthly or Outer Ear which, like antennas, can only listen to whatever frequency has been blown into them by the winds; yet has no power of discretions. And (2) The Inner Ear or Spiritual Ear always functions with prudence, responsibility and freedom. The equilibrium of the Inner Ear is balanced by its performing, processing, judging, measuring and understanding. In science when these IXQFWLRQVDUHH[HUFLVHGDWPD[LPXPHIILFLHQF\DUHFDOOHG³+HDULQJ´:KHQWKHFRQVFLRXV hears they first perceives, heeds, examines and gathers the sounds into comprehensive mode of growth, unfoldment and understanding before allowing The Inner Ear to open. The Inner Ear feeds from the breast of Love Divine into the heart of man. When we truly hear our ear is open to righteousness. This is why the Holy prophet instructs the Moors to ³2SHQHWK127WKHLU,QQHU(DUXQWRVODQGHURURWKHUWKLQJVWKDWKDUPVEHFDXVHLWLVLQ conflict to man divine unfoldment), the faults and the failings of men give a pain to his heart. 6. His desire is to do good, and he researcheth out the occasions thereof; in removing the oppression of another, he relieveth himself. 7. From the largeness of his mind, he comprehendeth in his wishes the happiness of all men; and from the generosity of his heart, he endeavoreth to promote it. Noble D rew A li on C amel /E ast to W est; B ringing Us E verything F irst C reated 01-06-2011 in Honor of N D A 125th Birthday ! By Dr. Elihu N Pleasant-Bey, GNC, Swift Angel #1 56 ,1),1,7</(6621(,*+7(/,+86$'(37/(6621! CHAPTER XXVIII H O L Y (From the Infinite) I NST R U C T I O NS F R O M T H E PR O P H E T (Angel of Allah) M AST E R 7KHVFLHQFHRI³0$67(5´FRPHVLQWKUHHGHJUHHVRI$XWKRULW\ 1) T he Spirit, The Great God Allah 2) Plane of Soul: Prophets, Angels and Adepts 3) Plane of carnal manifest: Highly skilled, Owner, Original Model, Guide, Head, Leader or Administrator AND SE R V A N T (Faithful, Moslem, Citizen, Public or Civil attendant, Government Server, obedient, a devotee, The spirit of a Servant is made equal as that of a Master in the service of Allah) T here is a harmony in every purpose and this purpose is fully realized when the force IURPD0$67(5¶V:LOOLVXQLWHGE\WKHSRZHUVIURPWKH:LOORID6(59$17 1. Repine (complain, fretful, dissatisfied, find fault, criticize, nitpick) not, O (Spirit, Godman) man (thought of Allah, planted in a soil of soul, now in a body of desires), at the state of servitude (being ruled, dominated or restricted); it is the appointment of A llah (choice, planned, prior arrangement, employment, promotion), and hath many advantages (Being worthy, hired, trusted, crafty; it removeth thee from cares and solicitudes in life (Concerns, Responsibilities, attentiveness, protectorate). 2. The honor (integrity, credit, admiration, reputation, nobility, pride, distinction) of a servant is his fidelity (loyalty, faithfulness, reliability, trustworthiness, dependability, commitment, conformity); his highest virtues (Honesty, assets, value, worth, benefit, uprightness) are submission and obedience (compliance and agreement, assent and respect, surrender and duty). 3. Be patient (tolerant, enduring, serene, uncomplaining), therefore, under the reproofs (reprimands, admonitions, criticisms, accusations) of thy master; and when he rebuketh (censure, give a talking to, a scolding) thee, answer not again. The silence of thy resignation (acceptance, acknowledgement and acquiescence without defiance) shall not be forgotten. 4. Be studious of his interests (serious of his pursuits, reflective of his importance, intellectual involving his affairs, diligent about his business and meticulous about his concerns; be diligent in his affairs (industrious in his relationships, conscientious in his dealings, attentive in his associations, thorough in his interactions and painstaking in his 57 employments), and faithful to the trust (true to the faith, accurate to the reliance, authentic to the dependence and exact to the expectations), which he reposeth (assigned with trust, reclined in tranquility, rest assured) in thee. 5. T hy time and thy labor belong unto him (Remember you have been appointed, by Allah, to be a servant at this time and in this life span; your time and work must be DSSOLFDEOHLQWKH0DVWHU¶VKRQRU Defraud him not thereof (Do not deceive, cheat, con, trick or take advantage of, swindle), for he payeth thee for them. 6. And thou who art a master, be just to thy servant if thou expecteth from him fidelity; and reasonable in thy commands if thou expecteth ready obedience. 7. T he spirit of a man is in him; severity and rigour may create fear, but can never command love. 8. M ix kindness with reproof, and reason with authority (Purpose with power, Cause with ability, Explanation with mandate); so shall thy admonitions take place in his heart, and his duty (responsibility, obligation, function) shall become his pleasure. 9. He shall serve thee faithfully from the motive of gratitude (methods of thanks, ways of appreciation); he shall obey thee cheerfully from the principle of love (The Great God within); and fail thou not, in return, to give his diligence and fidelity their proper reward. Dear Students: This chapter, as are the especial chapters XX through XLVIII, is The Holy 3URSKHW¶V'LUHFW,QVWUXFWLRQVWRKLVSHRSOHIRUWKHFKDUDFWHUEXLOGLQJWRWKH*Rvernment upon which their clean and pure nation can live. The Moorish Peoples must raise their thoughts from human knowledge to infinite wisdom. During the time of slavery and from the pains of forced domestication the Moorish have learned to repine against authority. The traumatized and finite mind of a slave cannot comprehend the infinite warnings, holy instructions and Divine Constitution from The Great God Allah through His Prophet. A slave is one who is forced to obey the dictates of the slave master. Slaves do not have the freedom of choice. The subjugated, through all the laboring of his life, will never attain to the position to become a slave master. But through the divinity of our government a Servant can become the Master, Children can become parents and a wife can take care of the duties of a KXVEDQG¶VKRXVHKROG The mind of a slave and the mind of a servant are as unlike as prison and freedom. Dear Students go beneath the surface of HOLY INSTRUCTIONS FROM THE PROPHET: MASTER AND SERVANT and you will see why we have a T heocratic form of Government. Notice the divine and natural harmony in constitutions of: Master and Servant, Husband and Wife, Parent and Children, Government and Citizens. The love of a Servant is truly shown through the freedom they enjoy within the peaceful service to their just government. 58 The Moorish Americans are ordained to be a Master (sovereign) Nation; It is an appointment of Allah. Now they must submit and recognize themselves as servants (Moslems) of The Great God before they can take their place in the affairs of men and lead the nations of the earth to peace! T hru: D r. E lihu N Pleasant-Bey, Instructor 59 -+6-+-&7!1(//#+!+-+(8!(/,+86$'(37/(6621! CHAPTER XXIX M agistrate (A Judge in a Lower Misdemeanor Court; Child Support, Pretrial Hearings, Minor law Officer, Judiciary with limited powers: Governors, Mayors, Councilmen, Justice of the Peace, County or State Representatives, Congressmen, Senators) A nd Subject (A vassal placed under authority or law, Citizens, Hoi Poloi, Under the Jurisdiction or control of a ruler or law, a legal resident governed by law, obligated to obey ordinances) 1. O thou, the favorite of H eaven (An infinite state of mind, Thoughts from the Higher Self MHK, 12:8-9), whom the sons of men (free National Beings), thy equals (those who $OODKPDGHWRZRUNRXWWKHLUOLIH¶VVXP KDYHDJUHHGWRUDLVHWRsovereign power (Free and Self sustaining) and set (accepted, elected, acknowledged, fixed, appointed, arranged, agreed to) as a ruler (Divine Ministers, Sheiks, Chairman, Mufti et al) over themselves; consider the ends and importance of their trust (faith, confidence, depend on, rely, responsibility, care), far more than the dignity and height of thy station (position, status, post, place, rank). 2. Thou art clothed in purple (royalty, majestic, crowned, nobility), and seated on a throne (Chair, office of power; the crown of majesty investeth thy temples (Where things are made of thought, shrine, sanctuary), the scepter of power is placed in thy hand (actions of the soul, the mind); but not for thyself were these ensigns given; not meant for thine own, but the good of thy kingdom (Moorish America, Government, family, community). 3. The glory of a king is the welfare of his people (the happiness, wellbeing, interest, good, and security of his nation); his power and dominion rest on the hearts of his subjects. 4. The mind of a great prince is exalted with the grandeur (greatness, dignity, stateliness) of his situation; he evolveth (develop, grow, produce, advance) high things, and searcheth for business (trade, commerce, industry, partnership, agreements, interest) worthy of his power. 5. He calleth together the wise men (Prophets, Ministers and Magistrates) of his kingdom; he consulteth among them with freedom (autonomy, liberty, sovereignty, without 60 restrictions, self sustaining, openness), and heareth the opinions (views, judgments, beliefs, attitudes) of them all. 6. He looketh among his people with discernment (sensitivity, judgments, awareness); he discovereth the abilities (skills, capability, talents, gifts, powers, faculty) of men, and employeth them according to their merits (qualities, virtues, accomplishments). 7. His magistrates are just, his ministers are wise, and the favorite of his bosom deceiveth him not. 8. He smileth on the arts, and they flourish; the sciences improve beneath the culture (refinements, national tradition, inherit background, cultivation) of his hand. 9. With the learned and ingenious he delighteth himself; he kindleth in their breasts emulation; and the glory of his kingdom is exalted by their labors (the worth of the Moorish American Government is realized by the love and initiatives from the Citizens). 10. T he spirit of the merchant who extendeth his commerce, the skill of the farmer who enricheth his lands, the ingenuity of the artists, the improvements of the scholar; all these he honoreth with his favor, or rewardeth with his bounty. 11. H e planteth new colonies, he buildeth strong ships, he openeth rivers for convenience, he formeth harbors for safety, his people abound in riches, and the strength of his kingdom increaseth. (T hese, [10-11] are just a few bricks necessary in building a clean and pure nation) 12.He frameth his statutes with equity and wisdom; his subjects enjoy the fruits of their labor in security; and their happiness consists of the observance of the law. 13.He foundeth his judgments on the principle of mercy, but in the punishment of offenders, he is strict and impartial (This is the course of justice and maintains the peace in a society). 14.His ears are open to the complaints of his subjects; he restraineth the hands of their oppressors (the protections held within the sovereignty of a free National Constitution and its government), and he delivereth them from their tyranny. 15.His people, therefore, look up to him as a father, with reverence and love; they consider him as the guardian of all they enjoy. 16.Their affection unto him begetteth in his breast a love of the public; the security of their happiness is the object of his care. 61 17. No murmurs against him (hatred, slander, spiteful remarks, deformation of character, planting negative seeds in weak minds, creating doubtful thoughts, Satan going to and fro) arise in their hearts; the machinations (plans, set-up, devising of secret, cunning of schemes to do harm) of his enemies endanger not the state. 18. H is subjects are faithful, and firm in his cause; they stand in his defense, as a wall of brass; the army of a tyrant flieth before them, as chaff before the wind. 19. Security and peace bless the dwelling of his people; and glory and strength encircle his throne forever. 62 -+6-+-&7!1(//#+!&(+8!>D>!$#)0+!;,(/&-#+0)7!! Moorish American Prayer ALLAH the father of the Universe, the Father of Love, Truth, Peace, Freedom and Justice. ALLAH is my Protector, my Guide, and my Salvation by night and by day, through His Holy Prophet, Drew Ali. (Amen). Koran Questions for Moorish Children 1. Who made you? ALLAH 2. Who is ALLAH? ALLAH is the Father of the Universe. 3. Can we see Him? No. 4. Where is the nearest place we can meet Him? In the heart. 5. Who is Noble Drew Ali? He is ALLAH's Prophet. 6. What is a Prophet? A Prophet is a Thought of ALLAH manifested in the flesh. 7. What is the duty of a Prophet? To save nations from the wrath of ALLAH. 8. Who is the founder of the Moorish Science Temple of America? Noble Drew Ali. 9. What year was the Moorish Science Temple of America founded? 1913 A.D. 10.Where? Newark, New Jersey. 11.Where was Noble Drew Ali born? In the State of North Carolina, 1886. 12.What is his nationality? Moorish-American. 13.What is your nationality? Moorish-American. 14.Why are we Moorish-Americans? We are Moorish-Americans because we are descendants of Moroccans and born in America. 15.For what purpose was the Moorish Science Temple of America Founded? For the uplifting of fallen humanity. 16.How did the Prophet begin to uplift the Moorish American? By teaching them to be themselves. 63 17.What is our religion? Islamism 18.Is that a new, or is that the old time religion? Old time religion. 19.What kind of a flag is the Moorish? It is a red flag with a five pointed green star in the center. 20.What do the five points represent? Love, Truth, Peace, Freedom and Justice. 21.How old is our flag? It is over 50,000 years old. 22.Which is our Holy Day? Friday. 23.Why? Because Friday is the day on which man was formed in flesh, and it was on a Friday when He departed out of flesh. 24.Who was Jesus? He was a Prophet of Allah. 25.Where was he born? In Bethlehem, of Judah, in the House of David. 26.Who were His Father and Mother? Joseph and Mary. 27.Will you give in brief the line (genealogy) through which Jesus came? Some of the Great Fathers through which Jesus came are: Abraham, Boaz by Ruth, Jesse, King David, Solomon, Hezekiah and Joseph by Mary. 28.Why did ALLAH send Jesus to this earth? To save the Israelites from the iron-hand oppression of the pale-skin nations of Europe, who were governing a portion of Palestine at that time 29.How long has that been? About two thousand years ago. 30.What was the nationality of Ruth? Ruth was a Moabitess. 31.What is the modern name for Moabites? Moroccans. 32.Where is the Moroccan Empire? Northwest Amexem. 33.What is the modern name for Amexem? Africa. 34.What is the title given to our ruler in Morocco? Sultan. 35.Where do we get the name Jesus? From the East. 64 36.What does the name Jesus mean? Jesus means Justice. 37.Did the Angel give to the Child that was called Jesus a Holy name? Yes, but it cannot be used by those who are slaves to sin. 38.What is an Angel? An angel is a thought of ALLAH manifested in human flesh. 39.What are Angels used for? To carry messages to the four corners of the world, to all nations. 40.What is our Prophet to us? He is an angel of ALLAH who was sent to bring us the Everlasting Gospel of ALLAH. 41.What is the Everlasting Gospel? It is a Saving Power that comes from ALLAH through our Ancient Fathers, by His Prophet. 42.What is the Covenant of the Great GOD-ALLAH? Honor thy Father and thy Mother, that thy days may be long upon the Earth land which the Lord thy GOD-ALLAH hath given thee. 43.At what age did Jesus begin to preach? At age twelve. 44.Where did he teach? India, Africa and Europe. 45.How long did he teach? Eighteen years. 46.What did Jesus say that would make you free? TRUTH. 47.What is TRUTH? TRUTH is Aught. 48.What is Aught? Aught is ALLAH. 49.Can TRUTH change? TRUTH cannot change, or pass away. 50.What other name do we give to TRUTH? HOLY BREATH. 51.What have you to say about HOLY BREATH? All we can say is it is Great. It is good. It was, it is, and evermore to be. AMEN. 52.At what place on earth was the physical part of MAN formed? In the Garden of Eden. 53.Where is the Garden of Eden? In the land of Canaan, in the City of Mecca. 54.What is the modern name for the Garden of Eden? MECCA. 65 55.What is the name of the first physical man? His name cannot be used, only by Executive Rulers of the A.C. of the M.S.T. of A. 56.What are the words of A.C. of the M.S.T. of A.? Adept Chamber of the Moorish Science Temple of America (3rd Heaven). 57.Who were Adam and Eve? They are the mothers and fathers of the human family. Asiatics and Moslems. 58.Where did they go? They went into Asia. 59.What is the modern name given to the children? Asiatics. 60.Who is guarding the Holy City of MECCA today to keep unbelievers away? Angels. 61.What is the modern name for these Angels? Asiatics. 62.What is the shade of their skin? Olive. 63.Are the Moorish Americans any relation to those Angels? Yes, we all have the same father and mother. 64.Give five names that are given to the descendants of Adam and Eve: Lucifer, Satan, Devil, Dragon and Beast. 65.What is the Devil sometimes called? The Lower-self. 66.How many selves are there? Two. 67.Name them: Higher-self and Lower-self. 68.What people represent the Higher-self? The Angels who protect the Holy City of MECCA. 69.What people represent the Lower-self? Those who were cast out of the Holy City, and those who accept their teachings. 70.What is the Higher-self? The Higher-self is the Mother of virtues and the harmonies of life, and breeds Justice, Mercy, Love and Right. 71.Can the Higher-self pass away? No. 72.Why? Because it is ALLAH in MAN. 66 73.What does the Lower-self breed? Hatred, Slander, Lewdness, Murders, Theft, and everything that harms. 74.What did the Higher-self say to the Lower-self at one time when He met Satan? "Where are you going Satan?" 75.What was the answer that the Lower-self gave to the Higher-self? "I am going to and fro the earth seeking whom I may devour." 76.Has he finished his task of devouring? Yes. 77.When was His time declared out? When He nailed Jesus to the cross. 78.What were the last words Jesus uttered? It is finished. 79.What did He have reference to? He had reference to the end of Satan. 80.Did Jesus say that He would return to conquer Him? Yes. 81.What is the first name of the person into whom Jesus was first reincarnated? Prophet MOHAMMED, the Conqueror. 82.Was Satan to be bound then? Satan was bound in part. 83.When was the head of Satan taken off? 1453 (Byzantine). 84.By whom? By Mohammed. 85.Name some of the marks that were put upon the MOORS of Northwest, by the European nations in 1774? Negro, Black, Colored and Ethiopian. 86.Negro, a name given to a river in West Africa by MOORS, because it contained black water. 87.What is meant by the word Black? Black according to science means death. 88.What does the word colored mean? Colored means anything that has been painted, stained, varnished or dyed. 89.What does Ethiopian mean? Ethiopia means something divided. 90.Can a man be a Negro, Black, Colored or Ethiopian? No. 91.Why? Because man is made in the Image and after the likeness of God, ALLAH. 67 92.What title does Satan give Himself? God. 93.Will you define the word White? White means Purity, Purity means God, and God means the Ruler of the Land. 94.To whom do we refer at times, as being the GREAT GOD? ALLAH. 95.Is the Devil made in the Image and Likeness of ALLAH? No, he is the shadow of our lower-selves and will pass away. 96.Who made the Devil? Elohim. 97.Who is Elohim? Elohim is the Seven Creative Spirits that created everything that ever was, is, and evermore to be. 98.What is Elohim sometimes called? The SEVEN EYES of ALLAH. 99.How many days are in the Circle? Seven days. 100. How many days are in a creation? Seven days. 101. According to Science, how many days are in a year? Seven days. 68 -+6-+-&7!1(//#+!(1(.(+8!0!1##$!0&!3##)-/'!3,/1-3/!&'(-)! 0)5'-&(5&,)(!0+9!-+61,(+5(/!-+!-+9-0+!5#,+&)7! The feigned moral indignity expressed by the ilk of highly paid, well placed public 3URYRFDWHXUV «QHHGFRPPHQWDWRUVRYHUWKHLQVWDOODWLRQRIDPRVTXHDWWKH*URXQG=HUR VLWH WHQGV WR FRQIRXQG UHVHDUFKHUV OLNH PH 0RVTXHV¶ DW OHDVW WR P\ PLQG DUH D JUDQG testament to the ultimate in Moorish/Muslim Architecture. Beyond that, it is an apt reminder of the great body of Muslim-Moorish influences once pre-existing in the Hemispheric Aboriginal Indian Country of the places we now know to be the Americas. I must admit to wondering what had gotten the Catholic Majesties in such a twisted bunch that it created an absolute blind rage and hatred of the Saracens that they would dare to chase them into the realm of unknown lands (and apparently past the sheer edge of the square world-a belief in vogue in their era) in order to vanquish them forever? :KDW¶VPRUHWKH&DWKROLF0DMHVWLHVZLWKWKHEOHVVLQJRIKLV3DSDO+LJKQHVVDQGWKH+RO\6HH VHDOHG WKH IDWH RI WKH 6DUDFHQV DQG WKHLU GHVFHQGDQWV WR D FRQGLWLRQ RI ³DXWKRUL]HG 3HUSHWXDO 6ODYHU\´ IRUHYHU ZLWK D YRZ WR YDQTXLVK WKHLU ³.LQJGRPV 'uchies, counties, principalities HWFHWF ZKHUHYHUWKH\H[LVW´DQGSURPSWO\VHWWKHLUVLJKWVRQWKHWDNHRYHURIWKH$PHULFDV So it is the Pope and the Catholic Majesties themselves that gives us our first clue of the location of the extended KingdomVRIWKH6DUDFHQVDVWKH\GHVFHQGHGXSRQWKH$PHULFD¶VZLWK their Armada bearing Men of the Cloth, Sacristy Conversion Kits and Expedition of Heavilyarmed Conquistadors at the ready to kill all Saracens resistant to forceful conversion to Christianity. 7KH'XP'LYHUVDVJUDQWHG+HUQDQGR'H6RWRDQGRWKHUV³$SRVWROLF$XWKRULW\´>RQEHKDOIRI WKH .LQJV RI 6SDLQ DQG 3RUWXJDO@ ³:H JUDQW \RX E\ WKHVH SUHVHQW GRFXPHQWV ZLWK RXU Apostolic Authority, full and free permission to invade, search out, capture and subjugate the Saracens and pagans and any other unbelievers and enemies of Christ wherever they may be, as ZHOO DV WKHLU NLQJGRPV GXFKLHV FRXQWLHV SULQFLSDOLWLHV DQG RWKHU SURSHUW\ ^«` $QG WR UHGXFHWKHLUSHUVRQVLQWRSHUSHWXDOVODYHU\´). Note: AposWROLFPHDQVUHODWLQJWRWKH3RSH«WKHUHIRUHVWDWLQJ3DSDO$XWKRULW\ Anyway, Hernando de Soto (and others) did come here into the interior Indian Country of the extended kingdom of Saracens and left numerous descriptions of his travails and very surprising narratives describing Indian settlements with Moorish Architecture, use of Moorish Mats, Moorish Darts, and Moorish Cloaks. He also wrote extensively about Indian Chiefs wearing ³$OPDL]DUV´ OLNH ³0RRUV ´ $ ODWHU 7UDLO RI 7HDUV GHVFULSWLRQ RI %ODFN ,QGLans recalled the ³1HJUR ,QGLDQV´ RQ KRUVHEDFN ZHDULQJ ³$OPDL]DUV´ 0RRULVK :UDSV JLYLQJ WKHP DQ ³$UDE 'HSRUWPHQW´ 69 ,Q³&DUROLQD´ZHIRXQGHYLGHQFHRIQXPHURXV,QGLDQ6HWWOHPHQWVUHSXUSRVHGLQWR3ODQWDWLRQV WKHQDPHRIRQHZDV³6DUD]LQV´ ³6DUD]HQV³ 7he aboriginal name of the Indian Settlement was 6DUDFHQV DWWKHSRLQWRIFRQWDFWZLWKWKH/RUG¶V3URSULHWRUV (YHQLIWKHSODFHZDVQDPHGE\ Whites as claimed by Euro-His-Story, it is telling in either case that the Black Indian inhabitants (prior to ColRQLDO6HWWOHPHQW ZHUHGHFUHHG³6DUDFHQV´)XUWKHUUHPRYLQJGRXEW(WKQRORJLVWV UHIHUUHGWRWKH$ERULJLQHVDV³,VKPDHOLWHV´ 6HDIDULQJ0RRULVK³0DULQHUV´RI$ERULJLQDO,QGLDQ&RXQWU\ Seafaring ancient Moroccans, Tunisians, Algerians, Turks and Canary Islanders were Marine travelers to the Americas. Their ventures actually started hundreds of years earlier by Moorish, Carthaginian and Phoenician Ancestors. U.S. Ethnologist and First Director of the Smithsonian Institution, J.W. Powell documented in KLVHDUO\V5HSRUWDQXQXVXDOILQGLQ4XHHQ:HHWDPRRU¶V5KRGH,VODQG3URYLQFHD%XULDO 0RXQG FRQWDLQLQJ ZKDW KH GHVFULEHG DV DQ DQFLHQW ³1DWLYH LQ &DUWKDJLQLDQ $UPRU´ $ YHU\ detailed description of both the Native and the Armor was filed in the report, which included ³OHDWKHUVWUDSV´FRQVLVWHQWZLWK³PDURQTXLQHULH´ RUOHDWKHUZDUH Due to the complex early Maritime claims upon the waterways, the 18th Century found Americans already functioning under working International Treaties with Morocco, Algiers, Tunisia, and Tripoli. George Washington and President Thomas Jefferson maintained the Barbary States Treaties (Maritime Treaties) with the same Moorish countries. The status of the Treaties was reported in each Presidential State of the Union Address until 1830, which coincidently overlaps with the removal of the Indians from their Native Settlements to areas west of the Mississippi (along with their Black Tribal Citizens and Free Persons of Color-whom DV ZH DUH UHPLQGHG ZHUH QHLWKHU FRQVLGHUHG 6ODYHV QRU VXEMHFW WR 86 RU 6WDWH RU ³1HJUR /DZV´ DVFRQILUPHGE\WKH6RXWK&DUROLQD/HJLVODWXUHLQ +RZHYHUWKHIRUFHG,QGLDQ removals (along with their Ethnic Black Tribal Citizens and Free Persons of Color) resulted in cutoff communications between Maritime Nations and citizens situated in Sovereign Colonies and Black Indian Settlements. H istoric Moorish/M uslim Influences in the A boriginal Indian Country 7KHQDPH³0RRUV´KDVDOZD\V referred to several historic and modern populations of Berbers, Black Africans and Africans of Arab descent from Northern Africa, Muslim Iberians and West Africans from Mali and Niger, who had been absorbed into the Almoravid dynasty, some of whom came to conquer and occupy the Iberian Peninsula for nearly 800 years. At that time they were Muslims (or followers of Islam), although earlier people had followed other religions. They called the territory Al Andalus, comprising most of what is now Spain and Portugal. 70 A lmoravid Dynasty The Almoravids were a Berber Muslim Dynasty that ruled Morocco and Muslim Spain in the 11th and 12th centuries. They may have originated in what is now Mauritania. Their founder was Abd Allah ibn Yasin, who by military force converted a number of Saharan tribes to his own reformed religion and then advance on Morocco. After his death c. 1059, Yusuf ibn Tashfin and his brother Abu Bakr came to power. Marrakech was founded (c. 1062) and was the center of a power empire. Called by the Moors in Spain to help stem Christian reconquest, Yusef entered Andalusia and defeated (c.1086) Alfonso VI of Castile. He later subdued the local Muslim rulers and governed Muslim Spain and N. Morocco (Abu Baker ruled over S Morocco). The dynasty also pushed south, destroying the ancient state of Ghana. In the 12th century they were attacked by the Almohads, who finally (by 1174) won both Morocco and Muslim Spain. 7KH0RRUV¶UXOHVWUHWFKHGDWWLPHVDVIDUDVPRGHUQ-day Mauretania, West African countries, and the Senegal River. Parts of Mauretania covered northern portions of modern Morocco and much of north western and central Algeria during the classical period. The people of the region were noted in classical literature as the Mauri. The term Mauri, or variations, was later used by European traders and explorers of the 16th to 18th centuries to designate ethnic Berber and Arab groups speaking the Hassaniya Arabic dialect. In modern Iberia, the term is applied to people of Moroccan ethnicity. The root of the word appears as; mouro, moro, moir, mor and maur. The root has taken on a YDULHW\ RI PHDQLQJV LQFOXGLQJ ³0RUHQR´ IURP /DWLQ ,W FDQ DOVR PHDQ ³%ODFN 3HUVRQ´ RU ³0XODWWR´ 0RRU FDPH WR KDYH D EURDGHU PHDQLQJ DSSOLHG WR ERWK 0RURV DQG 0RULVcos of *UDQDGD(DUO\HWKQRORJLVWVFDOOHG,VODPLF%ODFNVLQWKH$PHULFDV³0RKDPPHGDQV´*XDQFKHV from the Canary Islands were descended from Berbers and Anthropologists confirm finding ancient markings from inhabitants in the Canary Islands bearing the letters (Z)(A)(N)(A)(T)(A), DGLUHFWUHIHUHQFHWR%HUEHUVRI0RRULVK2ULJLQ:KDW¶VPRUH&RORQLHVRIWKHVH&DQDULDQVZHUH also found among the tribes of pre-FRORQLDO DQG &RORQLDO HUD ³&DUROLQD´LQ ZKDWLVQRZWKH Americas. Saracens Saracens, refers to Muslim/Moors. In fact the name figures prominently in the ancient Biblical story of Isaac and Ishmael, the sons of Abraham. The children of Abraham and his Jewish wife Sarah are descended from Isaac. Further, the children of Abraham and Hagar, the Egyptian 6ODYHDUHGHVFHQGHGIURP,VKPDHODQGDUHHPSW\RIRU³ZLWKRXW´DJHQHWLF'1$FRQWULEXWLRQ from Sarah (Genesis 16, 21:1±21) 7KHUHIRUHWKH0XVOLPGHVFHQGDQWVRI,VKPDHODUHWKRVHHPSW\RI6DUDRU³ZLWKRXW6DUD´ ERUQ ³RXWVLGHRI6DUD´ DQGZHUH UHIHUUHG WRDV ³6DUDFHQV³6RPHWH[WUHIHUWRWKHPDV+DJDUHQHV Despite Egyptian ancestry this population are considered to be Arabs. 71 ,W VHHPV WKDW VLQFH WKH\ ZHUH ERUQ RI D ³6ODYH´ WKHLU HQHPLHV GHFLGHG WKDW GHVFHQGDQWV RI ,VKPDHO VKRXOG EH ³SHUSHWXDO 6ODYHV´ WKroughout every generation and wherever they lived (even after removing to faraway lands), although they were Blessed by God to be a mighty Nation, children of the desert, proficient with a bow. Remembering A n A boriginal Moorish-Indian Q ueen The next story centers upon the ancient settlement of a Black Indian Queen killed by beheading in 1674 as a preemptive act of aggression and example to others by the militarized settlers of Natick, Massachusetts in the opening salvo of King Philips War. Although Queen :HHWDPRRU¶V ancient Burial Mounds were in existence at contact, the great Mound treasure was not discovered until later. Her story appears out of sequence due to its strategic geographical situation as an Atlantic settlement of Indian-Moors. Moors Dominate T he A tlantic -+DVVDQLPLVFR4XHHQ:HHWDPRRU¶V6HWWOHPHQW 4XHHQ :HHWDPRRU¶V &RXQWU\ ZDV $TXHWQHFN WKH $ERULJLQDO QDPH RI 5KRGH ,VODQG She was ruler of Atlantic Coastal Black Indian Tribes and a kinsmen of Massasoit and King Phillip of the NarraganseWW DQG :DPSDQRDJ 1DWLRQV 7KH 4XHHQ ZDV³6TXDZ 6DFKHP RI Pocasset at Fall River (extent territory to Massachusetts). Weetamoor was also related to 7XVSDTXLQNQRZQDV³WKH%ODFN6DFKHP³RU%ODFN&KLHI These were the Indian groups that welcomed the first Pilgrims in the Americas upon the word RI7LVTXDQWXPRU³6TXDQWR´ H assani-Morisco: Moroccan M uslim/Moors- :HHWDPRRU¶V3HRSOH :HHWDPRRU¶V 7ULEDO 7RZQ FDOOHG +DVVDQLPLVFR ZDV D FRPSRXQG ZRUG ZKLFK VHHPV WR KDYH contained two important elements specific to Morocco; the first being a similarity to the name GHULYHG IURP WKH VSRNHQ ODQJXDJH RI 0RURFFR NQRZQ DV ³+DVVDQL\\D´ 7KH VHFRQG HOHPHQW EHLQJ WKH ZRUG ³0RULVFR´ WKH QDPH JLYHQ WR ,QGLJHQRXV 0RRUV LQ DQFLHQW WLPHV FRQYHUWHG forcefully by the Spanish to Christianity. Alternate names are: Hasanya and Hassani. The Classification is Afro-Asiatic, Semitic, Central, South and Arabic. The alternate Hassani, plus Morisco would produce Hassanimorisco, literally meaning Hassani speaking Moroccan Muslim/Moors. In short, they were a special group of Saracens escaping conversion and established Colonies in the Aboriginal Indian Country. 4XHHQ :HHWDPRRU¶V FKRVHQ &RORQ\ QDPH JLYHV JUHDW FOXHV DV WR WKH HUD RI WKHLU HVFDSH DQG settlement (11th or 12th century). They were Subjects of the Kings of Morocco. Further their tribal families would also settle Carolina and the interior. 72 Moors of C arolina Besides Hassanimisco, large Moorish Native communities are known to have existed in Delaware. A city known as Cheswold, Delaware was composed of Moorish Natives with known connections to the Lenni-Lenape and Nanticoke Nations of Delmarva. Extensive Moorish Colonies, Indian-Moor Communities and Creole Settlements among many other Tribal Nations existed in North and South Carolina (including Turks, Guanches and other ³DOOLHV´ FDSWXUHG E\ PDQ\ ,QGLDQ &HQVXV 5HSRUWV 7UHDWLHV DQG KLVWRULFDO GRFXPHQWV (particularly among the Nations of the 5 Civilized Tribes). These nearly indescribable persons were subsequently categorized as ³IUHH SHUVRQV RI FRORU´ ³IUHH EODFNV´ ³0XODWWRV´ DQG ³1HJUR´DPRQJWKH7ULEHV Moors As G uides In T he A boriginal Indian Country H ernando De Soto in A ncient C arolina Hernando de Soto made several very curious remarks during his travels. He lamented in one discussion about his Moors being the ancestors of the Indians. The other observation being that DIWHUWKHORVVRI0RRUVIURPKLV([SHGLWLRQ'H6RWR¶VWHDPVHHPVWRKDYHEHFRPHYXOQHUDEOH unstable and directionally confused. Hernando De Soto also UHFRUGHG QXPHURXV LWHPV LQ DQFLHQW ³&DUROLQD´ DQG $ODEDPD EHDULQJ Moorish influences, such as those documented in their original narratives, confirmed by a 6FKRODUO\ UHFRXQWLQJ LQ ³'H6RWR &KURQLFOHV 7KH ([SHGLWLRQ RI +HUQDQGR GH 6RWR WR 1RUWK America in 1539-1543 by Lawrence A. Clayton, Vernon James Knight, Jr., and Edward C. Moore, Editors, Pages 304- ;9,, ³7KH $UP\ /HDYH &RIDFKLTXL ,Q 7ZR 'LYLVLRQV´ ³%HVLGHVWKHVHNLQGVRIDUURZKHDGVPDGHRIFRSSHUVXFKDVWKRVHWKH\SXWRQGDUWVLQ6SDLQ there were others with harpoons, also made of copper, and in the form of small chisels, lances, DQG0RRULVKGDUWVZKLFKORRNHGDVLIWKH\KDGEHHQPDGHLQ&DVWLOOD´ De Soto remarked upon his Expedition leaving three African Ancestored People with the Aboriginal Indians between Guaxule, Chiaha, and Xuala; 2 were Negroes and the third was a 0RRUIURP%DUEDU\³D%HUEHU³>0RRU)URP%DUEDU\3DJH;;@ $IRXUWKSHUVRQOHIWZLWKWKH7ULEHDW &RRVD&UHHN1DWLRQ ZDVD³1HJURQDPHG5REOHV´ Indian -Moor Colonies A ncient C arolina Moorish/M uslim Settlements 1526-L ucas V ásquez de A yllón E xpedition In 1526 an expedition led by Lucas Vásquez de Ayllón founded San Miguel de Guadalupe on the coast at Winyah Bay. San Miguel de Guadalupe is modern day Georgetown County, South 73 Carolina. The Santee River (stream) flows through here. The North and South Confluence of the River can also be found in this county. /XFDV 9iVTXH] GH $\OOyQ¶V 6SDQLVK-0RRU FRORQ\ LV UHIHUHQFHG DV D ³IDLOHG´ FRORQ\ LQ European History recounts because it did not result in an American Pilgrim Colony. Rather, de $\OOyQ¶V&RORQ\HYROYHGDVDQLQWHJUDWHG1DWLYH$PHULFDQ-Moor Colony. +LVWRU\ ,WLVQRWHG WKDW LQWKHV WKH&KLFRUD PHW 6SDQLVK H[SORUHU $OO\yQQHDU 3DZOH\¶V Island. Tribal members were spread out in Clarendon, Florence, Georgetown, Horry, Marion and Williamsburg counties. In 1743, the Colonial Government forced nearly all the remaining Indians to move to the Catawba Community. Tribal Leaders met at Cherawtown. In light of the ColRQLDO*RYHUQPHQW¶VDWWHPSWWRFRQFHQWUDWHDUHD1DWLYHVLQWRRQHYLFLQLW\DQ DPDOJDPDWLRQ/XFDV9iVTXH]GH$\OOyQ¶V6SDQLVK-Moors, the Winyuh, Pee Dee, Waccamaw, Santee, Chicora and Catawba was therefore created. U.S. G eological Survey Records San Miguel De Guadelupé (historical)-ID# 1232466 Class-Populated Place, CountyGeorgetown, State-SC, Latitude-331941N, Longitude-0791539W, Map-Georgetown South. Winyah Bay Entrance-ID#1251481, Class-Channel, County-Georgetown, State- SC, Latitude331154N, Longitude-0790856W, Map-Santee Point. Citation: Quattlebaum, Paul. The Land Called Chicora. Gainesville, Florida: University of Florida Press, 1956. P. 126. 1566-Pedro Menéndez de A vilés E xpedition In 1566, another Spaniard under Pedro Menéndez de Avilés, founded a settlement in South Carolina comprised of some 800+ Spaniards and their families, including Spanish Moors. He QDPHG WKH VHWWOHPHQW ³6DQWD (OHQD´ 0HQHQGH] GH $LYOHV¶ QHSKHZ QRWHG WR KDYH EHHQ D ³0DQGLQJR´VHWWOHG6W$XJXVWLQH)ORULGD M uslim/Moorish Influences In C arolina South Carolina Historical Society Records in the Carologue, Spring 1993 Edition carried a story HQWLWOHG ³0XVOLP 6ODYHV $EGXFWHG 0RRUV $IULFDQ -HZV 0LVQDPHG 7XUNV DQG DQ $VLDWLF Greek Lady. Some Examples of Non-European Diversity in South Carolina Prior to 1861 by -DPHV:+DJ\7KH6RXWK&DUROLQD+LVWRULFDO6RFLHW\DOVRNHSWGRFXPHQWDWLRQRQWKH³)UHH 0RRUV´RI6RXWK&DUROLQDZKLFKZDVUHFRUGHGLQWKH-RXUQDORIWKH6RXWK&DUROLQD+RXVHRI Representatives. 74 O fficial Documentation Confirming Inhabitation of F ree Moors in C arolina (Extract from the Journal of the House of Representatives, 1789-1790) ³6RXWK &DUROLQD KDG VLJQLILFDQW HWKQLF GLYHUVLW\ GXULQJ FRORQLDO WLPHV ,W ZDV KRPH WR )UHH Moors and Turks. While fighting in Defense of their country, the Moors were captured with their wives by a King of Africa. They were claimed by a Captain Clark who was to deliver them to an Ambassador of Morrocco, then living in England, to return them to their own country. ,QVWHDGKHEURXJKWWKHPWR$PHULFDZKHUHKHVROGWKHPLQWRVODYHU\´ ³7KH\ SHWLWLRQHG WKH 6RXWK &DUROLQD /HJLVODWXUH DQG WKH SHWLWLRQ VWDWHG That as free born subjects of a Prince now in Alliance with these United States; that they may not be considered as subject to a Law of this State (now in force) called the negro law. They were freed by the South Carolina Legislature; Report That they have Considered the same and are of opinion that no Law of this State can in its Construction or Operation apply to them, and that persons who were Subjects of the Emperor of Morocco being Free in this State are not triable by the Law for the better Ordering and Governing of Negroes and other Slaves. ³5HVROYHGWKDWWKLV+RXVHGRDJUHHZLWKWKH5HSRUW7KH\ZHUHIUHHSHUVRQVRIFRORU´ [From The State Records of South Carolina Journals of the HOUSE OF REPRESENTATIVES, 1789-1790 MICHAEL E. STEVENS, Editor CHRISTINE M. ALLEN, Assistant Editor Published for the South Carolina Department of Archives and History by the University of South Carolina Press Columbia, SC]. South Carolina Historical Society. O phir of Solomon: Intriguing L andmar ks-Indian Settlements A nd Repurposed Plantations in C arolina Ophir Plantation-/RFDWHDORQJWKH6DQWHH6W-RKQ¶V3DULVK%HUNHOH\&RXQW\ LQSUHVHQWGD\ Pinopolis). Earliest documented date of existence, 1685. A house was erected on the site in 1810. The site currently lies submerged under Lake Moultrie. Plantation lands were originally located near present-day Pinopolis. Ophir is yet another casualty of the Santee Cooper Hydroelectric and Navigation Project. This project displaced many families and communities, including historic homes, Indian Mounds, Burial Places, Cemeteries and Archaeological opportunities were lost as the area was flooded. Despite the fact that Thomas Porcher maintained Native American Slaves here from the point of initial contact, along with the presence and predominance of Indian Burial Mounds, the Ophir Graveyard was classified as ³%ODFN³ O phir Plantation-331740N 0800528W Chicora Map. O phir C anal (historical) Berkeley Chicora unknown 33.294ºN 80.091ºW 75 Note: Only 3 instances of use of the word appears in the Aboriginal Indian Country. All were associated purely with Indian Nations (2 Cherokee Settlements in North and South Carolina, as well of 1 Northern California Indian Settlements. O phir Indian Mounds (Indian) O phir Plantation Cemetery (Black) O phir Plantation{Citation: Ophir Plantation; Manuscripts Department Library of the University of North Carolina at Chapel Hill SOUTHERN HISTORICAL COLLECTION #M-823 STONEY AND PORCHER FAMILY PAPERS Inventory Abstract: Records, 1799-1862, of a Charleston District, S.C., plantation}. Negro Bay 1234351 Swamp Berkeley SC 331742N 0801321W Cross Feature ID: 1234351 Name: Negro Bay Class: Swamp Citation: U.S. Department of the Interior, U.S. Geological Survey, 1:62,500-scale topographic maps; various edition dates. Represents new or changed names from published editions. Map name and year of publication follow (if known): Chicora/1921 Entry Date: 01-May-1993 Elevation(ft/m): 92/28 Black Tom Bay 1246906 Swamp Berkeley SC 330854N 0800537W Moncks Corner Note: The name Monck comes from, George Monck, the Duke of Albemarle (1608-1670) one RIWKHRULJLQDO/RUGµV3URSULHWRU Moorfield Plantation-Location-Chicora, Berkeley, SC Moorfield Swamp-Location, Chicora, Berkeley, SC. USGS Location: Moorfield Swamp (historical) 1234340 Swamp Berkeley SC 331846N 0800639W Chicora. Moorfield Plantation Cemetery (Black). Black M ingo Swamp QDPHVWUDQVODWHVWR³%ODFN.LQJ6ZDPS³RU%ODFN&KLHI6ZDPS Indian field (Plantation Cemetery identified as Black). Indian F ield Methodist C ampground: National Register of Historic Places #73001707, added 1973. Also known as Indian Fields. About 4 mi. NE of St. George on SC 73. Period of Significance-1825-,QGLDQ)LHOG&HPHWHU\&ODVVLILHGDV³%ODFN´ Pooshee Plantation-Location, Chicora, St. Johns Berkeley Parish, Berkeley County (submerged under Lake Moultrie). Plantation lands were originally located near present-day Bonneau. Plantation houses built in 1716, 1804 and a western wing added in 1852. Origin of Name: Native American. Earliest documented date of existence 1705. Land grant to Pierre de St. Julien de Malacare. Number of acres, 4000. Primary crop, Santee long cotton. 76 Pooshee Plantation (historical) 1234600 Locale Berkeley SC 331901N 0800049W Chicora 75 - 01-MAY-+DVVHSDUDWH&HPHWHULHVRQ&ODVVLIHG³:KLWH´DQGWKHRWKHU ³%ODFN´1DWLYH Americans classed as Black. San M iguel De G uadelupé (historical)-ID# 1232466, Populated Place, Georgetown, SC, 331941N, 0791539W, Georgetown South. O ld Santee Plantation-/RFDWLRQ6DQWHH5LYHU6W6WHSKHQ¶V3DULVK%HUNHOH\&RXQW\ C ur riboo Plantation-Location, Berkeley County. Peru Plantation-Location, St. Stephens Parish, Berkeley County. Portions on Black River, Georgetown County. USGS: O ld Peru-ID#1234356, Populated Place, Berkeley, SC, 332514N 0795912W, Saint Stephen. Sarazen Plantation-Location, Cooper River, Berkeley County (Submerged under Lake Moultrie). Other Names: Sarizins. House built in 1826. Egypt Plantation-Location, St. James Santee Parish, Berkeley County. Cote Bas Plantation-/RFDWLRQ &RRSHU 5LYHU 0RQFNV &RUQHU 6W -RKQ¶V %HUNHOH\ &RXQW\ (located off Bushy Park Road between the Back River and the Cooper River.) Mexico Plantation-/RFDWLRQ 6DQWHH 5LYHU 6W -RKQ¶V %HUNHOH\ DQG 6W 6WHSKHQ¶V 3DULVK Berkeley County (bordering the old Santee Canal). Primary crop, Sea island cotton. USGS: Mexico-ID#1231539, Populated Place, York, SC, 345617N 0810017W Rock Hill West. Mexico Cemetery-ID#1224463, Cemetery, Berkeley, SC, 332643N, 0800636W, Pineville. C hachan Plantation-Location, Western branch of the Cooper River, Old Cordesville, Berkeley County ( off SC 44 Doctor Evans Road) on Chachan Road. Other Names: North Chacham. Earliest documented dated of existence, 1760. House built 1760. Primary crop, Rice. C hachan Plantation Cemetery SC Berkeley cemetery 331003N 0795750W Cordesville Note: linguistically similar to the name of an ancient Peruvian Chimu Settlement, at Chanchan. Salkehatchie River 1250734 Stream Hampton SC 324731N 0805247W Cummings. Combahee River: Named for the Combahee Indians who formerly lived on this stream. Description: Heads at the junction of the Salkehatchie River and Little Salkehatchie Rivers, flows SE to the Coosaw River 17.7 km (11 mi) northeast of Beaufort. Citation Note: 7KH&RPEDKHH5LYHUZDVDOVRFDOOHG³7KH-RUGDQ5LYHU´ 77 *Citation: Jordan River, Combiheh River,Combeheh River ; Salley, Alexander S., Jr., editor. Narratives of Early Carolina, 1650-1708. New York, New York: Charles Scribners Sons, 1911. *Citation: Salkehatchie River; U.S. Board on Geographic Names decisions, either decisions referenced H ilton Documents Moorish A rchitecture In E arly C arolina Hilton, in the 1700s described enormous structures typical of Moorish Architecture left in Carolina. Hilton Head Island, Beaufort County, South Carolina. Moorish/M uslim Mexico, Pacific States and the A merican Southwest Further west, when the Padres began bringing Black Mexican Aboriginals to settle the Missions they brought with them Indios, Coyotes, Mulatos, Black Mexicans and Moriscos with names OLNH $PH]TXLWD PHDQLQJ ³7R 0RVTXH´ WR VHWWOH WKH &DOLIRUQLD 0LVVLRQV IUom Baja, San Diego, San Luis Rey near Oceanside, San Juan Capistrano, Los Angeles, Santa Barbara, San Buenaventura, San Luis Obispo, Santa Margarita, San Miguel, San Jose, Sonoma, Santa Clara, Solano, as well as San Francisco (in Alta California). As the Padres set up the Mission systems from Loreto, Baja to San Francisco and even into Arizona, they documented the various descriptions and racial classifications of these settlers, ZKLFKZHUH DWWKHRXWVHW ,QGLRV&R\RWHV &R\RWO 1HJUR4XHEUDGR³%URNHQ %ODFN&RORU´ Mulato, even Chino (Black with Asian features), Mestiza, Mestizo, people descended from mixed Black Ancestors (for instance Olmec, Mixtec, etc.), and español. Even though the settling of the Missions represents a pivotal period of early Spanish/Mexican settlement of the Pacific West, we are no less awed by the fact that the most ancient prehistoric remains of an even earlier population of Black Aboriginals has been confirmed by modern forensic archaeological studies. Mexico Tenochtitlán is the original name of Mexico it was founded in 1325 on an islet in the western SDUW RI ODNH 7H[FRFR GH 0RUD ZKLFK WUDQVODWHV OLWHUDOO\ LQWR ³2XU &RFR SHRSOH RI 0RRUV´ 1HDUE\0D]DWODQGHORV0XODWWRVLWVHHPVZDVOLWHUDOO\³WKH%LUWKSODFHRIWKH0XODttos. The Olmec mated with the Coyoatl or Coyoacan and produced a generation called Coyotes. The ³&R\RWHV´ ILJXUHG SURPLQHQWO\ LQ WKH VHWWOHU FODVV RI HPLJUDWLQJ ZLWK WKH Padres in an effort to help establish settlements in their North America holdings, which were needed to fend off Russian encroachment of the Pacific West. It is clear that Coyotes had some type of African Ancestry. 78 ,Q WKH ROG WH[W ³7KH :LOG 7ULEHV RI 0H[LFR³-Physical Features in Northern Mexico, p. 619; "The Tlascaltecs in 1568 wore cotton-cloth mantles painted in various fine colors. The Inhabitants of Cholula, according to Cortes dressed better than the Tlascaltecs; the better class wearing over their clothes a garment resembling the Moorish cloak, yet somewhat different, as that of the Cholula. ,Q WKH VDPH ERRN XQGHU ³'UHVV LQ 0LFKRDFDQ S -623), the following description of a 7XUEDQDSSHDUV³RQWKHKHDGDVPDOOUHGFORWKDUUDQJHGOLNHD7XUEDQIURPZKLFKDUHSHQGHQW scarlet feathers, similar to those used by the ancient Aztec warriors." Esteban, the Moor Discovered New Mexico 1536-7KH PRVW IDPRXV 0RRU LQ WKH KHPLVSKHUH SURSHU ZDV (VWHEDQ GH 'RUDQWHV ³D %ODFN $UDE´D1DWLYHRI$]HPPRXU0RURFFR DVXUYLYRURIWKH1DUYDH]([SHGLWLRQWR/D)ORULGD who discovered what was (New Spain) and is now Southern New Mexico. He returned to Culiacan, Mexico with stories of having seen the Seven Cities of Cibola (Seven Cities of Gold). +H ZDV DQ ³HVODYR ODGLQR ³ RI $QGUHV 'RUDQWHV RI %HMDU GHO &DVWDQDU 6DODPDQFD Eslavo Ladino, means a Slave and converted Christian. Esteban, as he was now known, accompanied Dorantes. King Charles V of Spain granted him authority to settle all of La Florida, a territory that stretched from the southern tip of the Florida peninsula westward to the ³5LRGHODV3DOPDV´ZKLFKLVWRGD\¶V6RWRGHOD0DULQD5LYHULQWKH state of Tamaulipas, Mexico. Esteban (also, Estebanico) began his ascent into the Aboriginal Indian Country as one of only four survivors of the 600 members of the Narvaez Expedition in 1527-1528 to colonize La Florida. (VWHEDQ¶VVXUYLYDORIWKH([SHGLWLRQDQGVXEVHTXHQWGLVFRYHU\RI1HZ0H[LFRLVQRWKLQJVKRUW of miraculous and should be shouted from the rooftops and shared by other Moors. $FFRUGLQJ WR &DEH]D GH 9DFD ³ZH HQMR\HG D great deal of authority and dignity among [the Indians], and to maintain this we spoke very little to them. The black man always spoke to WKHP DVFHUWDLQLQJ ZKLFK ZD\ WR JR DQG«DOO WKH RWKHU WKLQJV ZH ZDQWHG WR NQRZ´ 1RWH >³%ODFN $UDE«1DWLYH RI $]DPRU´ by Kitty Morse, Saudi Aramco World, Volume 53, 1XPEHU0DUFK$SULO@@$O=HPPRXUL¶VWRZQLVD%HUEHUZRUGIRU³ZLOGROLYHWUHH´ ,Q(VWHEDQ¶VSXUSRVHGXULQJWKLVPLVVLRQZDVWROHDG'H1L]DIURPWKH,VODQGRI0DOKDGR (near the Bay of Galveston) to Cibola. Their personalities clashed, as De Niza did not relish the freedom the Moor felt in the Aboriginal Indian Country, nor the pleasant reception he received IURPWKH,QGLDQV(VWHEDQURGHDKHDGRIWKH6SDQLDUGDQG³GLVDSSHDUV´ZLWKLQWKHFRQILQHs of WKH =XQL 3XHEOR 'H 1L]D GRHV QRW UHDFK =XQL EXW LV PHW E\ ,QGLDQV ZKR QRWLI\ KLP RI ³WKH GHDWK´RI(VWHEDQ 79 European His-Story accounts contend that the New Mexico Indians killed Esteban (for various reasons) although his death was never observed, even those reporting it merely speculated that he had been killed and that is what they told the Spaniards. Did Esteban the Moor slip away as GLG'H6RWR¶V0RRUV" Coincidently, but apparently unrelated to Esteban the Moor, killed in their Pueblo (according to European His-Story); 7KHUHLVDQDFWXDO³&LEROD&RXQW\´ QRWDUXPRU 7KH$FRPD3XHEORLVRIILFLDOO\6DQ(VWHEDQGHO5H\GH$FRPD OLWHUDOO\³6DLQW6WHSKHQWKH .LQJRI$FRPD³ 3. They too have an El Morro National Monument (the Moor National Monument), and 4. Participate in an ancient Annual Feast honoring San Estevan. Numerous Structures, including Missions of Moorish Architecture were described, painted and ultimately photographed as a testament to their style, influence and rightful place in this hemisphere bearing Colonies, Settlements and Communities inhabited by the subjects of the Kings of Morocco in this hemisphere. To banish this type of Architectural style is an arrogant insult to their memory, as well as the remnant of their host Nations. The foregoing are but a mere sampling of my various works presented for your edification. Sincerely, Angela Molette (Tuscaloosa Ohoyo) Black Warrior Woman 80 -+6-+-&7!1(//#+!&*(1.(8!0!3(//0E(!&#!011!3(3"()/!#6! /,1&0+0&(/!#6!3,)0$,/'! Sultanates of M urakush A message to all members of Sultanates of Murakush In the United States, the Supremacy Clause of the United States Constitution makes all treaties that have been ratified under the authority of the United States and customary international law, ...the "Supreme Law of the Land" (U.S. Const.art. VI Cl. 2) and, as such, the law of the land is binding on the federal government as well as on state and local governments. According to the Supreme Court of the United States, the treaty power authorizes Congress to legislate under the Necessary and Proper Clause in areas beyond those specifically conferred on Congress (Missouri v. Holland, 252 U.S. 416 (1920)). The standard treaties and conventions leave the issue of implementation to each state, i.e. there is no general rule in international law that treaties have direct effect in municipal law, but some states, by virtue of their membership of supranational bodies, allow the direteryt incorporation of rights or enact legislation to honor their international commitments. Hence, citizens in those states can invoke the jurisdiction of local courts to enforce rights granted under international law wherever there is incorporation Foreign national According to the U.S. Department of Homeland Security a foreign national is defined simply as, "An individual who is a citizen of any country other than the United States."[1] The Brookhaven National Laboratory, under direction from the U.S. Department of Energy, further explains that, from the perspective of the United States, a foreign national is, "A person who was born outside the jurisdiction of the United States, is a citizen of a foreign country, and has not become a naturalized U.S. citizen under U.S. law. This includes Legal Permanent Residents (also known as Permanent Resident Aliens)."[2] This definition presumably also applies to anyone who has successfully renounced his or her U.S. citizenship. An alien (foreign national) who has been granted the status of permanent resident status is treated as a citizen of the state where the alien is domiciled Visit Sultanates of Murakush at: http://www.murakushsultanate.com/?xg_source=msg_mes_network 81 -+6-+-&7!1(//#+!&'-)&((+8!0+!-+9-E(+#,/!:(#:1(/!'-/&#)7!>D>! 'Faith-Based' Social Services July/August 2001 Viewpoint For Native Americans, It Was A Trail Of Tears "Faith-based" social services is not an original idea with President George W. Bush or the current Christian right. It is a concept that has been tried before, and it eventually proved to be a disaster for all concerned for the federal government, for the churches and for the population it was intended to serve. In 1869 President Ulysses S. Grant began turning over the full responsibility for the administration of Indian agencies to American churches and missionary bodies, whose assumed honesty and charitable motives were expected to give them success in achieving pacification and assimilation of the tribes. Within three years, Indian agencies had been apportioned among the Presbyterians, Methodists, Catholics, Lutherans, Quakers, Congregationalists, Dutch Reformed, Baptists, Episcopalians and other denominations. Missionaries filled federal offices as Indian agents and were in full charge of education and other activities on the reservation. On the whole, it was a disaster for most of the tribes of Native Americans. Some of the agents lived up to the expectations and acquitted themselves honorably. Others proved to be corrupt and incompetent. On numerous reservations, the missionary agents were fanatically determined to "Christianize" (in their own denomination) their wards and destroy everything they considered heathenish. Acting as bigoted dictators and backed by Army troops, they tyrannized Native Americans with orders that banned their ceremonies, their dances, the telling of legends and myths and all other manifestations of Native religion and culture. Those who resisted, particularly medicine men and tribal leaders, were treated with stern measures, ranging from harassment and the withholding of rations to imprisonment, banishment or death. During this same period, the Bureau of Indian Affairs made a number of attempts to suppress Native American religion with a series of departmental regulations. This was a direct violation of the Free Exercise Clause of the Constitution and, without a doubt, one of the greatest violations of human rights committed against a native population. Enthusiastic missionaries bent on the destruction of what they saw as a pagan religion, as well as reformers who saw assimilation as the only way to solve the "Indian problem," zealously implemented repressive government regulations. Children were forcibly taken from their parents and sent off to schools, often far distances from their reservations. When tribal leaders objected, they were held back by troops or thrown in jail without due process. In effect, all Native religious practices were banned. 82 The policy of entrusting reservations to the churches eventually failed because of the Native Americans' resistance, a growing public concern about Native rights and the treatment by the missionaries. Different denominations also began fighting among themselves over the distribution of supplies and the real or imagined favoring of rivals. In addition, some denominations were unable to continue financial support of their missions. In Washington, officials began to see that many of the church and missionary agents were no improvement over government agents prior to Grant's administration, so officials in the administration of Rutherford B. Hayes killed the policy, without addressing the constitutional issue. Although the practice was discontinued in the l890s, some 27 Christian denominations became established among a number of tribes, particularly those whose culture was in a state of disintegration. This, however, did not end the assault on Native religion, culture or institutions. The era of missionary control set the patterns for the treatment of Native Americans for the next 50 years. The U.S. government did everything in its power to break down and destroy "Indianness" including the Native American religion. This policy was not reversed until 1934 under Commissioner of Indian Affairs John Collier. The Indian Reorganization Act of 1934, also known as the Wheeler-Howard Act, inaugurated a sweeping change of policy in Native American affairs. Often referred to as the "Indian New Deal" it marked a change in the policy of enforced assimilation of the previous 50 years. Freedom of religion, the goal of so many European immigrants, was finally extended to the Native Americans, giving back to them the rights that were denied for over a half century by a government in cooperation with churches. This short history lesson makes clear several points. In the first place, the federal government has a constitutional obligation to "promote the general welfare," and it must not turn over its responsibilities to other organizations. Second, the Constitution forbids government to become involved in religious activities. Most churches have a clear missionary mandate. They see social services as secondary to that function or even as a means to implement that role. Government funding also puts "faith-based" programs in competition for state and federal grant monies. We must not assume that churches would be any more competent than existing, social service agencies. Chief Joseph reportedly said: "Do not send us churches; they will teach us to fight about God." Today we may paraphrase him, "Do not send us faith-based social services; they will teach us to fight about God and federal dollars." John M. Sullivan is professor emeritus of sociology at Limestone College in Gaffney, S.C. 83 -+6-+-&7!1(//#+!6#,)&((+8!"105$!+0&-.(!03()-50+!'-/&#)7"" Historical falsification and manipulation has been successful in painting a false picture of the origination of the so-FDOOHG ³%ODFN´ LQ $PHULFD EHLQJ RQ WKH VODYH VKLSV 7KH KLV-story books and his-storytellers (historians) have suppressed the existence of African descendants in American prior to the slave trade. Most Euro-Americans and American Indians will deny and even laugh at the notion of Africans being the original Native Americans. It was once said that, ³3HRSOH ODXJK DW ZKDW WKH\ GR QRW XQGHUVWDQG thinking that they are demonstration their VXSHULRULW\UDWKHUWKDQWKHLUODWHQWLGLRF\´LQRWKHUZRUGVWKH\WKLQNWKHLUODXJKWHULVDVLJQRI wisdom rather than ignorance. After the laughter is done the facts are still sitting there on the table staring them in the face. " Over 65% of the Melanin Rich (Black) population on the planet is said to be Black (Moorish) Native Americans. How is it that in his-story they always mention the fact that EuroAmericans and American Indians mixed, and that the Euro-Americans mixed with the Moors (Blacks), but they purposely never mentions the origin of the American Indian? How is it that DQHQWLUHUDFHRISHRSOH¶V $PHULFDQ,QGLDQ¶V OLQHDJHKDVQRWEHHQWUDFHGWRLWVRULJLQ"7KH truth that you discover in the realms of our-story renders the lies in his-story incomplete and inaccurate. In order to investigate the true origin of the American Indian you must begin with the Ancient Olmecs. The Olmecs were the first to inhabit what is currently known as Central and South America, and was domiciled in this area from 1500 B.C. to about 300 A.D. The Olmecs were responsible for the first Step Pyramid erected in the Americas. In the book entitled They Came Before Columbus: The African Presence In Ancient America by Ivan Van Sertima it states verbatim : "" " ³7KHYHU\ILUVW$PHULFDQ3\UDPLGRU6WHSSHG7HPSOHDSSHDUVDW/D9HQWDWKHVLWHFRORVVDO Negroid Heads and the steel on which is carved the Mediterranean type figure with bread DQGWXUQHGXSVKRHV´"" "" The Olmecs are of the Negroid persuasion and hail out of Ancient Uganda (Northeast Central Africa). Their arrival preceded the Continental Drift which occurred thousands of years ago. Often in schools teachers show the students the way the Continents fit together like a puzzle, and explain that the continents were at one point, one landmass. In this era the Negroid ZDV DEOH WR URDP IUHHO\ DQG HVWDEOLVK VHWWOHPHQWV DQG WUDGH WKURXJKRXW WKH ³ZRUOG´ 7KHVH wooly-haired dark skinned people were the original inhabitants of the Americas. " "" The obvious question rises as to how the Negroid arrived in America. There were two ways that the Melanin Man arrived in the Americas. The first of which was mentioned earlier in regards to the Olmecs (Negroid) walked to America (when it was one mass of land connected to Africa. The second way Afrikans arrived in the Americas was by ship. This was the case of A bu Bakari I I RI 0DOL $IULFD ,Q WKH WLPHV EHIRUH WKH LQYHQWLRQ RI WKH VDLO ³$IULFDQ´ navigators learned the routes of currents and tides of the Pacific and Atlantic Oceans. The G uinea C ur rent and the C anary C ur rents are the two main currents that flow from Africa to 84 America. The Canary Current flows southward form the African coast to C ape Blanc or C ape Verde depending on the season. And the Guinea Current flows eastward from the Guinea Coast, which cycles out and to the sea joining the South Equatorial Current. In efforts to escape from the racism and strict opposition of Muhammadism to African Culture, and denial of truth, Abu Bakari II left the kingdom of Mali. In efforts to link to his family Abu Bakari II set off on a trek to the Americas. The Malian empire was vast spanning from Morocco, Libya, and Tunis. Bakari set sail to America with half of his riches and history of his Empire after making his EURWKHU0DQVD³.DQ.DQ´0XVDNLQJEHIRUHGHSDUWLQJLQ$'8VLQJWKH$QFLHQW$IULFDQ practice of the talking drum was utilized to communicate with his fleet, Abu Bakari arrived in precisely six cycles after the disappearance of Quetzalcoatl by way of the sea from among the Toltecs in 999 A.D., therefore his was mistakenly thought to be Quetzalcoatl by the Aztecs. The rain god and wind god aspects of Quetzalcoatl fit with the black skin of Bakari. In the Aztec culture a cycle denotes 52 years of the Gregorian calendar. After the departure of his brother Mansa Musa left to find Abu Bakari never to return again. " The worship of black gods was a common occurrence in Pre-Columbian art and culture, as illustrated in the book T hey C ame Before Columbus, which states: ³7KHUH PD\ EH VRPH VW\OLVWLF GLVWRUWLRQ LQ WKH 1HJURLG +HDG IURP WKH 0DQGLQJR FRQWDFW period in plate 6 (bottom row). The chin huts out with an exaggerated and primitive. Strangely enough, it was regarded by the American Indians as a sacred face. If was venerated later by the Aztecs, simply because it was black, as their god Tezcatlipoca. Black gods and gods with Negroid features (for the word black is sometimes used to describe 1HJURLGIHDWXUHVIRURWKHUVLW¶VVRPHWLPHVMXVWDFHUHPRQLDOFRORU PD\EHIRXQGDPRQJWKH American Indians. Another black god is the god of jewelers, Naualpilli. The Negroid features of this god were sculpted in green stone by the Mexicans, while his kinky hair was cast in pure gold. There is also the god of traveling merchant, of whom we shall later speak, EkChu-$KZKRHQWHUV0D\DQP\WKRORJ\LQWKHZDNHRI0DQGLQJR´ There are a lot of commonalities shared by the Mandingo Malians and the medieval Mexicans; for instance, the plumed serpent motif of ancient Mexico and the feathered serpent of mediaeval Mali. The Dasiri of Bombara is the Malian equivalent of Quetzalcoatl of Mexican lore. Dasiri (protector of the village whose sacred animal is the snake) is of the Mandingo from which Abu Bakari II was a member; both the feast of Dasiri and the Quetzalcoatl Ceremony take place in the beginning of the year. Archeologists have discovered that the colossal bay salt heads were crafted by the Olmecs (Negroid). Originally discovered in 1836 A.D. and rediscovered in 1938 A.D. by Dr. Matthew Sterling outside the city of Tres Zapotes in the jungles of the Gulf of Mexico. These humongous statues astounded the Archeologist and continue to be the center of fascination for many today. The size and skill displayed in conjunction with the obvious African features of the 20 ton, 7-8 foot statues was truly baffling to the Archeologist. Even more confusing was the fact that ancient people without the use of modern technology or the wheel were able to move this gigantic stone. The boulders were moved from the bottom of Mount Tuxtla where it was 85 taken over a thirty feet deep gorge to the site of these monuments today. Could it be that these ancients new the same knowledge used by the ancient Egyptians in the engineering of the great Pyramids in Giza and the Nubia? You better believe it! As stated previously the original inhabitants of the Americas were Negroid and also the dynasties that ruled Egypt prior to the Hyksos Dynasty were Negroid as well. Even the headgear worn by the Olmec statues appears to be the same headwear worn by the Egyptian Nubian army in the period of the Pharaoh Rameses, and the first 1000 years B.C. Additional evidence can be found on the walls of Mount Alban where engravings of the dancers or death figures, which show a striking resemblance to the Sphinx of Egypt and also the deity Ra in bird form. 7KHQDPH2OPHFV PHDQLQJ³SHRSOe of the rubber land) was given by their descendants the Aztec. This name was given because the Olmec uprooted rubber trees (called Cau-Uchu PHDQLQJ ³ZHHSLQJ ZRRG´ E\ 2OPHFV DQG SODQWHG WKHP LQ WKH $PHULFDV The Negroid later becoming known as the Olmec, and when the Europeans came to the Americas they witnessed natives playing with large rubber balls extracted form the rubber trees. Prior to the Columbian era the cultivation of rubber fluid was customary during the Olmecian period. While these facts are clear and the evidence of Africans being the first inhabitants of the Americas is known in some intellectual circles, archeologist keep the secrets of history under lock and key buried away from the public. These truths would undo centuries of deprogramming of the Melanin Rich occupants of America, while stealing their historical global achievements and claiming all of their worldly and intellectual possessions by brute force and trickery. That is why they laugh when you state that the Negroid was the original occupant of the Americas. Because their acknowledgement of that means that you fall into the indigenous category and fall out of the jurisdiction of the corporation (government) that FRQTXHUHGWKHODQGVRI\RXUSHRSOH:KDW¶VZRUVe is that they will no longer own you as chattel (property) and you become autonomous, sovereign or self-governing. And quite frankly after they have reprogrammed you and raped, tortured, and killed your ancestors they fear what you PD\GRLI\RXDUH³IUHH´IURPKLVKROG KHIHDUV\RXDUHOLNHKLPDQGZLOOVHHNWRGHVWUR\KLP Our peaceful nature as a people is what he is not taking into consideration. If the shoe was on the other foot he would not be satisfied until every black soul was buried six feet under the dirt. The Melanin Man wants freedom and harmony and not to fulfill some sick fantasy of world control that is passed down from generation to generation which you see today in the world society by the Illuminati and their minions. It is for this reason that his-storytellers (historians) will tell you that the origin of the Olmec is not certain. They will even say that they may have been Chinese immigrants that crossed the Bering Strait. They known that those colossal monuments that still sit there today share the gene traits (large lips and nose) of the African (Ugandan) and will even say they were Negroid like because of jagged and faulty tools (despite fine details on the headgear and eyes), they will say anything except the obvious truth staring at them in those statues, because of what LW ZLOO PHDQ IRU WKH ³KLVWRU\´ WKH\ FUDIWHG 7KH $IULFDQ 0DQ ZDV QRW LQWURGXFHG WR $PHULFD 86 during the slave trade, for they were always here as natives (Native Americans). As the Olmecs we built the bay salt head statues and as the Washitaw Mound Builders we built huge monumental mounds in America to mark our presence. During slavery times you had free EODFNV DOVR FDOOHG IUHHPHQ WKDW DUH SURSHUO\ UHIHUUHG WR DV 0X¶XUV 0RRUV 7KH\ ZHUH WKH product of the Negroid link in the Americas, and some became indentured servants. 8SRQ WKH DUULYDO RI WKH (XURSHDQ WKHVH 0X¶XUV ZHUH HQVODYHG 7KH\ KDG HVWDEOLVKHG prosperous communities with schools, government, agricultural centers, social systems, and granaries established. This bring in the question of the origins of the American Indian also called the Red Man, and where the fit in the picture. The American Indian (Red Man) is a product of the mixture of two races the Negroid (Olmec) and the Mongoloid (Chinese). It is also a contested fact that the original people of Asia are of African descent. They can be found in the first Chinese dynasty (Shang Dynasty). During the 4th century a Buddhist monk named Hsu Shen lead some of these descendants to the shore of what is now known as California. Hsu Shen and his followers set sail and arrived on American shore in 459 A.D. They lived amongst the Olmecs (pure blood, Negroid) and gave rise to what is known today as the American Indian (full blood, Red Man). The Olmecs gave them the area known as South America then called Amexem, which stems from the word Hexian which stems from Hsu Shen of Ho Shen which incidentally is the name of Mexico. The Northern Olmecian region became known as Atlan. Since they were seen as part of the same family link their children were permitted to mix in with the Olmecs. This mixture resulted in the creation of what in known as the American Indian. The epicanthic fold in the eyes of the RULJLQDO$PHULFDQ,QGLDQVLVDUHVXOWLQWKHIHDWXUHIDOVHO\FDOOHG³VODQWHG´H\HV7KLVHSLFDQWKLF fold is a trait original to the Mongoloid genetics. The American Indian also inherited the shovel teeth and hollow strait hair from the Mongoloid gene. The American Indian (product of Negroid and Mongoloid mixing) is today referred to accurately as full blood. Those that are paler than normal are a result of the years of European occupation and they are called mixed blood. They purposely tied into our genetic vine to infiltrate and control us from within. They married in to the tribes to disrupt the structure of it. When Europeans saw that most North American Tribes were rule by a gynecocracy or matrilineal government, which is a government ruled by women, they falsely thought that a society governed by women was weak. The European view of the women was that they were weak, spoiled creatures that need protection, and this was a wrong image to project on the American Tribes. Nations like the Iroquois, Washitaw, Hopi, Navaho Crow, Pomo, Kiowa and Turok were ruled by women. The Native Americans acknowledged that strong women build a strong nation. The European Christian influenced outlook on the creation of woman coming IURPPDQ¶VULEPDGHLWLPSRVVLEOHIRUWKHPWRXQGHUVWDQGKRZDQ\SHRSOHFRXOGVXUUHQGHUWKHLU power to a woman. When they saw women ruling over governments when they arrived the Europeans sought to change this structure. This infiltration was seen in a project where Cherokee young men were sent to Europe to learn the British ways of life. These young men were then returned to the Cherokee nation which included North Carolina, Mississippi, and 87 Georgia, to establish male dominance amongst their people and eradicate the traditional governmental structure. While some genuine meaningful relationships were established between Europeans and Native Americans, in many cases these unions were arranged as gestures of peace. It was FRPPRQIRUD&KLHIWRJLYHKLVGDXJKWHU¶VKDQGLQPDUULDJHDVDVLJQRIKDUPRQ\DQGJRRGZLOO a way to welcome into the family. The natives were very selfless and giving during the European Colonization. It must be stressed that there have been many in our midst ( Native Americans, American ,QGLDQV ZKRDUHZKDWLVFDOOHG³PL[HGEORRG´DQGLWVKRXOGEHQRWHGWKDWWKLVLVQRWPHDQWWREH a divisive lesson but one of unity and inclusion of the Melanin Man (Black) in his rightful place in the history of the Americas. We must never treat any of our brothers and sisters any differently, no matter how dark or light their skin may be. The right or Native Americans and American Indians as indigenous people do not lie in our genealogy but rather in our dedication to our culture and the maintenance of our traditions and lands. 88 -+6-+-&7!1(//#+!6-6&((+8!*'0&!*0/!7#,!5011(9!"(6#)(!>F?4G! Universal Zulu Nation & Universal Zulu Kemetic Moors Presents: The Aboriginal Indigenous Conference of the Americas T aj T arik Bey of the Moors O rder of T H E Roundtable in Association with R. V. Bey Publications Answers 51 Questions for 7KH8QLYHUVDO=XOX1DWLRQ¶VAboriginal Indigenous Conference W hat Were You Called Before 1492? Contained herein are answers to the 51 questions, asked of the Universal Zulu Nation, in search of answers. We attended the Conference in October 2008, and thought the questions were worthy of answering, and publishing for the benefit of all who were interested. The cover letter below was written by King Yoda, of the Universal Zulu Nation, as a call to all Aboriginal and Indigenous People, to all Preachers, Imams, Rabbis, Teachers, Students, and other Community /HDGHUVµVR-FDOOHG¶5HOLJLRXV/HDGHUVDQG&RPPXQLW\$FWLYLVWV The answers provided within, have been carefully researched by Taj Tarik Bey. Acceptance of them is a matter of study to prove them right, or prove them wrong. The Truth is the light; the light brings you to the dawning of your awareness; your awareness sets you free. Many shall go to and fro in the earth, seeking knowledge and knowledge shall increase. Peace and Love Forever Moor, Sister Rahsmariah V. Bey, Publisher R.V. Bey Publications. 89 /HWWHUIURPµ.LQJ<RGD¶LQUHIHUHQFHWRWKHSXUSRVHRIWKH&RQIHUHQFH T O A L L A B O R I G I N A L A N D I N D I G E N O US P E O P L ES ON THIS PLANET, SO CALLED EARTH, WHAT WAS YOUR PEDIGREE, INHERITED NAME BEFORE THE YEAR 1492, WHEN COLUMBUS SAILED THE OCEAN BLUE, AND TOOK YOUR IDENTITIES, AND ROBBED YOU? ALL YOU BROTHERS AND SISTERS WITH HUE WERE HERE UNITED; SO-CALLED BLACK, SO-CALLED BROWN, AND SO-CALLED RED MEN AND WOMEN. THEN HERE COMES COLUMBUS, AND WHAT ARE YOU NOW? WHAT IS YOUR NATIONALITY? WHAT IS YOUR BIRTHRIGHT? WHY IS THERE SUCH A SEPARATION BETWEEN SO-CALLED BLACK AND SO-CALLED BROWN? TO FIND OUT THE ANSWERS TO THESE QUESTIONS, TO FIND OUT ABOUT YOURSELF, COME TO THE ANNUAL UNIFICATION 0((7,1* $7 µ7+( 1$7,21$/%/$&.7+($75(¶,1+$5/(021/08, 10/10/08 AND 10/11/08. L E A R N A B O U T Y O U R T R U E SE L V ES. STOP BEING HOODWINKED AND BAMBOOZLED BY THE LIES AND DECEITS. WE ARE NOT A SEPARATE PEOPLE!!! NOW IS THE TIME TO COME TOGETHER AND REUNITE!!! COME ON DOWN AND HEAR SOME POWERFUL BROTHERS AND SISTERS DROP KNOWLEDGE ON BIRTH-RIGHTS, NATIONALITY, AND MUCH MORE! T H IS IS A B O U T U N I T Y I N T H E C O M M U N I T Y!!! THIS IS A CALL OUT TO ALL PREACHERS, IMAMS, RABBIS, AND OTHER SO-CALLED RELIGIOUS LEADERS. THIS IS A CALL OUT TO ALL TEACHERS, STUDENTS, AND OTHER COMMUNITY LEADERS. WE HAVE WASTED TOO MUCH TIME ON NONSENSE! IT'S TIME TO STOP HATING OURSELVES AND EACH OTHER. WE HAVE TO COME TOGETHER SO-CALLED BLACK, SO-CALLED BROWN, YELLOW, AND RED PEOPLE. ITS TIME TO RECONNECT AND REBUILD. LIKE THE GREAT SLY STONE TOLD US A LONG TIME AGO: " I T'S A F A M I L Y A F F A I R " A N D N O W I T'S T I M E T O " ST A N D!! " KING YODA, U N I V E RSA L Z U L U N A T I O N THURSDAY, FRIDAY, SATURDAY D A T E : 10/09/08 10/10/08 AND 10/11/08 P L A C E: NATIONAL BLACK THEATRE 125TH ST. AND 5TH AVE. HARLEM, NEW YORK, T I M E : 6:00 PM - UNTIL P E A C E , U N I T Y, L O V E , H A V I N G F U N, O V E R C O M I N G N E G A T I V ES T O P OSI T I V ES!!!!! 90 Q U EST I O NS A N D A NSW E RS 1. W hat were we called before 1492? A nswer: 7KH¶QDWXUDOSHRSOH¶ZKRDUHWKH)RXQGHUVRI&LYLOL]DWLRQDQGWKH0RWKHUV and F athers of the Human F amily, were called Moors / Muurs / Mu / Maure / Maurus / More / Moorens / Moroccan / Al Moroccans, etc. These are some of the dialectical pronunciations, according to varied languages, such as, Moorish Latin, Middle English, Germanic, F rench, Greek, etc. 2. W ho is the O riginal M an and Woman? A nswer: The Ancient Moabites / Muurs / Moors; the Asiatics- someti mes referred to as, Mu, Lemurians; and in latter history, Canaanites / Africans. 3. W ho is M an and who is M ankind (kind of M an) A nswer: Man is a na me that designates the human species, (Hominidae) Woman and her VRQV 0DQNLQG LV UHIHUHQFH WR µPRGHUQ²PDQ¶ - the Hybrid / Ibrida (Amalga mated Moors), known as, Paleolithic Man, Neanderthal, Troglodyte Niger, Engla-Man, Albion, or European. 4. A re W e A ll A mericans? A nswer: Assuming this question is directed to the dark olive Asiatic Aboriginals of the Land, the response is that the Moors are the true possessors of the present Moroccan E mpire, ZKLFKVSDQVIURPµ7DPDUL¶ QRZFDOOHG$IULFD Hven across the great Atlantis; and includes, Northwest, Central, and Southwest Amexem, and the Atlantis Islands. These geographical areas are now called, America; North, Central, South, and the adjoining Islands. 5. W ho is this man A merigo Vespucci, that E uropeans claim A merica was name after? A nswer: Amerigos Vespucius was a European of Italus (Italian) descent; and a neophyte explorer who sailed from the Moorish city of Khadiz (Cadiz), to learn of the latitudinal and longitudinal imaginary gridline used by the Moors for navigating the Earth. Particularly using the Sextant to measure one heavenly body in relation to another, against the horizon, for deter mining longitude and latitude positions while at sea or on the oceans. 6. W hat is this name A mexum that T he Moors claim the A mericas was called? A nswer: Amexem is the ancient na me of the lands known as, Africa. Including North, Central, and South America. 91 7. W ho is C hristopher Columbus and if he is the O ne who Discovered A merica, then why was this continent not named after H im? A nswer: Chritofero Columbo was a European Inquisitionist and Sadist, whose actual mission was theft and murder by genocide; initiated for Christendom, against the Aboriginal Moabite / Moorish tribes of the Western Hemisphere. The continent was not named after Columbo because he didn't discovery America. Ameru / America / Amexem already had its name and it was already a highly cultured and thriving Civilization. 8. W ho are the Native A mericans? A nswer: µ1DWLYH $PHULFDQ¶ LV DQRWKHU contemporary sociology ter m or disassociation conquest-tag - an invented construct of European conquerors. It, like many other misnomers and tags, is not a national identity of the Aboriginals, but is a political status²class designation, designed to expand upon social and political divisions, displacement, and confusion amongst the Aboriginal Moors of the Americas. 9. A re W e Black, B rown, Red, Yellow, W hite People? A nswer: No, we Asiatics are not Black, Brown, Red, Yellow, Orange, Light-skinned black, Purple, Plaid, or Green people, etc. The Human F amily (collectively) is identified and known E\ µ1DWLRQDOLWLHV¶ DQG SHGLJUHH QDPHV - not by crayon colors. This deep sign of mental LJQRUDQFHZDVSURPRWHGE\,QTXLVLWLRQLVW¶VWRGHQDWLRQDOL]HWKHULJKWIXO Heirs and Inheritors of the Land (America / Al Moroc). However, the Europeans were calling WKHPVHOYHV µ5HG 0HQ¶ SULRUWRWKHSROLWLFDODGDSWDWLRQRIWKHSROLWLFDOVWDWXVµ:KLWH 0HQ¶LQWKH±63. This caste adaptation was initiated by Horace Greeley, a newspaper tycoon from New York. He influenced WKHWUDQVIRUPDWLRQRIWKHµ:KLJJDPRUH :KLJV 3DUW\¶LQWRWKHµ5HSXEOLFDQ3DUW\¶GXULQJWKH establishment of the Knights of Columbus and Ku Klux Klan Oath of 1854 to 1863, in Philadelphia, Pennsylvania, and Chicago, Illinois, United States of North America. It must be further understood that the WHUP ³)UHH :KLWH 3HRSOH´ LV D VRFLDO FDVWH DSSHOODWLRQ LQ Jurisprudence, and has nothing to do with complexion of skin. 10. W hat is the difference between H umans and H ue-mans? A nswer: Human is the specie, (Hominidae / Man). Hue-man is a sociological fad word, used to designate, or refer to, the natural peoples of the planet, who naturally, and obviously have, by nature, life-IRUFHµPHODQLQ¶LQWKHLUVNLQ 11. W ho are the real Indians? T he so called Indians of the A mericas or the Indians from India? A nswer: Indian, as propagated by European conquerors of the western hemisphere, is a myth. America is not India, and the Aboriginals are not Indians. However, Europeans have called the Moors of the Western Hemisphere, Indians, because they (being influenced by 92 Christophero Columbo) thought they had first arrived at Hindustan, Asia, just below China. The Aboriginal, Natural People and their culture were falsely designated as, Indian; although the Europeans knew that we were not Indians. Sometimes the Europeans would designate the 0RRUVDVµ:HVW²,QGLDQV¶ 12. W ho are the real L atinos? T he Spanish speaking Puerto Ricans, Dominicans, Mexicans, Salvadorians, B razilians, South A mericans etc., or the L atinos from Spain, Portugal, F rance, Italy, G ermany etc.? A nswer: Latin is a language and not a people. Latino is another pseudo-identity construct of European Sociologists. Designated for the purpose of promoting divisions among the natural peoples. Puerto Ricans (Boringuen), Dominicans, Haitians, Mexicans, El Salvadorians, Brazilians, and other true South Americans are all Moors² descendants of the Ancient Moabites. 13. W hat people stole all your nationalities and Birthrights? A nswer: The Dutch Master Colonists coined the tags and brands, Negro, Black, Colored, etc., to break the linear history of the Aboriginal Moors of Northwest Africa / North America. This is a mental ²warfare tactic, used to disconnect the natural people from the illustrious history of their Fore-F athers, and from the Land. 14. W ho are T he M O O RS,(M U U RS) and what is their H istory to so called L atinos, Black, Native A merican People and T he World? A nswer: Muur / Moor is the true consanguine pedigree of the natural people. The other words, such as, Latinos, Blacks, Native Americans, etc., are misnomers, tags and brands; having nothing to do with the true national names of the people of the earth. The Moors ruled the world and the seven seas for over eleven hundred, ninety²six years straight, until falling DQGEHLQJRFFXSLHGE\WKH'XWFK(XURSHDQ,QTXLVLWLRQLVW¶V and Colonists. 15. W here did the so called Indians (Red M an and Woman come from? A nswer: The so-called Indians are mixed Moors, of Chinese and Moabite inter mixing. µ5HG 0DQ¶ Ls a designation originating with Europeans, and was commonly used until the mid ¶V 16. W ho are the O lmecs and what is their relationship to the M ayans, A ztecs and all A mericans? A nswer: Ol mecs, Mayans, and Aztecs, etc., are all Aboriginal and Indigenous natural SHRSOHV RI WKH µ1DKXDWLDQ¶ PL[HG WULEHV RI $QFLHQW 0RDELWHV 0RRUV ZKR IRXQGHG Mehicu 0H[LFR 7KLVLVGHULYHGIURPWKH2OG0RRULVK/DWLQZRUGµPL[WLFLXV¶ZKLFK PHDQV³WRPL[´ 93 17. A re all H umans from all-Nationalities, races all from A frica? A nswer: Africa is a modern na me of Amexem. The Ancient Moabites are the Mothers and F athers of the Human F amily. The expanded national descendants of the Ancient Ones are therefore, obvious; whether thorough-blood or mixed. The Human F amily origin is from the Moabite Woman. 18. W hy do these specific A fricans called Z ulus, Dogons, K emetians (Egyptians) claim A frica as their T hrone but claim to come from Space like M ars and Sirus A and B? A nswer: The Ancient Natural Peoples of Amexem, inclusive of Ka maat, etc., are all of one family (expanded). Travel in the extra-terrestrial planetary system is not new to Moors, nor is space travel a modern technological discipline. It is Ancient among Ancients! We are the RZQHUVDQGHVWDEOLVKHUVRI&LYLOL]DWLRQRQWKH(DUWKµ6 tore-KRXVH¶RI this Solar System. Much of our knowledge and history was lost. But we were not always only on the Earth. 19. W ho built all T he Pyramids all over E arth? A nswer: Our Ancient Mothers and F ather built the Pyra mids all over the planet Earth. Some of the Pyramids in Central America are older than the Pyramids in Kamaat. Pyramid University, located in the Yucatan, Mehicu is over 24,000 years old, as an example. 20. W hy all civilizations are based off of K emet (Egypt)? A nswer: Most of the modern or contemporary Civilizations are based more or less upon Ancient Sumer / Babylonia. Kamaat (mis-called Egypt) is modern and also derivative of Ancient Sumer / Babylonia Cosmology Culture. 21. W ho are the Egyptians, A tlantians, L emurians and what do they all have to do with C ivilization today? A nswer: We are one and the sa me natural peoples, having expanded upon the face of the planet, Earth. The variations of names has more to do with social / political jurisdictions, involving geographical movements and locations, which were, and are, given names. 22. W hat is a Negro, Colored M an and Woman? A nswer: 7KHVH QDPHV DUH µEUDQGV¶ DQG µWDJV¶ FRLQHG IRU LJQRPLQLRXV VRFLDO µVWDWXV¶ in VRFLHW\ 7KH\ DUH SROLWLFDO µ&DVWH¶ GHVLJQDWLRQV DQG QRW QDWLRQDO LGHQWLWLHV 1HJUR LV an $QWKURSRLG$SHµ&RORUHG¶LVDOHJDOWHUPPHDQLQJµ$UWLILFHIDNHFRYHUHGXSDUWLILFLDO and IUDXG¶ 94 23. Is L atino a race and why do L atinos think they are not of Black or W hite People or that they are B rown People or Spanish but not A frican or Moors? A nswer: /DWLQ LV QRW D µUDFH¶ EXW LV D ODQJXDJH²originally, Moorish Latin. Black and :KLWHLQ6RFLRORJ\DUHµ&DVWH¶WHUPV7KH$ERULJLQDODQGPL[HG0RRUVRI&HQWUDO America, 6RXWK $PHULFD DQG WKH DGMRLQLQJ ,VODQGV ZHUH VXEMHFWHG WR µQRP -de-JXHUUH¶ war strategies and mental disassociation, by the European Conquistadors, just as the Aboriginal Moors of the North were branded black, negro and colored. In the year, 1511, Phillip II, E mperor of Rome, declared all that is Moorish shall be claimed by the Church! Thus, the language, Moorish Latin, beca me falsely known as, Spanish. Truth be told, there is no such thing as Spanish being a language. This documented Roman &DWKROLF&KXUFKµ(GLFW%XOORI¶LVDOVRZK\PDQ\ of the American (Al Moroccan) descendants of Moors (mixed and others) were falsely called 6SDQLVK7KLVµQRP-GHJXHUUH¶ practice is an act of conquest ²not of pedigree truth. 24. W ere all H umans slaves to other H umans some time in H istory? A nswer: 7KHZRUGµ6ODYH¶LVPRGHUQLQRULJLQKDYLQJQRDQ cient history on the planet. It is derived from the word, Slovene and Slovak. This refers to the European members of the SerboCroatian group of Slavonic peoples. However, contemporary Sociologists have layered the natal identity word with social / political connotative meanings. The contemporary word, µVODYH¶KDVEHHQSODFHGUHWURDFWLYHO\LQKLVWRU\DQGDVVLJQHG to those held to forced servitude. Yet, it must be noted that this word is not ancient! 25. W ho are the Real E uropeans and where did they come from? A nswer: Europeans are Paleolithic / modern man -µ+\EULGV¶RUµ$QGURLGV¶7KHLU origin is WKH µ+HWHURJHQHRXV PDQLIHVW¶ RI WKH µ7URJORG\WH 1LJHU $QWKURSRLG¶ FURVV-bred with the µ+XPDQ¶ VSHFLH 7KLV SHUIHFWHG ELRORJLFDO H[SHULPHQWDWLRQ PDQLIHVWHG DV µ7KH Paleolithic 0DQ¶ 3DOH-face), or Neanderthal. 26. W ho first started Religion and why is it needed today? A nswer: 7KH $QFLHQW 0RDELWHV IRXQGHG WKH ZRUOG¶V ILUVW UHOLJLRQ 7KH WUXH HW\PRORJLFDO PHDQLQJRIµ5HOLJLRQ¶LVµDVWXG\RIWKH6WDUVDQGWKHZRUNLQJVRI1DWXUH¶7KH masses of the world (miseducated by European conquerors) do not know of the original meaning of Religion. Selfish and wicked rulers and High Priests have traditionally suppressed the truth, in order to amass wealth, political power, and to subdue and conquer the world. These truths about religion are held secret, and taught in Secret Societies of North America and the world. The power of knowledge has been preserved for the Elite Caste, Industrialists, and Rulers of Government. Another term for this Religious / Cosmo knowledge and Anthropological secrecy is called, Masonry. 95 27. W hat is the oldest religious so called Holy Book on T his planet and is it T he Holy Bible, the G lorious Q ur'an, Vedas, the Book Coming Forth By Day or some other older religious Book? A nswer: It must be understood that so-FDOOHG UHOLJLRXV µ+RO\ %RRNV¶ DUH DOO FRGHG Astrology Texts. They are, for the most part, mathematical calculations of Human evolution, chronology and prophecy. Among the books mentioned in this TXHVWLRQ ³7KH Book² Coming )RUWK %\ 'D\´ LV GHULYHG IURP HYHQ ROGHU 6XPHULDQ FXOWXUH DQG WH[WV The Vedas are next, displaying more openly, the philosophical and Astrological culture of the Ancient Ones. Much RI WKLV PDQLIHVWHG GXULQJ WKH µ0DXU\DQ '\QDVW\¶ in ancient Hindustan and Sumeria / Babylonia. Yet, all of these Holy Books have a symbiotic relationship. 7KH ZRUG µ+RO\¶ LV GHULYHG IURP WKH $QFLHQW 6DQVNULW ZRUG µ halig¶ PHDQLQJ µ+H EXUQV¶ µ7KH 6XQ¶ DQG µ7KH :KROH¶RU+ROLVWLF 28. W hat are E xtrater restrials, A liens, Space C reatures and what do they have to do with H uman Beings? A nswer: Much that is considered extra-terrestrial is actually not! All phenomena and advanced things are just not exposed to the masses, nor admitted to by Inquisition Rulers. Space travel is ancient. And interfacings with Beings from other planets are also ancient to Moabites. We have never been alone nor static in this Solar System nor in this Galaxy. 29. W hat are U F Os and are they from Space or Subter ranean- Worlds within our E arth? A nswer: U F O means unidentified flying object. This si mply implies that officials are not admitting to the public, the truth of what is known of these interstellar Craft and Devonia. These Crafts and Devonia are from the subterranean realms and from other planets and galaxies! 30. W hy do all A boriginals Indigenous People all have stories in their history dealing with beings from other worlds? A nswer: Refer to answers to questions, 28 and 29. 31. W ho is G eorge W ashington and was he the 1st President of T he United States? A nswer: George Washington was an Englishman and was appointed as the ninth (9th) President for the United States Republic of North America, in the year 1789. 32. W ho is John H anson and was he the 1st President of T he United States? A nswer: John Hanson was elected the first (1st) President for the United States Republic of North America, in the year 1781. 96 33. W as John H anson a Moor? A nswer: Many have said that John Hanson was a thorough-blood Moor (Moabite / Muur). Others have said that he was an Amalgamated Moor (European / Albion). 34. W hat does the I roquois Constitution have to do with the United States Constitution? A nswer: Keep in mind that the Irinakoiw (Iroquois) comprises a Confederation Body Politic of Moorish Tribes of the Northwest Territories, comprised of the Noble Titles, (Ali, Bey, El, Dey, and Al) of the Noble Moors. Irinakoiw is not a single Aboriginal 7ULEHDQGPHDQVµ7KH 5HDO$GGHUV¶&RQFHUQLQJWKHGHULYDWLYHFRQWHPSRUDU\8QLRQ The Articles of Association; The Articles of Confederation; The Declaration of Independence; and the Constitution for the United States Republic of North America (1789) has its origin from Ancient Moorish &RQVWLWXWLRQ3ULQFLSOHVDQGGHULYHGIURPµ7KH/DZ RIWKH*UHDW3HDFH¶7KLVVRFLDO / political History and Law connection is also why the DQFLHQWµ*UHDW6HDO3\UDPLG¶LVGLVSOD\HGXSRQWKH back of the Dollar Bill. The Great 6HDO3\UDPLGLVWKHµ,QVLJQLD¶RIWKH0RRULVK1DWLRQ- The Moroccan E mpire. In many of the Long Houses of the Irinakoiw, the Europeans were taught Masonry, which is ³6FLHQWLILF0RUDO*RYHUQPHQW´ 35. W hat is the oldest L anguage on E arth? A nswer: The oldest language known on Earth is Classical S anskrit (S a mskrita) which fostered the modern science of Descriptive Linguistics or Etymology. The multiple µ3UDNULW¶ dialects are found prevalent in the Ancient Maurian Dynasty of Old Perot (Hindustan), including many geographical areas having Sumerian influence. These ancient natural peoples are Moors. 36. W as so-called W hite people slaves first to Black People (Moors) and when they came fought for their F reedom did W hite people turn around and made slaves of all the so-called Black people or all people and erase most of their story in H istory? A nswer: The Android / Hybrid OffspringRU³&KLOGUHQRI<DFXE´- referred to modernly as, -DFRE DUH 3DOHROLWKLF PDQ (XURSHDQV 7KH\ ZHUH ODWHU FDOOHG ³7KH &KLOGUHQ RI ,VUDHO´ EHFDXVH <DFXE¶V QDPH ZDV FKDQJHG WR ,VUDHO E\ 0XXU -Lu-Akin-El, the last High Priest Scientist of the Moabite Nation, Ancient Central Africa (Central $PHUX$PHULFD 7KHµ+\EULG $QGURLG¶µ&KLOGUHQRI,VUDHO¶ZHUHGHFUHHGWREH slaves of Babylonia Moroccan E mpire for three hundred, sixty years (360), from 836 $0WR$0DQGDEVHQWRIµ,VRQRPL5LJKWV¶ by Ha mmurabia Bey, the first Sultan of the Moorish Nation Moroccan E mpire of Ancient Central Africa / Central America. $QGWKLVLVWKHWUXHKLVWRULFDOEDVLVRIWKHµ.DUPLFEUHDFK¶ that is the origin or root of the hostile (so-called race-caste politics) of the modern day world. These chronologies (dates) correspond to 1416 and 1776 C.C.Y. Therefore, it is without doubt that the Moors must be told the truth of the Masonic History of themselves. 97 37. How did E urope or E uropeans conquer the World? A nswer: Consider the preceding hidden history, and follow the war records of the world; even up to the Major World War that was considered as the most influential event to propel the Christian World into power. This is not to dispel or to diminish the Crusades or the latter µ%DWWOHDW*UDQDGD7KHEDWWOHLQTXHVWLRQZDVµ7KH%DWWOHRI 7RXUV¶QHDU3RUWLHUH)UDQFHLQ the year 732. This pivotal battle (sometimes minimized in history) conjoined with apparent divisions and power struggles raging among the ruling Moors, spurred the later successes of Christendom against the Moslem Moors at Cordoba and Granada, Andalusia (Spain), in 1492. This is why the year, 1492 is used by scholars the of the world, to mark the axis year between Ancient History and Modern History - The Old World (The Moslem Moors), and The New World (The Christian European Beginnings as a World Power). 38. W hat happen to all the E mpires like the Romans, T he Moors, T he Persians, T he C hinese, T he Spaniards, T he B ritish etc., and how did they all F all? A nswer: The interesting thing about repeated conquests and colonization a mong the human family is that the ultimate outcome converges into blending and conjoined interests. Thus, the varied shades of skin complexion, and a distortion of World History by way of deletions, name brands, book burnings, and oppression of the defeated Moors. If one does not have a reasonably well-rounded background study in World History, Law, and Linguistics, ignorance sets in. Most of the failures of these former E mpires can be traced to corruption, invasions, FRQTXHVWV DQG YLRODWLRQV PDGH DJDLQVW 1DWXUH¶V Laws. This self-destructive anomaly (inhumane activities) includes the debilitating practices of Idol-God worship, the suppression of women, Dogmatism, Despotism, and Human Caste Systems. 39. W hat is a Race, and are there 5 Races or just the H uman Race? A nswer: 7KHUH LV EXW RQH µ5DFH¶ DQG WKDW LV WKH +XPDQ 5DFH 7KH +XPDQ 5DFH KDV expanded into a multitude of F amilies, which are universally known as, Nations and Nationalities. The 5 Race categories or sub-divisions were contemporarily constructed by European Sociologists and Anthropologists for colonial caste system purposes. Yet all social Scientists and Anthropologists are well aware of the fact that all of these so called races have one human-race origin²¶7KH 0RDELWH :RPDQ¶ ZKR KDV EHHQ VRFLRORJLFDOO\ cast in modern KLVWRU\DV³7KH$IULFDQ:RPDQ´ 40. W hat is the New World O rder and what was the O ld World O rder? A nswer: The New World Order is the unavoidable acceptance of, and ushering in of, µ5LJKW-/DZ0RUDO*RYHUQPHQW¶DQGµ,VRQRPL3ULQFLSOHV¶DVZHUHFRGHGDQGHPEHGGHG within the Ancient-derived Constitution for governance of the United States of North America; having its origin from Ancient Moabite / Moorish Cosmology Culture. The Old World Order refers to the High Culture Principles of Moral Government, that fell into the hands of the Peregrinus, conquering Christian Crusaders, and also, spurred by the destabilizing, and excruciating 98 destruction caused by Idol-God worship, the suppression of women, and human²caste SUDFWLFHVWKDWGHOXGHWRµVODYHU\¶6LQFHWKHVH violations of Divine Law have not been properly addressed and resolved, the fate of the present-GD\µIDOO¶RIWKLVFRUUXSWDQGPLVFUHDQWµ6RFLDO 2UGHU¶LVQRZLQLUUHYHUVLEOHHII ect. :KDWLVFRQVLGHUHGµ2OG¶LVRQO\EHLQJUHQHZHGRUµERUQ DJDLQ¶. 41. W hat are the 500 Nations of the A mericas before Columbus? A nswer: The so-called 500 Nations in the Americas (North, Central and South) are essentially the expressed and divided tribes of Aboriginal full-bloods, mixed and amalgamated Moabites / Moors / Muurs of Ancient Amexem. These Aboriginal and Indigenous natural peoples maintained a Matriarchal form of Government, and were misnamed as, Indians by Christophero Columbo and other European explorers, who thought these geographical regions were a part of the continent of Asia. 42. W ho is K ing Juba and what is his relationship to the A mericas? A nswer: Juba (Yubah) is a Chieftain or Sheik, known a mongst the defeated Moors of Northwest Africa, who have traditionally been referred to in history as, slaves in North $PHULFD+HZDVDVVRFLDWHGZLWKWKHµ*RRG-VSHOO¶V\VWHPRIPDWKHPDWLFDOUK\WKPLF song and dance, used for transmitting messages of military and freedom planning strategies. Other banned forms of communication were veiled within song and dance, and popularized during the mid-1800. This clever system efficiently moved suppressed messages and information among the people, and was later adopted into rhythmic song and dance church culture. Yubah has lost its original form, and is now called, Gospel (Good-Spell). The Good± 6SHOOVZHUHµFDOOHGXSRQ¶ µLQYRNHG¶ DQG µSRXUHG RXW¶ WR FRXQWHU WKH µ%DG-VSHOOV¶ RI WKH VODYH-PDNHUV¶ SURSDJDWHG Christian Dogma, inhumane treatment, and forced servitude. Yubah is also the name of the long, open coat garb which was worn by the Muurs / Moors and other Yehudi and Moslems of the Old World. The celebrative dance and activities that have relationship and origin with the Natural Peoples of the Land (Americas) have EHHQWUDGLWLRQDOO\FDOOHG³<XEDOL´ZKLFKLVRIWHQ NQRZQE\WKHPLVSURQRXQFHGZRUGµ-XELOHH¶ 43. W ho discovered the A mericas? W as it the A fricans, C hinese, V ikings, Columbus, A merigo Vespucci or was it always here with millions of People already living there? A nswer: The whole scenario and story of the great Columbian Discovery, etc., is a total fraud and myth. Columbo never set foot on the mainland of Northwest Africa / North America. He was deliberately diverted to the Atlantis Islands, by Pedro, the Moor, ZKRZDVWKHµFDSWLYH¶ Amir Al (Admiral) and assigned to aid in navigating the Nino. 99 44. Do we H umans come from A pes, F ish, or T he A dam and E ve or E ve then A dam or is it all a Bullshit story and we all came from E xtrater restrials so-called A liens? A nswer: 1R 7KH 2ULJLQDO +XPDQ KDV QR RULJLQ IURP $QWKURSRLGV RU )LVK ³$GDP and (YH´LVD&RVPR-Prophesy Code for the first-born of the Hybrid Offspring from the ³*DUGHQRI (GHQ´ $QFLHQW &HQWUDO $IULFD &HQWUDO $PHULFD²Pyra mid University at the Yucatan Peninsula. Adam and Eve were not the first humans. Adam and Eve are the European / 3DOHROLWKLF µJHQHWLF¶ EHJLQQLQJV RU ³0RGHUQ 0DQ´ ZKR DOVR LV NQRZQ DV ³7KH 7URJORG\WH Niger, and the Cave Man. And yes, some of the scientific technology XVHG LQ WKH ³,EULGa ([SHULPHQWV´ DW ³3LHGUDV 1HJUDV <D[FKLODQ 6FLHQWLILF &RPSOH[´ was both terrestrial and extraterrestrial. 45. W ho is Q ueen C alifa where C alifornia gets its name from and what is her story to the A mericas? A nswer: Khalifah was a Moabitess / Matriarch²the Spiritual and Temporal Ruler and Law² Giver of the geographical E mpire Territories now known as California and parts of Nevada. California was named for her. The Royal Moorish ruler-ship title, her name relates to Caliphal and Caliph. She also proved to be one of the most ardent Queen Warriors against encroachment by Europeans into the Territories under her rule and protections. She is known to have inflicted many costly victories over European Colonial armies. 46. W hat is a Straw-man versus a Natural Being? A nswer: It must be understood that there are two (2) types of person at Law. One is the µ1DWXUDO 3HUVRQ¶ ZKLFKLV WKHOLYLQJEUHDWKLQJ WKLQNLQJELRORJLFDOFUHDWLRQEHLQJ born of natural birth, by a living, breathing, thinking, biological, human Mother. The RWKHUµ3HUVRQ¶LV Dµ&RUSRUDWLRQ¶ZKLFKLVDµ/HJDO)LFWLRQ¶RUµ$UWLILFH¶FUHDWHGE\OHJDO process, the pen, and E\/DZRQSDSHU7KLVLVD³0DQ²of²6WUDZ´RU³6WUDZPDQ´ A Straw-man is also a weak or imaginary opposition (as an argument or adversary) set up only to be easily refuted; being a µSHUVRQ¶ VHW XS WR VHUYH DV D FRYHU IRU XVXDOO\ TXHVWLRQDEOH WUDQVDFWLRQV 7KH ³6WUDZ-man 3HUVRQ´LVZULWWHQLQ$//&$3,7$/ LETTERS. 47. W hy today all A mericans are suffering? A nswer: The true Americans (Al Moroccans) have, and are, suffering for past Kar ma, involving some results of miscalculated aspects of tampering with Nature and 1DWXUH¶V/DZV The present American state of affairs involves both a dissolution of the past Karmic Debt, (Ibrida Experiments, +DPPXUDELD %H\¶V 'HFODUDWLRQ RI JHQHUDWLRQ servitude upon the ³&KLOGUHQRI,VUDHO <DFXE ´DGRSWLQJ,GRO-God Worship; the radical changes caused by the 1HZ $JH $ZDNHQLQJ RI WKH ³3ULPRJHQLWXUH +HLUV $SSDUHQW´ (Moors), and the ensuing confusion and hatred caused by a lack of knowledge, due WR ,QTXLVLWLRQLVW¶V¶ SDVW ERRN burnings, mis-education, sociological and political mis-concepts, Misprision, government corruption, Constitutional treason by the monopoly ruling µ:KLWH6XSUHPDF\1HWZRUN¶DQGWKH 100 gradua WLQJ FROODSVH RI WKH µ&RORU-of-$XWKRULW\¶ µ&RORU-of-/DZ¶ $GKHVLRQ-Contract Fraud practices, the fall of pseudo religion; and the accelerated rate and rise of knowledge and intelligence among the once ignorant and suppressed natural peoples of the planet. 48. W hat is T he F all of A merica? A nswer: 5HIHU WR µ5HWULEXWLRQ -XVWLFH¶ DQG WKH DQVZHU JLYHQ LQ TXHVWLRQ QXPEHU However, America is not falling. America is the terrestrial Land ²being North, Central, South America, and the adjoining Islands²Land of the MooUV ³7KH *UHDW )DOO´ LV properly, the GLVVROXWLRQDQGFROODSVHRIWKHFRUUXSW³(XURSHDQ+HJHPRQ\RI:KLWH6XSUHPDF\´ and of their debased dominance over the Moorish E mpire. In other words, the 0RRUVDUHEHLQJµ5HGHHPHG¶ DQGDUHEHFRPLQJDZDUHRI³7UXWK´DQGRIWKHLU³*UHDW /RVW(VWDWH´- End Ga me! 49. W ho are T he F reemasons and what is their H istory to A ll of T he A mericas? A nswer: F reemasonry is a F raternal Order, which is world-wide, and is essentially an institution which preserves key knowledge parts of true Human History, Anthropology, Philosophy, Religion / Cosmology / Metaphysics, Mathematics, Science, Liberal Arts, World History, Spiritual Geometry, Jurisprudence / Law, Moral Government, Astrology, Alchemy, and the Potentate Powers of the Planet, Earth, etc. F reemasonry is ³0RRULVK6FLHQFH´YHLOHGDQG held secret for the purpose of empowering the few, at the injury, enslavement, and promoted ignorance of the masses. Knowledge is Power, and if the ignorant masses chance to encounter µ7UXWK¶WKH\ZLOOLQdeed, become free! The suppressed Knights Templars, Knights Hospitalers, and the Teutonic Knights, were founded during the Christian Crusades, including most of the European Orders; and were blended into the Masonic Orders of North America during the mid1¶V² approximately 1859. 50. W ho Rules Planet E arth today or is it really a secret? A nswer: Masons rule the Planet, Earth; now fronted by Patriarchal European Christian &UXVDGHUVRIWKH&KXUFKRI5RPH 5RPDQV ZKLFKPHDQV³5HG0HQRIWKH 5RWKVFKLOG´ 5HG Shield) . 51. How do we eat to live? A nd who will survive the coming of H ell on earth from the cleansing of Mother Nature a living God? A nswer: Go back to those knowledge and Culture Principles of your Ancient Fore-Mothers and Fore-F athers, and re-learn those disciplines and earth sciences that comprise Ancient Moabite / Moorish Science and high Culture Cosmology. Within the context of your travels and studies, you will re-OHDUQWKHNQRZOHGJHDERXWWKH³6DOWVRIWKH (DUWK´\RXURZQFRQVWLWXWLRQ (make²up), and what natural foods are good for you, or bad for you. You will learn those things necessary to live a healthy life, or, you may choose to cause injury by violating the body with substances that harm. Within the studies of the oldest science on the planet, involving the PDVWHU VWXGLHV RI WKH µ:RUNLQJ RI 1DWXUH¶ FDOOHG $VWURORJ\ \RX ZLOO GLVFRYHU WKH IRRG VWXIIV 101 that apply to your energy, thus you will take action as the original man (so-called Gods) of the earth. The word, God is a contemporary word; is a Verb Transitive, being Germanic in origin; arriving into language in the Medieval Period, about the 5th Century and should not be artificially injected retroactively into Ancient History. The word, god, is an action word, and is not, in its original form, a noun. Thus it is wise to take action as the original man of the earth DQG UHPHPEHU WKDW ³PDQ LV PLQG DQG WKHUH QHYHU ZDV D WLPH ZKHQ PDQ ZDV QRW´ <RXU H[LVWHQFHLQWKHµJDUERIIOHVK¶LQWKHUHDOPRIHDUWKUHTXLUHV\RXWRSDUWDNH in the fruits of the earth for sustenance and maintenance of your body, your Temple, while in the physical form. Mother Earth provides for you. Peace, Prosperity, and Progress. ² Brother Taj Tarik Bey Note from Universal Zulu Nation: T hese are just some of the questions to be answered at T his G reat A boriginal / Indigenous Conference that you do not want to miss. So spread the word, and remember to bring your questions to ask all the great panelists that will be speaking at this G reat E vent. B ring out all your family and T eachers, 6WXGHQWV IROORZHUV HWF DQG OHW¶V JHW GRZQ WR some UHDOVHULRXVTXHVWLRQVDQGDQVZHUV/HW¶VWU\WREULQJ dignity and unity back to all of our communities. T he L ies must be destroyed, and F actology must Rise over so-called T ruths. 102 -+6-+-&7!1(//#+!/-C&((+8!"(+H03-+!"0++0!$0! Introduction %DQQD.D¶V)DPLO\+LVWRU\ As one searches through the pages of Black History, seeking information on blacks who made great contributions to our history, from time to time, one will stumble upon information that does more than educate, but actually enlightens. The TRUE story of Benjamin Banna Ka and his Family History will not only enlighten the reader, but will change our knowledge and perspective on American History and the Foundation of the Federal Government forever. 6SHFLILFDOO\ WKLV PDWHULDO SURYLGHV D FOHDU IRXQGDWLRQDO NQRZOHGJH RI WKH 8QLWHG 6WDWHV¶ principal historical cities and their founding; Philadelphia and Washington D.C. %HQMDPLQ %DQQD .D¶V JUDQGPRWKHU¶V QDPH LV JLYHQ DV 0ROO\ :DOVK %DQQD .D¶V grandmother, Molly {Pronounced: MAHL-ee} Welsh has been said by many authors, who write about the history of Benjamin Banna Ka, to be white, but we will find that this is incorrect and that the authors who make this claim [that Molly Walsh Banna Ka was white] provide no HYLGHQFH 7KHVH DXWKRUV PDNH WKHLU JXHVV ZRUN EDVHG RQO\ RQ WKH IDFW WKDW %DQQD .D¶V grandmother was from the Welsh [Wales] province of Britain. History will show us that the Black Moors of Islam had a tremendous impact in Wales and Great Britain during the time that %DQQD.D¶VJUDQGPRWKHU>0ROO\@ZRXOGKDYHEHHQOLYLQJWKHUH$OVRWKHUHFRUGVRI%DQQD.D¶V own almanac prove in words that Molly Walsh Banna Ka was a Black African, which at the time proves she was of Moorish lineage. The importance of this history will demonstrate the influence of the Moors in England and America and on the founding of the American Government. Molly Walsh was an indentured servant. After being relieved of her seven [7] year duty of indentured serYLFHLQWKHODWH¶V0ROO\:DOVKSXUFKDVHGDIDUPDQGODWHUWZRVR-called VODYHVLQWKHODWH¶V+HUIDUPZDVDORQJWKH3DWDSVFR5LYHUQHDU%DOWLPRUH2QHRIWKHVRFDOOHGVODYHVQDPHGµ%DQQDND¶ZDVVRQRID0RRULVKFKLHIWDLQ0\ER\DZDVWKHQDPHRf the other man that Molly aided to freedom. Molly after freeing both men married Bannaka. Their ILUVWFKLOGµ0DU\¶ZDVERUQDSSUR[LPDWHO\7KH%DQQDND¶VKDGWKUHHPRUHGDXJKWHUV Just as her mother had done, Mary Bannaka married a Black Man from Africa, whose original name is unknown. He carried the name Robert. He was allegedly from Guinea and DUULYHGLQ$PHULFDLQ+H>5REHUW@WRRNWKHIDPLO\VXUQDPH³%DQQD.D´%HQMDPLQ%DQQD Ka was born on Nov. 9, 1731 as a free black man. His name was later changed to Bannaker, DOOHJHGO\E\4XDNHUVFKRROWHDFKHUV%HQMDPLQ¶V*UDQGPRWKHU0ROO\KDGDKXJHLQIOXHQFHRQ KLVOLIH³8VLQJWKH%LEOH0ROO\%DQQD.DWDXJKWKHUGDXJKWHU0DU\ VFKLOGUHQWRUHDG Due to their knowledge of Astronomy, farming, irrigation, and herbology, life was good to the Banna Ka family. Young Benjamin learned to play the flute and the violin, and when a Quaker school was opened in Bannaky springs Benjamin attended it during the winter. 103 BANNA KA THE SCIENTIST Benjamin took over the family farm at the age of 15. He devised an irrigation system of ditches and little dams to control the water from the springs (known around as Bannaky Springs) on the family farm. Their tobacco farm flourished even in times of drought. At the age of 22, in 1753, he created the first wooden striking clock in America. %HQMDPLQ %DQQD .D KDG WDNHQ D ZDWFK DSDUW WR VWXG\ LWV ZRUNLQJV¶ %DQQD .D WKHQ FDUYHG similar watch pieces out of wood to make, in 1752, a wooden clock. Due to its precision it struck every hour, on the hour, and continued to do so nearly forty years. The clock brought fame to young Banna Ka. Benjamin Banna Ka began a watch and clock repair business. Although most authors say Benjamin Banna Ka got his first watch from a Josef Levi, there is no historical record of a Josef Levi connected to the watch Banna Ka had in his possession, which he used to design his wooden clock. %HQMDPLQ¶VFORFNODWHULQIOXHQFHGDIDPRXV0DU\ODQGHUWKHLQGXVWULDOLVW-RVHSK(OOLFRWW to build a complex clock. Banna Ka was taught mathematics and astronomy by his grandmother who learned it IURPKLVJUDQGIDWKHU%DQQD.D+HEHFDPHVXFKDQH[SHUWLQWKHVXEMHFWVWKDW³KHVXFFHVVIXOO\ predicted the solar eclipse that occurred on April 14, 1789, contradicting the forecasts of SURPLQHQW PDWKHPDWLFLDQV DQG DVWURQRPHUV RI WKH GD\´ ,W LV VDLG WKDW RQ PDQ\ QLJKWV KH would wrap himself in a great cloak and lie under a pear tree and meditate on the revolutions of the heavenly bodies. He would remain there throughout the night and take to his bed at dawn. As we shall see, this type of activity that Banna Ka participated in was based on His family lineage and the information and knowledge that was passed down to him. SURVEYING WASHINGTON D.C. As reported in a newspaper called the Georgetown Weekly Ledger March 12, 1791, when Banna Ka was 60 years old, he was appointed, by President George Washington, to a three-man WHDP RI VXUYH\RUV KHDGHG E\ 0DMRU $QGUHZ (OOLFRWW -RVHSK (OOLFRWW¶V FRXVLQ WR VXUYH\ WKH future District of Columbia. 1791 was a very good year for Benjamin Banna Ka. At the age of 60, he surveyed the boundary for the Federal Territory in what is now Washington DC. Benjamin Banna Ka: surveyed and laid out a 10-mile square area. When the architect initially in charge of the project, Pierre L'Enfant was fired by George Washington due to his alcoholism, poor intellect, and extreme temper, Washington contacted Banna Ka. What Banna Ka did afterwards after it is revealed in this material will go down in history forever. /¶(QIDQW KDG EHHQ D IULHQG RI WKH IDPRXV *HQHUDO /DID\HWWH DQG WKH KLULQJ RI WKH )UHQFKPDQ/¶(QIDQWRQO\RFFXUUHGEHFDXVHRIKLVIULHQGVKLSZLWK*HQHUDO/DID\HWWH2QFHKLV 104 µEDG KDELWV¶ ZHUH GLVFRYHUHG DQG VHHQ DV D GHWULPHQW WR WKH SODQQLQJ RI :DVKLQgton D.C. /¶(QIDQW ZDV GLVPLVVHG &RQWUDU\ WR SRSXODU WKHRU\ %DQQD .D GLG QRW ZRUN ZLWK / (QIDQW Banna Ka returned home in April 1791. L'Enfant was appointed in March 1791 to a different job and worked it until March 1792. They never met and Bannaker would never have seen / (QIDQW V SODQV%HQMDPLQ %DQQD .D ZDV DEOHWRSODQWKH µ&LW\ RI :DVKLQJWRQ¶ EDVHG RQDQ ancient astronomical science. The layout of Washington D. C. is and the City of Philadelphia is a master universal clock that accurately demonstrates when the New Year of the Egyptians RFFXUUHG DQG GHWDLOV DQ HYHQW FDOOHG µ3ROH 6KLIW¶ 7KDW VDPH \HDU KH DOVR FDOFXODWHG WKH µHSKHPHULV¶IRUKLVDOPDQDFV- years 1792-1797. Pole Shift will be discussed later in this text. A LETTER TO JEFFERSON: In 1792 Benjamin Banna Ka wrote to Secretary of State of the United States Thomas Jefferson. Thomas Jefferson, as Secretary of State at the time, was well respected nationally. His activities and words also prove he was a white supremacist and slave owner. He pronounced that Black people were mathematically inferior, in addition to several other inferiorities. Benjamin Banna Ka sent a copy of his almanac along with a twelve page letter to Secretary of State Thomas Jefferson reprimanding him on his character and perspective on Black People. Banna Ka himself knew above all He himself was the witness of the foolishness of the thought in Jefferson of the inferiority of Blacks, as Banna Ka, a Black Man, was primarily responsible for designing the federal city that was WKHIRXQGDWLRQRIWKHµVPDOOZKLWH 1DWLRQ¶FDOOHGWKH8QLWHG6WDWHVRI$PHULFD 7KRPDV-HIIHUVRQ¶VTXRWHDERXWWKHLQIHULRULW\RI%ODFNVLVXVXDOO\DFFXUDWHLQFRQWHQWDV given by most authors, but not in source and time frame [as given by most authors]. -HIIHUVRQ¶V quote on the inferiority of Blacks does not come from the year 1792 when he was Secretary of State. It is a written quote from his "Notes on the State of Virginia" which was published in 1781 and 1782. Specifically the quotes on the alleged inferiority of Blacks can be found in a VHFWLRQFDOOHGµ4XHU\¶RI-HIIHUVRQ¶VQRWHV7KUHHPDLQSDUWVRIKLVTXRWHVSURYH-HIIHUVRQ was a complete white supremacist despite the fact that He knew a Black Man [Banna Ka] had designed the Federal City because no one else had the mathematical and astronomical knowledge to do so. Here they are, Comparing them by their faculties of memory, reason, and imagination, it appears to me, that in memory they are equal to the whites; in reason much inferior, as I think one could scarcely be found capable of tracing and comprehending the investigations of Euclid; and that in imagination they are dull, tasteless, and anomalous. It would be unfair to follow them to Africa for this investigation. We will consider them here, on the same stage with the whites, and where the facts are not apocryphal on which a judgment is to be formed.3 Jefferson in his own words calls Black People inferior in reason to white people. He states that Black people are dull of imagination, tasteless, and anomalous. 105 The improvement of the blacks in body and mind, in the first instance of their mixture with the whites, has been observed by everyone, and proves that their inferiority is not the effect merely of their condition of life.4 Here Jefferson makes the suggestion that race mixing makes Blacks smarter people and that it was not the condition of slavery that impacted the intellectual capacity of Black People. To our reproach it must be said, that though for a century and a half we have had under our eyes the races of black and of red men, they have never yet been viewed by us as subjects of natural history. Advance it therefore as a suspicion only, that the blacks, whether originally a distinct race, or made distinct by time and circumstances, are inferior to the whites in the endowments both of body and mind5. Jefferson sums up his sick thoughts by stating clearly that he believes his race [white people] to be superior to Black People physically and mentally. Historically there have been statePHQWV PDGH E\ DXWKRUV WKDW %HQMDPLQ %DQQD .D¶V IDPRXVµOHWWHUWR-HIIHUVRQ¶ZDVVSHFLILFDOO\LQUHVSRQVHWRWKHVHTXRWHVIURP-HIIHUVRQ7KLVLV also not correct. Banna Ka's letter was sent in 1791, about 10 years after Jefferson wrote the words that we prHYLRXVO\ FLWLHG ,W LV FOHDU WKRXJK WKDW -HIIHUVRQ PXVW KDYH NHSW WKLV µZKLWH VXSUHPDFLVW¶SRVWXUHXSSXEOLFO\XQWLOWKHWLPHWKDW%DQQD.DUHVSRQGHGLQUHSULPDQGLQJ him about his thoughts towards Black People. %HQMDPLQ%DQQD.D¶VOHWWHUSROLWHO\UHIXWHG-HIIHUVRQ¶VSRRUSRVWXUHWRZDUGVKLPVHOIDQG other blacks and spoke on the responsibility of white Americans as a Christian Nation and those seeking freedom of improving the conditions for Black people by abolishing slavery. The letter has continued to remain an important document in Black History. The letter ended with; ³,VXSSRVHWKDW\RXUNQRZOHGJHRIWKHVLWXDWLRQRIP\EUHWKUHQLVWRRH[WHQVLYHWRQHHGD recital here; neither shall I presume to prescribe methods by which they may be relieved, otherwise than by recommending to you and all others, to wean yourselves from those narrow prejudices which you have imbibed with respect to them, and as Job proposed to his friends, µSXW \RXU VRXO LQ WKHLU VRXOV VWHDG WKXV VKDOO \RXU KHDUWV EH HQODUJHG with kindness and benevolence towards them; and thus shall you need neither the direction of myself or others, in ZKDWPDQQHUWRSURFHHGKHUHLQ¶ And now, Sir, although my sympathy and affection for my brethren hath caused my enlargement thus far, I ardently hope, that your candor and generosity will plead with you in my behalf, when I make known to you, that it was not originally my design; but having taken up my pen in order to direct to you, as a present, a copy of an Almanac, which I have calculated for the VXFFHHGLQJ\HDU,ZDVXQH[SHFWHGO\DQGXQDYRLGDEO\OHGWKHUHWR´ Benjamin Banna Ka published a treatise on bees, did a mathematical study on the seventeen-year locust cycle, and became a pamphleteer for the anti-slavery movement. 106 BENJAMIN BANNA KA: The Black Sage! Benjamin Banna Ka is among many people who have had their true histories distorted by ZKLWH KLVWRULDQV RI $PHULFDQ +LVWRU\ +H ZDV FDOOHG µWKH EODFN VDJH¶ HYHQ E\ ZKLWHV RIWKH WLPH %HQMDPLQ %DQQD .D¶V LQIOXHQFHRQ WKHEXLOGLQJ Rf the American Nation is tremendous. He has been written off in history as a simple clock maker, and a man with a good memory, however he was much more than that. Our watches prove this fact. First we must make it as clear as possible that Benjamin Banna Ka was black, and as he put it in his RZQZRUGVRIWKHµGDUNHVWDQGGHHSHVWG\H In a letter to Thomas Jefferson Banna Ka stated, ³6LU,IUHHO\DQG&KHDUIXOO\DFNQRZOHGJHWKDW, am of the African race, and, in that colour which is natural to them of the deepest dye; and it is under a Sense of the most profound gratitude to the Supreme 5XOHURIWKHXQLYHUVH´ The only newspaper known to have mentioned %DQQD.D¶VUDFHZDVWKH*HRUJH7RZQ:HHNO\ /HGJHUZKLFKFDOOHGKLPµDQ(WKLRSLDQZKRVH abilities as a surveyor and astronomer clearly prove WKDW0U-HIIHUVRQ¶VFRQFOXVLRQWKDWWKLVUDFHRIPHQ were void of mental endowments was without IRXQGDWLRQ´ 107 MOLLY WALSH BANNA KA %(1$-$0,1%$11$.$¶V*UDQGPRWKHU 0ROO\:DOVK%HQMDPLQ%DQQD.D¶Vgrandmother is said by most authors to have come from the Wessex County province of Wales, thus she carried the name Welsh or Walsh from the area that she lived in. Here is a map of Wales Great Britain and Ireland. Wales [The Welsh Province] is situated to the South West of England. Our point in highlighting this information is to show the geography of the area to support our claim made that Molly Walsh Banna Ka was not white but black and a Black Moor or Muslim. Our first proof comes directly from BenMDPLQ%DQQD.D¶VRZQDOPDQDFZKLFKZDVSXEOLVKHGLQLQ Philadelphia. The commentary is a biographical note about Banna Ka from the publisher. It states, ³%$/7,025($XJXVW Benjamin Bannaker, a free black, is about fifty-nine years of age; he was born in %DOWLPRUH&RXQW\KLVIDWKHUZDVDQ$IULFDQDQGKLVPRWKHUWKHRIIVSULQJRI$IULFDQSDUHQWV´ Indentured Servant Molly Walsh is said to have been an indentured servant. The histories of most researchers make the conclusion that Molly must have committed some violation of the law that created a VLWXDWLRQRIKHUKDYLQJWRZRUNRIIDGHEWWRVRFLHW\LQRUGHUWRVXSSOHPHQWµSXQLVKPHQW¶IRUKHU FULPH+LVWRU\VKRZVWKDWWKHWLPHSHULRGLQWKHODWH¶VLQWKHDUHDVRI:DOHVDQG(QJODQG 108 had great impact from the Black Moors of Islam. History also proves that Black People have an ancient presence on this island [See David MacRitchie Ancient & Modern Britons Volume I & II]. For authors to assume that Molly was white because she was from England is incorrect. During the late 1600s the whites of England were not very advanced in their agricultural abilities. Most of the population was still illiterate. Molly proved too be both advanced in agricultural and herbal knowledge as well as a reader. It is interesting that she had no other family with her that is mentioned in history, no mother, no father present, and no brothers or sisters. None are mentioned. The conflicts between the Moors and the white English during this time period and the descriptioQRI0ROO\¶VKLVWRU\SURYHFOHDUO\WKDWVKHKDGWREHDEODFNZRPDQ+HUQDPHZDV Molly. Molly was not a common name in England or Europe during the 17th Century. The QDPH 0ROO\ LV VWULNLQJO\ VLPLODU WR WKH QDPHV RI WKH %ODFN 0RRULVK $IULFDQ .LQJV µ0XOH\¶ 7KLVWLWOHPHDQWµ/RUGRU5XOHU¶:KLWH,WDOLDQVWRGD\VWLOOXVHWKHµZRUG¶DVDQLQVXOWE\VD\LQJ \RX I¶LQJ 0XOH\ 7KLV GLVJXVW ZLWK WKDW QDPH LV GXH WR WKH SRZHUIXO %ODFN 0RRULVK $IULFDQ influence [in respect to the religion of Islam] that occurred throughout Europe. This was hated by white European men and they admitted this in their own records. Molly and Muley are the same word. Molly is also striking similar to Mali, an empire of the Black Moors of Islam in Africa. Mali is the empire that the so-called Dogon are in and would have been in during this time period. They were called Mandinke [Mandingo] and were Black Muslims. This is the area ZKHUH0ROO\¶VKXVEDQGZDVIURPZKRPVKHSXUFKDVHGJDYHKLPKLVIUHHGRPE\GRLQJVRDQG them married him. In fact, Molly and her daughter by her husband Banna Ka decided to purchase another so-called slave from Africa so that Mary could have a husband from Africa. This man was the father of Benjamin Bannaka So by investigating the facts we can see that Molly had a special affection for Africa. Her name and the general activity of her life demonstrates this, as well as her ability to read, and know agriculture, and herbology,. T he Moors in W ales and E ngland Author Nabil Matar in his book Islam in Great Britain 1558-1685 speaks of the impact of the Black Moors on Great Britain in these words, ³The Turks and Moors of North Africa and the rest of the Ottoman [Musli m] dominions were spreading alarm in England, Wales, and elsewhere in the British Isles, especially a mong ILVKHUPHQ VDLORUV WUDGHUV DQG WKH /HYDQW &RPSDQ\¶V UHSUHVHQWDWLYHV LQ 3DUOLDPHQW« 7KH QHZVDERXWWKH7XUN¶VLQFXUVLRQVZURWH6LU1LFKRODV6ODQQLQJWR6LU)UDQFLV9DQHLQ6HSWHPEHU ³WHUULILHVWKHFRXQWU\´7KHUHZDVVRPXFKFRQFHUQDERXWWKH7urkish attacks and about the fate of English captives that in December 1640, a committee for Algiers was appointed by 3DUOLDPHQWZKRVHPDLQWDVNZDVWRRYHUVHHWKHUDQVRPLQJRI(QJOLVK&DSWLYHV´ We can see here the mention of the impact of the Moors [Black Muslims] and Turks [Arabs] on Wales and England. Islam was having a great impact on all of Europe. Nabil Matar verifies this by stating, 109 ³7RPDQ\%ULWRQVWKH0XVOLPVSRVHGDGDQJHUWRDOORI&KULVWHQGRPIURP*UHHFHWR (QJODQGDQGIURPµ0XVFRY\´WR,UHODQG´ The impact of the Black Moorish and Ottoman Empires of the Muslims was so great that Peace Treaties were established between The Black Moorish African Empire and Great Britain in 1578, 1662, 1666, 1721, 1728, and 1751. These treaties were generally for the protection of citizens of both empires, for trade, and for the payment of tribute to the Black Moorish African Empire for protection of Great Britain from invasion, particularly from the Arabs [Turks]. African Moors attacked white European ships ± including those of England and Scotland ±often in retaliation to attacks on Moorish and Turkish ships and the enslavement of Muslims in Italy, Spain, Malta, and England12. This is documented in a book by Sir Godfrey Fisher called µ%DUEDU\/HJHQG¶. *The true problem that existed for the whites in England was the large numbers of converts that Islam was making in Europe. These converts were from the areas of England, Scotland, Ireland, and Wales. History proves that the white Britons wrote about the large conversions themselves. (QJODQGDQG:DOHVZHUHSODFHVRISRYHUW\DQGGLVHDVHGXHWR&LYLO:DULQWKH¶V,Q history this activity in England was called the English Revolution. This revolution that took place had the impact of the Black African Moors and Turks of Islam at the root of its cause. The Muslims were winning the English citizens over as converts to Islam. Christopher Hill writes DERXWWKLVUHYROXWLRQLQKLVERRN³7KH&HQWXU\RI5HYROXWLRQ´0DQ\RIWKH%ODFN0RRUVZKR were captured who were agriculturalists and herbalists were used as servants and made farms for the Europeans who were not an agricultural society and who were suffering from disease. Molly Walsh Banna Ka was one of these servants. With no record of a legitimate name or lineage, it would make sense that Molly was a foreigner to the area. After the Treaties were PDGHLQWKH¶VLWZRXOGPDNHVHQVHWKDW0ROO\DVD%ODFN0RRUZRXOGEHSDUGRQHGDQG sent to America to work for the benefit of the British Crown for seven [7] years and then be freed, as opposed to being returned to her homeland in Africa, which would have definitely been the case if she had been found by or made contact with other Moors, who were ever present in the area. The ascension of Muley Rashid to the throne in Morocco in 1666 and the treaties made at that time and the presence of Muslims on the isles would have and did bring attention to Black Moors [Muslims] who would have been captured by the white British. Great Britain had become a subject Nation to the African Moorish Empire in the late 17th Century, so Molly, as well as many other Moors who were former servants, was sent to America as a business strategy by the British crown. Slavery in America would not become pervasive in America [with slaves being brought from Africa] until the power of the Moorish Empire in Africa was broken after the rule of powerful Black ruler Muley Ishmael [1728]. In fact, the mad desire of the British to colonize America and the world with their false destructive Religious dRFWULQHZDVGXHWRWKHSRZHUIXODIIHFWRI,VODPLQ(QJODQGIURPWKHODWH¶VWRWKHHDUO\ ¶V 110 B E NJ A M I N B A N N A K A : T he Scientist! Benjamin Banna Ka was the first scientist to record that other stars were like our Sun with planets circling them. He placed this in his 1792 almanac. Here is the highlight of the text WKDWGHPRQVWUDWHV%DQQD.D¶VNQRZOHGJHRIWKHXQLYHUVH ³7KLV6XQZLWKDOOLWVDWWHQGDQWSODQHWVLVEXWDYHU\OLWWOHSDUWRIWKHJUDQGPDFKLQHRI the universe; every star though in a SSHDUDQFHQRELJJHUWKDQWKHGLDPRQGWKDWJOLWWHU¶VXSRQD ODG\¶V ULQJ LV UHDOO\ D YDVW JOREH OLNH WKH 6XQ LQ VL]H DQG JORU\ QR OHVV VSDFLRXV QR OHVV luminous, than the radiant source of the day: So that every star is not barely a world, but the center of a magnificent system ; has a retinue of worlds, irradiated by its beams, and revolving round its attractive influence, all of which are lost to our sight in unmeasurable wilds of ether.13 As author of Benjamin Banneker: Surveyor, Astronomer, Publisher, Patriot Charles Cerami states, Here Banneker was expressing almost matter-of-factly (and in words that are nearly accurate to this day) the existence of extra-solar planets, a concept that only a few scientists would touch on in the century after his death and that astronomy would turn to with fascination only in the 20th century. 14 1R ZKLWH DVWURQRPHU LQ WKH ZRUOG XQWLO DIWHU %HQMDPLQ %DQQD .D¶V DOPDQDF ZDV published, neither Copernicus, nor Galileo, or any other white scholar had expressed definitive thoughts on what lay beyond our solar system. They knew of the stars as distant bodies, but they knew nothing about them being similar to Our Sun. Benjamin Banna K a also spoke of other life forms in the universe. 111 There were absolutely no white scientists even proposing such ideas scientifically. Banna .D¶V WKRXJKWV RQ RWKHU OLIH IRUPV ZHUH DW OHDVW WZR FHQWXULHV DKHDG RI ZKLWH VFLHQWLVWV DQG astronomers. This knowledge is interesting as again the Holy Quran was the only book available that spoke of this subject that Banna Ka could easily get his hands on. George Sale had made an English translation of the Holy Quran in 1734. This would have been available to Banna Ka. ³$QG WKH 6HYHQ KHDYHQV DQG WKH HDUWK DQG WKRVH EHLQJV LQ WKHP GHFODUH +LV >$OO ah] glory. And there is not a single thing except it glorifies Him in His praise, but many of you do QRWXQGHUVWDQGWKHLUJORULILFDWLRQ´6XUDK%DQD,VUDHO>@7KH2IIVSULQJRI,VUDHOYHUVH ³$QGRI+LVVLJQVLVWKHFUHDWLRQRIWKH+HDYHQVDQGWKH(DUW h and what He has spread forth in both of them of living beings. And He is all powerful to gather then together, when He ZLOO´6XUDK$O6KXUDD>@7KH&RXQVHOYHUVH %DQQD.D¶VJUDQGIDWKHUZDVGHILQLWHO\DZDUHRIKLVFXOWXUDOKLVWRU\DQGODQJXDJH%DQna Ka [the grandfather] having an Arabic name and knowledge of astronomy and agriculture was GHILQLWHO\D0XVOLP$OORIWKHSLHFHVILWH[SODLQLQJ%HQMDPLQ%DQQD.D¶VEULOOLDQWLQVLJKWDQG mind only when this truth is added into the equation. The United States of America as a British Colony and as an Independent Country had signed treaties not allowing them to enslave or LPSULVRQ0RRUV>0XVOLPV@7KLVLVZK\%DQQD.D¶VIDPLO\ ZDVIUHH,WZDVDOVRGXHWRWKHLU superior intelligence and participation in AmerLFD¶V IRXQGLQJ DV D QDWLRQ %HFDXVH RI WKLV knowledge and practice of their Culture and history they were seen as free by right. Benjamin Banna K a: T he Innovative F armer! Benjamin Banna Ka knew and could predict the Weather and eclipses. He knew farming and irrigation methods that saved his crops, and was a pioneer scientist of nature. %HQMDPLQ¶V JUDQGPRWKHU 0ROO\ ZDV WKH SLRQHHU RI WKH family in farming. She lived alone in America before she got married to grandfather Bannaka. Molly must have been a very productive farmer, as she was able to purchase more land and buy slaves so that she could free them. As a single woman, this meant that she had to have some mental resources. These were a knowledge of agriculture and herbs. This knowledge was enhanced by her marriage to Grandfather Bannaka and was passed down to Benjamin %DQQDND¶VPRWKHU0DU\ Mary was spoken of as having knowledge of the properties and uses of herbs, which was often of advantage to her neighbors. Her appearance was imposing, her complexion a copper color...she had an ample growth of long black hair, which never became grey. Her grandsons, 112 the children of one of her daughters used to speak with admiration of her many good qualities and her remarkable activity. They loved to relate WKDW ZKHQ µVKH ZRXOG UXQ WKHP GRZQ DQG FDWFKWKHPZLWKRXWDVVLVWDQFH¶7KLVFRQWLQXHGKHUSUDFWLFHZKHQVKHZDVRYHUVHYHQW\\HDUVRI age15 %HQMDPLQ¶VJUDQGIDWKHU%DQQD.DZDVNQRZQWRKDYHWKHDELOLW\WRSUHGLFWWKHZHDWKHU ³(YHQ PRUH VWULNLQJ´ DIWHU WREDFFR ZDV VHOHFWHG DV WKH FURS RI FKRLFH ZDV %DQQDND¶V astonishing ability to foretell the weather. The neighboring farms came to look enviously at the way this family always seemed to plant its heaviest crop when there was going to be fine weather and to cut back when conditions turned out to be less favourable. It was said that [Grandfather] Bannka foretold the direction of the prevailing winds long enough in advance to locate his plantings with uncanny precision. He was inventive too; he devised a way of channeling water from a small spring to part of their acreage, and this irrigation made the farm flourish in a way that none of the surrounding properties could match16 5REHUW %HQMDPLQ¶V IDWKHU DQG 0DU\ KLV PRWKHU TXDGUXSOHG WKH IDPLO\¶V RULJLQDO landholdings17 %HQMDPLQ%DQQD.D¶VPRWKHUSURYHGWREHDJRRGVRXUFHRIWHDFKLQJDQGSUDFWLFDODGYLFH IRUWKH\RXQJPDQ+HSODFHGKHUUHPHGLHVIRUZKRSSLQJ&RXJKDQGKHUµRecipes for C uring :RUPVLQ&KLOGUHQ¶ in his almanac. B A N N A K A , SI R I US, & T H E D O G O N... T he Sacred Science of the A ncient Moors! The Sirius Star System played a major role in the history of Ancient Egypt. It was the basis of the Ancient Egyptian Calendar. It is mentioned as the home of the resurrected etheric souls in the Pyramid Texts, which are listed among the oldest written Egyptian Records. It [The Sirius Star System] functions as a major part of esoteric [secret] science. The Religious significance of Sirius is profound as it is mentioned in much of the Freemasonic histories and 113 histories and records of Secret Societies. In particular, the Amarna Dynasty of Egypt [18 th Dynasty] is the point in history where Sirius finds its greatest significance in Egyptian history. We can see the letters MAR in AMARna. A famous Pharaoh named Akhnaton, his father Yuya, and son Tutankhamun are some of the most famous people of this dynasty. They are called the Family of Amraan [Amarna] in the Holy Quran. They are the ancient ancestors of the Moors and apart of the Ancient lineage of Israel [As-Ar = Osirus]18. In fact the Quran gives special attention to the Star Sirius and beyond the records of the Dogon and Egypt it is the only text that gives plurality to the Stars of the Sirius system. This is directly connected to Benjamin Banna Ka and his commentary on the plural numbers that he gave to the Sirius Star System. According to the Ancient Egyptian Calendar of the Amarna Dynasty and the records of the Dogon left with French scientists in the 1930s, Sirius is at the Center of the Universe. As we will prove later, Benjamin Banna Ka knew this and incorporated this truth into the building of Washington D.C. and this knowledge was later incorporated into the design of Philadelphia. Sirius was called the Dog Star. The Amarna Pharaohs of the 18th Dynasty of Egypt based their mummification procedures on the movements of the Earth and Sun in relation to the Sirius Star System, and they are the only Egyptians that are recorded as carrying out this activity. Benjamin Banna Ka, who knew that the Sirius System had more than one star according to his almanac records, is connected to his ancestors in Africa [The Dogon & EgyptiansAncient Moors] by this knowledge. Charles Cerami has connected Banna Ka to the Dogon because of his knowledge of the Sirius Star System. This is definitely a proper connection. However, keeping in mind that whenever we are making an analysis on history that we must place ourselves in the context of the historical period in order to make a proper analysis, then the connection to the Dogon will be verified, but something else will too. As we have stated the Holy Quran mentions the Star Sirius in a Surah [Chapter] called The Star [Al Najm]. The star system is spoken of in the plural form and is given as the word Al ±6KLUDD 7KH ORQJ µ$¶ VRXQG DW WKH HQG RI WKH ZRUG LV FDOOHG D EURNHQ SOXUDO LQ WKH $UDELF Language. So Prophet Muhammad was aware in his recitation and record of the Quran to give plurality to the Stars in the Sirius System. The Black Moors or Muslims many of whom were EODFN GHVFHQGDQWV RI 3URSKHW 0XKDPPDG¶V IDPLO\ DQG GHVFHQGDQWV RI 7KH $PDUQD '\QDVW\ OLYHG WKURXJKRXW :HVW $IULFD ZKHUH %HQMDPLQ %DQQD .D¶V JUDQGIDWKHU ZDV VWROHQ IURP DV D slave and brought to America. The name Banna Ka is Arabic. Banna meaQV µWR EXLOG RU FRQVWUXFW¶DQGµ.D¶PHDQVµRQHZKRLVOLNHVRPHWKLQJ¶,WDOVRPHDQVµVSLULW¶7KH'RJRQOLYH in the area that was known during this time as Mali. Of course there are no known records that speak of a tribe named Dogon. The Dogon Tribe did QRWRULJLQDOO\FDOOWKHPVHOYHVµ'RJRQ¶ Their histories are presently stated by them as preserved by way of oral traditions. This area was full of Black Moors who practiced the culture of Islam. So here, we have made the basic connection of Sirius to BenMDPLQ %DQQD .D¶V grandfather Banna Ka, The Ancient Egyptians, and the Dogon, who would have definitely been affected by the Holy Quran and Islam. The Black Moors of Islam serve as the link between the 114 Dogon and the Egyptian teachings on Sirius. Benjamin BaQQD .D¶V JUDQGIDWKHU ZKR KDV DQ Arabic name, and who as the son of a royal chieftain, would have been proficient in Quran(ic) VWXGLHVZDVXQGRXEWHGO\WKHVRXUFHRI%HQMDPLQ¶VNQRZOHGJHDERXW6LULXV7KH(J\SWLDQVJDYH this hieroglyphic as a sign of mental baptism and instruction into mastery. This sign with three parts pouring forth from three sources is a sign of the Sirius Star System that has three stars Sirius A, B, and C. It is also significant that this hieroglyphic is in the form of an M, which is the thirteenth [13th] letter in most all languages, as 13 is the sacred number of the 13th Constellation µ6LULXV¶DQG the sacred number of Masonry and Ancient Egyptian Mythological Traditions in the history of Auset [Isis], Asar [Osirus], and Heru [Horus]. %HQMDPLQ%DQQD.DVWDWHGWKDW6LULXVZDVKLVµIDYRULWH6WDUDQGKLVOXFN\VWDU¶&KDUOHV Cerami states that no other Africans other than the Dogon were known to have a special interest in the Star called Sirius, however this is not true. The Black African Muslims [Moors] had great interest in it. Prophet Muhammad even dealt with the 50,000 year Earth cycle and its 1000 year cycle equivalent in the Orbit of Sirius B [Sirius B had an orbit around Sirius A equaling 50 Earth Years thus 1000 Sirius Years is 50,000 earth years]. This interest somehow found its way into the building of Washington D.C. and Philadelphia and became the basis of the movement for independence among the white Americans. BENJAMIN BANNA KA & Secret Societies Benjamin Banna Ka called the founding fathers frauds over the slavery question20. He became very concerned about the condition of his people in the later part of his life as he began to witness the activity of slavery. In his later life, He spoke out against this terrible behavior. Banna Ka was a part of a Society that were not only against slavery but were a part of a secret plan to end it. Banna Ka and the Society of Friends [Rosicrucians] The Quakers were the first white abolitionists of America. They had a special organization called the µ6RFLHW\ RI )ULHQGV¶, which was a leading abolitionist group. The Quaker Faith was based on the internalization of the Message of Christ as an individual and not as a part of the Church, which they saw as corrupt and not loyal to the True Message of Jesus. 115 The Quaker movement was also not very popular amongst the racist American whites, as the Quaker movement had grown out of the great Islamic influence in England from 1558 to the ODWH¶V7KLV,VODPLFLQIOXHQFHLVUHFRUGHGLQ1DELO0DWDU¶VERRN³ Islam in Great Britain 1558-´. Many of the white People in America worked progressively to keep Islam away IURPWKHLUVODYHV*HRUJH)R[IRXQGHURIWKHµ4XDNHU´IDLWKZDVDOHDGHUWKDWJUHZRXWRIWKLV religiously explosive period in Great Britain. William Penn, the white settler who was allowed to settle in Philadelphia by our ancestors, was also a Quaker. During his lifetime George Fox, the founder of the Quaker Faith, visited Barbados, Jamaica, America, Holland and Germany. Fox was accompanied on his travels by William Penn and in 1661 he founded the American Quaker Colony of Pennsylvania . Fox continued as a traveling preacher until his death in 1691. Three years after his death, a committee of leading Quakers under the leadership of William Penn, edited and published his journals. The Quakers have a special relationship with a famous fraternal order called the Rosicrucians. The word Rosicrucian according to the American Heritage dictionary means: 1. A member of an international organization, especially the Ancient Mystic Order Rosae Crucis and the Rosicrucian Order, devoted to the study of ancient mystical, philosophical, and religious doctrines and concerned with the application of these doctrines to modern life. 2. A member of any of several secret organizations or orders of the 17th and 18th centuries concerned with the study of religious mysticism and professing esoteric religious beliefs. E tymology From New Latin (Frater) Rosae Crucis, (Brother) of the Cross of the Rose, translation of German Rosenkreutz, surname of the traditional founder of the society [Sir Christian Rosenkreutz].21 Many have associated Christian Rosen Cruz with Sir Francis Bacon the Chief Translator of the King James version of the bible also known as William Shakespeare22. The mystical and philosophical doctrine of German Rosicrucianism produced the first Rosicrucian group in America. The Chapter of Perfection was formed by scientist-theologian Johann Jacob Zimmerman. Zimmerman joined other groups in accepting the invitation of William Penn to migrate to Pennsylvania. However, just before the group sailed, Zimmerman died. Their beliefs included a strong millennialism, and the group brought a hope for the imminent return of Christ to earth with them when they came to America in 1694. Zimmerman's role was assumed by Johannes Kelpius (1673-1708) who led the small band to Germantown Creek23. This connection between William Penn, the Quaker, The Rosicrucians, Freemasonry, and the subject of Benjamin Banna Ka is of importance because the founders of both the Quaker faith, George Fox, and Rosicrucianism, Christian Rosen Cruz have a special connection to Islam. Even if Sir Francis Bacon were the true Sir Christian Rosen Cruz, the Islamic connection stands. The secrets of Freemasonry, Rosicrucianism, the Quaker Faith, and the 116 subject of Benjamin Banna Ka are all tied to Islam, Prophet Muhammad, the Quran, and Black 3HRSOH LQ $PHULFD >,VUDHHO@ 7KH (OOLFRWW¶V DV 4XDNHUV ZHUH PHPEHUV RI WKH 6RFLHW\ RI Friends, and Andrew Ellicott was a Rosicrucian. Benjamin Banna K a: T he Design & L ayout of W ashington D. C . & Philadelphia! Major Andrew Ellicott24, a highly accomplished surveyor, was directed by Jefferson to perform the survey of the District of Columbia. Ellicott and his assistant, Benjamin Bannaka25, began work in the spring of 1791. The following year Washington asked Ellicott to finish L'Enfant's plan for the city. In less than one month Ellicott found himself at odds with the Commissioners and resignHG IURP WKH SURMHFW /¶(QIDQW¶V SODQV IRU WKH &LW\ QHYHU UHDFKHG Banna Ka in their original form. History proves that the second map, which has been attributed WR (OOLFRWW ZDV YHU\ GLIIHUHQW IURP ZKDW /¶(QIDQW KDG GHVLJQHG 'HWDLOHG FRPSDULVRQV KDYH been made between the two maps by the National Capital Planning Commission in 197027 and the comparisons show changes in the angles of the avenues and the location of squares and circles. This is very significant. The change in the angles of the avenues has everything to do with what Benjamin Banna Ka designed and laid out is Washington D.C. and why. 7+($/0$1$&¶62)%$11$.$ 7KH$OPDQDF¶VRI%HQMDPLQ%DQQD.DKDGHPSKDVLVRQ x x x x x x x x x the meetings of Quakers [Rosicrucians] the stars Spica, Arcturus, Regulus, and Sirius The Fixed Stars of the Constellation belt 7KHHVWDEOLVKPHQWRIDµ3HDFH2IILFH¶IRUWKH*RYHUQPHQWRIWKH8QLWHG6WDWHV 'RFXPHQWDU\6WXG\RIWKHµ<HOORZIHYHU¶LQ3KLODGHOSKLD Herbal Remedies for the many ailments during the time Prediction and Records of Eclipses Charts and Maps of The Human body and its connection to the Zodiac The Structure of the United States Court System 2XUHPSKDVLVKHUHLV%DQQD.D¶VVSHFLDODWWHQWLRQWRWKHVWDUV6SLFD$UFWXUXV5HJXOXV and Sirius. The design of Washington D.C. and Philadelphia is based on these stars and the Constellations that they are apart of. The significance of them is: x These stars map out the Ancient New Year of the Ancient Egyptians under the Amarna Dynasty called the Family of Amraan in the Holy Quran. It is the oldest and most accurate calendar on Earth. Prophet Muhammad in his record of the Quran deals with Specific aspects of this calendar and a 50,000 year cycle. This 117 information is directly connected to information given by the Most Honorable Elijah Muhammad in Message to the Blackman about the Tribe of Shabazz and Pole Shift, showing a continuing connection in the transmission of specific information that is pertinent to the next point x These stars also reveal the secret of the number 33 in Freemasonry as it pertains to astronomy, the calendar, the human anatomy, and an event we have mentioned FDOOHG 3ROH 6KLIW WKDW LV FRQQHFWHG WR WKH µHQG RI WKH ZRUOG WUDGLWLRQV¶ LQ DOO religions x These stars also reveal the planning and design of America DQG WKH ZRUOG¶V WZR most influential cities Washington D.C. and Philadelphia and the Ancient knowledge of the Black Moors that is infused into their infrastructure x /DVWO\LWUHYHDOVWKHFRQQHFWLRQEHWZHHQ%ODFN3HRSOHLQ$PHULFDDQGWKHµ(QGRI the World &RQFHSWLQKLVWRU\¶>%ODFN3HRSOHLQ$PHULFDDUHDWWKHURRWRIWKHULVH RI WKH (DUWK¶V PRVW $QFLHQW 1DWLRQ@ ,W ZDV LQ WKDW WKH ODUJHVW JDWKHULQJ LQ history of Black Men in America took place in x :DVKLQJWRQ '& µ7KH 0LOOLRQ 0DQ 0DUFK¶ ZKHUH RYHU 2 million Black Men gathered in a movement that is a part of a universal plan to place the Black man on top as the original ruler of the planet. It was in 1997 in *Philadelphia*, that we had the gathering of the largest body of Black Women ever in the history of Black $PHULFDDWWKH0LOOLRQ:RPDQ¶V0DUFKWKDWZDVDVLJQWKDWWKH%ODFNZRPDQZDV being restored to Her position as the Original Mother of the Earth and the universe. 7KLVLVDYLHZRI$UFWXUXV6SLFDDQG5HJXOXVIRUPLQJWKHµ'LYLQHWULDQJOH¶ The above map of the three significant stars Regulus [at the far right], Spica [bottom left], and Arcturus [top left] are aligned exactly to three significant Earth points in Washington D.C. and Philadelphia. The path of the Sun around the Center of the universe [Sirius System] is also marked by the line from Regulus to Arcturus. The Zodiacal path is seen in the line from Regulus to Spica. The angle in the triangle above is significant to Free Masonry, as we will see later in this writing. 118 If one were to take a Protractor [Square], the tool of a Mason, and measure the acute angle of this triangle, which is where the star Regulus is, they would get the measurement of GHJUHHV5HJXOXVLV/DWLQDQGPHDQVµ/LWWOH.LQJ¶,Q3KLODGHOSKLDLWLV&Lty Hall that is positioned at this point. City Hall contains all of the executive, legislative, and judicial governmental offices for the city of Philadelphia and a special Zodiac at the Center of a Square. The Zodiac is reversed, which we will see is of supreme importance to the concept of Pole Shift and the End of the World Traditions in most Religions and Cultures. Albert Pike spoke about Sirius and about a special triangle that was a part of the esoteric secret of Masonry. In his Book Morals and Dogma of the Ancient and Accepted Scottish Rite pf Freemasonry Pike states about Sirius, ³7KH $QFLHQW $VWURQRPHUV VDZ DOO WKH JUHDW Symbols of Masonry on the Stars. Sirius still glitters in our ORGJHVDVWKH%OD]LQJ6WDU´ 3LNH¶V FRPPHQWDU\ LV UHODWHG Vomewhat to the triangle surrounding Virgo previously noted. Pike calls WKLVWULDQJOHWKHµXQLYHUVDOHPEOHPRISHUIHFWLRQ¶ As we can see here Pike displays the symbol of 33 in the Pyramidal Triangle. What is the significance? Why did Pike refer to this as a universal emblem of perfection? /HW¶VPDNHVRPHRWKHUFRQQHFWLRQV3LNHZDVD%ULJDGLHU 119 General for the Confederate Army of the South during the Civil War. He was in close contact with the Cherokee who were also involved in an internal Civil war over the issue of slavery LQVLGHRIWKHLU1DWLRQ7KH2ULJLQDOQDPHRIWKH&KHURNHHLVµ6DUDJL¶$VZHFDQVHH6D-Ra-gi has the same root as Is-Ra ±eel, The S & R being the root consonants. The Cherokee in North Carolina have been connected to Ancient Black Israel by way of ancient inscriptions found near their reservations. T he C herokee & Israel The upper part of this diagram shows a silver shekel of the Second Revolt of Israel against the Romans, 132 ± 135 A.D., reading Simeon on the obverse (left) and Deliverance of Israel on the reverse. Reported find sites for this and related coins are shown for Kentucky and east Arkansas. Below the coins, is the Bat Creek stone from Tennessee, supposed by the Smithsonian finders to be Cherokee, but recognized by all Hebrew Scholars who have studied it as a Hebrew Text of the first Century A. D. Dr. Robert 6WLHJOLW] RI 1HZ <RUN UHDGV LW DV ³$ &RPHW IRU WKH +HEUHZV´ ZLWK UHIHUHQFH WR +DOOH\¶V FRPHW ZKLFK µKXQJRYHU-HUXVDOHPOLNHDIODPLQJVZRUGLQWKH\HDU $'¶ during the first Revolt, begun in 68 under Nero. The evidence suggests that Kentucky and Tennessee became havens of refuge for persecuted Hebrews after the various revolts against Syrian Greek and Roman Oppression.29 Why were the Black Israelites coming to $PHULFD"7KHZHVWKDGEHHQWKH³6HFUHW+DYHQ´IRU Black People all the way back to the 18th Dynasty when Akhnaton (Moses) set up expeditions for the first Israelites to come to Mexico. The Black Israelites had spread all over America. History proves that the Israelites under various names given to them by Caucasians like; Carthaginians, Gaelic Celts, Iberians, Libyans, and even later Muslims (They called themselves this) came into America. Most of these people were connected by lineage and Spiritual Doctrine to The 18th Dynasty of Egypt and Yuya (Abraham). America EHFDPHDVHFUHWKDYHQRISURWHFWLRQIURPWKHZKLWHVZKRKDGQRWµGLVFRYHUHG¶WKH:(67\HW 7KHSUHVHQW%ODFN3HRSOHLQ$PHULFDZKRDUHXQGHUWKHIRUHLJQQDPHVRIWKHLU6ODYHPDVWHU¶V children are their ancestors. We were not all brought to America during the Trans-Atlantic slave trade. We are Indigenous to America too. Remember our connections between the Black Moors and Black Israel. These are GHWDLOHG LQ RXU %RRN µ5HSDUDWLRQV :DU WKH 7UXWK DERXW %ODFN ,VUDHO *RG¶V +RO\ 1DWLRQ¶ 1REOH'UHZ$OL¶VIDWKHU-RKQ'UHZZDVDPHPEHURIWKH6DUDJL>&KHURNHH@DQGZDVD%ODFN 120 freedman. He was in close contact [by way of letters] with Pike until his Black and Red regiment turned to support the North. -RKQ'UHZ1REOH'UHZ$OL¶VIDWKHUVHHQLQWKLVOHWWHUGXULQJWKH Civil War communicating with Brigadier General Albert Pike John Drew although pictured as very light skinned in this picture was considered a Black Freed man. There is an account of Drew stated in a book called The Cherokee F reedmen: F rom Emancipation to American Citizenship by Daniel F. Littlefield Jr. In speaking on the personal life of the Cherokee and the Freedmen amongst them Littlefield records, In 1878 freedman John Drew, for instance, showed the best draft stallion at the Indian International F air held at Muskogee30 Noble Drew Ali started his organization called the Moorish Science Temple of America in 1913. It was the first Moorish Islamic movement initiated after we lost the knowledge of our Moorish Islamic History. It was called at the time the Canaanite Temple. In 1913, when Noble Drew Ali reinitiated this knowledge, the Sirius Star System was in exactly 13 degrees of Cancer. Cancer was in ancient times seen as the symbol Khepra31, the Dung Beetle with a disc. 121 K H E PR A K heper-T chesef ± T H E SA C R E D D ESI G N Remember the symbolism of 13 in Masonry and in connection to the Sirius Star System [The 13th Constellation] and the Founding of the American Nation. The Sun is in 13 degrees of Cancer every July the 4th. The seals of the Nation are based on the number 13 and it all comes from this history and Astronomical knowledge of Sirius, Black Israel, the Original People of the planet and universe. There are 13 steps to the pyramid. There are 13 arrows and 13 olive leaves and 13 olives in the hand of the Eagle. E Pluribus 8QXPLVOHWWHUVDQGLV/DWLQPHDQLQJµ2XW RI 0DQ\ FRPHV RQH¶ 7KHUH DUH 6WDUVDERve the head of the Eagle. There are 13 letters in $QQXLW&RHSWXVZKLFKLV/DWLQIRUµ)DYRXU0\8QGHUWDNLQJ¶ suggested that the worship of Khepera predates the worship of Ra, Khepera is considered a form of Ra. It is said that Ra cam into being under the form of Khepera. Khepera is called the father of the gods. He represents transformation from a state of inertness into a state of active life. When the body is dead prayers are recited over it so that the soul within could burst forth into a new realm of life. This resurrection is symbolized by Khepera. The scarab beetle may have become a symbol of resurrection and transformation because it starts out in life as an egg layed in a ball of dung. When the egg hatches the scarab is at first a larva and then a nymph. Finally the adult scarab emerges from his ball of dung fully winged. Joseph J. Adams http://ourworld.compuserve.com/homepages/pds/khepera.htm 122 Notice the Sash of Noble Drew Ali, with pouch at the end. This same sash with a pouch at the end is worn by a Native warrior to the left of an America soldier in Florida amongst the Moors [Maroons] or Seminoles who were at War with the Americans. The Moors were known for wearing this style of Clothing and it was connected to Orion and Sirius. See the diagram of Orion and his Sash or belt. The Belt of Orion [3-Stars] points directly to the Sirius Star System 123 So what is the connection of all of this to Benjamin Banna Ka? Our point in showing the previous pages is to show a uniform secret knowledge amongst various groups of Masons, Moors, and Natives in American History. Benjamin Banna Ka designed Washington D.C. based on the most Ancient Calendar of in the world. He laid out the avenue from The Capital Building to the White House, which is called Pennsylvania Avenue to be exactly aligned with the stars Regulus and Arcturus. This is the path that the sun takes in its course around the Center of the Galaxy and universe [Sirius System]. Here is a diagram of the Washington D.C. and Philadelphia layout as compared to the Stars. The angle at Regulus [White House and City Hall] is 33 1/3 degrees. On the human body, it represents the angle of the three master glands of the brain the Pineal, Pituitary, and Hypothalamus. They control the electric, magnetic, and etheric forces of the body and generally all cellular repair, protein assimilation, and general all bodily functions. Beginning every August 10th one can see the constellation formations of Bootes, Virgo and Leo, with the three main stars Arcturus, Spica, and Regulus setting over the White House or Art Museum in the Form of a Seven at the Western End of the Horizon. 124 On the Eastern End of the Horizon Sirius rises in the Second Week of August. This is the point in the year when the path of the Sun and the Path of the Zodiac meet. This is the True New Year measured at 365.25 days. We are entering the Age of Aquarius, which simply means the Solar system and the Sun are in the area of the Zodiac closest to the Constellation Aquarius 125 So every 51,840 years there has been a pole shift. This event occurs when the North Pole and the South Pole switch. What is the evidence in the past that it has happened? Why is it happening? And how was this information, if known transmitted down to Benjamin Banna Ka. 126 Remember Banna Ka's connections to The Quakers and Rosicrucians. William Penn a famous 4XDNHUDQG5RVLFUXFLDQIRXQGHGDSODQIRUWKHµ3URYLQFHRI 3HQVLOYDQLD¶>3KLODGHOSKLD@,QKLV plan Penn laid out [5] five city Squares. These squares today are known as Washington Square, Rittenhouse Square, Logan Square, Franklin Square, and Center [Penn] Square, which is the site of City Hall. Penn had purchased WKHDUHDIURP7KH/H1DSL¶V7KH/H1DSL¶VZHUH an ancient group of Black People. The word Napi was really Nabi. Nabi has DQFLHQW RULJLQV LQ (J\SW DQG PHDQV µ/RUG¶ µ1DEL¶ LQ $UDELF PHDQVµ0HVVHQJHU RI*RG¶7KH&XOWXUDO6\VWHPRIWKHµ/H1DSL¶V¶KDGLW¶VSRLQWRIRULJLQDWLRQ in the west in Mexico with the return of the Black Family of Amraan [Black Israeel] to America. This is the origin of Masonry in the Western Hemisphere. Penn laid out the Square based on ancient astronomical science. The Center Square location is located exactly where the water works facility was built in the 1800s and now the Zodiac is also located at the same location. This point represents the point where the ecliptic of the Sun [motion the sunmakes around the center of the universe] and the Ecliptic of the Zodiac meet. In this age that we have just entered called Aquarius this point represents the time Pole Shift is to occur. This information is secretly known by those who placed the Zodiac in a reversed orientation. The only other places where we witness this reversed orientation of the Zodiac are in Egypt at the Dendarah Temple, on the Tomb of Senmut, an early name for the Pharaoh Akhnaton[ Moses], in Washington D.C. at the Mellon Fountain Zodiac, and in Philadelphia. Noted researcher on the subject of Pole Shift, John White, speaks of the reverse Zodiac on the WRPERI6HQPXW³1RWRQO\GRSDS\ULWHOORIWKLVDSDQHORQWKH tomb of Senmut, the architect of Queen Hatshepsut, shows it. The Celestial sphere with the signs of the Zodiac and other Constellations of the southern sky are revHUVHGLQRULHQWDWLRQ´ As we can see, the Dendarah Zodiac is reversed, showing the Zodiac to move in a clockwise progression, although the revolutionary path and rotational path of the Earth move in a counterclockwise direction. 127 The Zodiac in Philadelphia and Washington D.C. are the same. In Philadelphia, the present sight of the Art Museum was formerly called FAIR MOUNT and was a truncated pyramidal mound built by the Le-Nabi in the style of the step pyramid. The only known surviving portraits of the Pyramidal/Mound come from the Thomas Birch collection [1823] Report of the Watering Committee Most of the portraits were created during the Construction of the Fairmount Waterworks in the early 1800s. This site was aligned exactly with Center Square and is aligned celestially with the 128 movement of the Sun around the Ecliptic. This proves beyond doubt that Benjamin Banna Ka and William Penn were influenced by the Le-Napi in the design of the key areas of Washington D.C. and Philadelphia, as the Le-Napi were the builders of the pyramidal mounds in the µ3KLODGHOSKLD DUHD¶ %DQQD .D¶V GHVLUH WR HVWDEOLVK D 3HDFH 2IILFH ZDV FOHDUO\ WR protect the Natives from the warring white Colonists, which shows he had a special affection for the LeNapi who were the dominate group in the area of Maryland Delaware and Pennsylvania, and the oldest Native National Community. The Tomb of Senmut [Moses ± Akhenaton] features two distinct points that are relevant to this study. The first is the reversed Zodiac, which we have discussed. The second is a map of the stars of Sirius that is exactly like the Dogon diagrams given to the Germans who visited them in the early 1900s and near exactly like the layout of Philadelphia and Washington D.C., with emphasis on the main monuments representing the 3 stars of the Sirius System and 1 planet. This diagram from the tomb of Senmut shows that the Amarna family of the 18 th Dynasty knew that Sirius had a plurality of Stars, as do the Dogon, and Banna ka. The Center Star Sirius A, is surrounded by three symbolic bands. The Three objects surrounding it form a Pyramid. The Dogon have a similar diagram 129 The diagram gives Sirius B twice thus five objects appear, however, there are four and they too form a pyramid. The same is true for both of the cities Washington D. C. and Philadelphia. There are four sites in both cities that match these two diagrams proving that there was a transmission of knowledge about what author Robert Temple calls the Sirius Mystery. This information was provided by Benjamin Banna Ka, The Le Napi [Black Amarna - Israel] , and was given to the whites [Quakers - Rosicrucians]. %HQMDPLQ %DQQD .D SURYHV WKURXJK KLV OLIH¶V ZRUN DQG WKURXJK WKH FRQQHFWLYH histories surrounding him and the design of both of these cities that Black people are on the rise to prominence. These areas encompass the governing of the creation and enforcement of the Law, The Commerce and symbolism of the Country, and the History and foundation of Independence as established on July 4th, the Cosmic Day of Sirius Sun & Earth Alignment, representing the resurrection of Ausar (Osiris) by way of Heru (Horus) the 1st Resurrected Son. It represents the DQFLHQW/LQHDJHRI*RG¶V Nation, and the rising of the Sun in the West, which is expressed in this V\PEROLVPDQGLVDOLWHUDODQGV\PEROLFHYHQWWLHGWRWKHULVHRIWKH(DUWK¶V2OGHVW Indigenous Nation, Black People in North America. 130 Honoring One of Our Founding Fathers We give honor to Benjamin Banna Ka who through living his life purpose has reached the golden state of immortality and we promise to carry on the work of peace and prosperity that He lived to produce. Ali Muhammad Philadelphia [15090 day 8 Month 12] July 25th 2005 131 -+6-+-&7!1(//#+!/(.(+&((+8!&'(!2#9-05!5#+/&-&,&-#+! By C.M. Bey, ©AA 222141/Library of Congress, Washington, D.C. If the lawmakers of the 50 Union States Society of North America, should attempt to ignore the Moorish Law and birthrights of this constitution, it would be an act of supreme violation of their own M agna C harta Code. Prefaced by, T aj T arik Bey Preface T he Zodiac Constitution Moorish Adepts, Moorish Scientists, Master Masons, Eastern Stars, Sheiks, Sheikesses, Neophytes, Amanuesis Maters, and World Scholars, have studied and marveled, upon analyzing the written Zodiac Constitution. This highly ± qualified document was penned by C. M. Bey ± a 3rd , 33rd, and 360 degree, Free Moorish Master Mason, Master Astrologer, PhD., LLD., and Constitution Law ± Giver. This master ± work was copyrighted and registered in the Library of Congress, Copyright Office, and with the Department of Justice, at Washington, D.C., United States Republic of North America. 7KHUH DUH LQWHUHVWLQJ DQG HIIHFWLYH OLWHUDU\ FKDUDFWHULVWLFV DERXW & 0 %H\¶V ZULWWHQ Zodiac Constitution, which go beyond the fact of its being clear, simple and direct. Moorish Scholars will take note that it maintains the ancient Moabite/Moorish Scientific, metaphysical and spiritual approach to the number seven [7] in harmony with the natural constitution of 0DQ¶VPDNH-up. Other learned intellectuals of the varied and advanced Gnostic schools of the world, and of Government, no doubt, must appreciate its uncluttered directness and integrity towards Justice. The written Zodiac Constitution was not readily available to the masses, due to the nature of limited access to Moorish Schools of learning, and the suppression of information practices RI8QLRQ6WDWHV6RFLHW\SROLWLFLDQVDQGRWKHU6HFUHW6RFLHWLHV¶SROLFLHVRIFOXELVPFXOWXUH7KLV anti-social practice is a part of the necessary socialization tools for maintaining veiled economic, political, and bureaucratic servitude in the Americas ± particularly, in the North Gate. 132 Let us be qualified in our understanding that the Zodiac Constitution is not just the actual written 7 Article document, as presented to you for reading, historical analysis and law ± study. The general populace must have access to that consciousness involving the true history and scientific foundation of Civilization and Culture on the Earth planet. Thusly, one immediately and wisely recognizes what actually comprises the Zodiac Constitution and the elemental nature of what inspired C. M. Bey to produce the inclusively complex scale of this compact and HYLGHQWLDU\WUHDWLVHRQ³5LJKW/DZ´JRYHUQPHQW What comprises The Zodiac Constitution is expressed and revealed in the first opening paragraph of Article 1, as written by C. M. Bey. His literary works have come manifest by way RI D NQRZOHGJH RI WKH =RGLDF RU ³:RUNLQJV RI 1DWXUH´ WKH 0RDELWH0RRULVK &RGH IRU Civilization, and the Sciences mentioned. And so, one can surmise that Astrology ± the twelve Signs of the Zodiac; an expansion on The Code of Mathematic Scale, involving the numbers 0 1 2 3 4 5 6 7 8 9; The Science of Geometry [G] and the Arabic Alphabet; comprise Moabite/Moorish Science ± the Culture and foundation of Civilization on the planet Earth. A logistical study of the Zodiac Constitution should generate years of research and recovery of world Culture and true American History, for all who seek truth. Let us affirm our honor for our ancient Mothers and Fathers. Embrace knowledge and shun ignorance. Help to uplift fallen Humanity. Hibu, Haqq, Salaam, Hurryatun, Adl, Islam, As Salaamu Alaikum, Vadi Makum, - Taj Tarik Bey A Free Moor Son of a Widow M.D.N.M. M.S.T. of A. M.O.O. The R. G.S.N.A.M.A. Shechabee Territory Northwest Amexem 133 The Zodiac Constitution By C.M. Bey, ©AA 222141/Library of Congress, Washington, D.C. A rticle 1 The Twelve Signs of The Zodiac, The Code of Mathematics scaling from zero to nine (0 ± 9), and the Science of Geometry (G), comprise the Constitution of the Living Moorish Nation of 1RUWK$PHULFDUHIHUUHGWRDV³1HJURHV´ZKRUXOHGWKHZRUOGDQGWKH6HYHQ6HDVE\WKH Signs of The Zodiac and the Science of Geometry (G), for eleven hundred and ninety-six years, to the Amazon Dutch-German Catholic Priesthood Fathers of the Revolution of 1789, and the Sisterhood Manga Charta, Emancipation Proclamation, Union Society of White Supremacy, in 1863 North America. The Twelve Jurymen of the 50 Union States Society, and also the none judges of the Supreme &RXUW ZHUH IRXQGHG XSRQ WKH 0RRULVK 1DWLRQ¶V 6LJQV RI WKH ]RGLDF &RQVWLWXWLRQ DQG Mathematics scaling from zero to nine (0 ± 9). Thus without our Moorish Constitution, the Manga Charta, Emancipation Proclamation, Union Society of the Myth of White Supremacy, Definitely could have been found in 1863. A rticle 2 Zodiac Constitution Birthrights T he Moorish A merican 7KH%H\¶VDQG(O¶V Since the 12 Jurymen of the 50 Union States, Manga Charta document of White Supremacy and the nine judges of their Supreme Court were founded upon our Moorish Zodiac 12 Signs, 0DWKHPDWLFDO&RQVWLWXWLRQWKHODZPDNHUVKDYHQRMXULVGLFWLRQRYHUWKH)UHH0RRUVWKH%H\¶V DQG (O¶V LQ WKH LQKHULWHG ODQG RI WKH 0RRULVK QDWLRQ QDPHO\ U.S.A., Canada, Central and South America. The Moorish American Nationality and their sir names, Bey and El, are their inherited birthrights without a legal due process of the lawmakers of the Union Society, U.S.A. What our Moorish forefathers were, we are today without a doubt or contradiction, namely, Moorish! A rticle 3 T ax and Military E xemption for Moorish A mericans (The Beys and E ls) 134 The Moors, referred to as Negroes, definitely can never become members and citizens of the Union Society of the 48 States. Therefore they cannot be forced or drafted into the Union, U.S.A. Army or Military service to fight for the Manga Charta Code of the White Supremacy against themselves. The lawmakers of the 48 States Union order cannot force the Moors, the Beys and Els, to pay taxes because taxation without representation is a supreme violation of the Moorish Zodiac Constitution birthright of Islam. When the Union lawmakers denounce their immortal Manga Charta Code, and resort to the Moorish Zodiac Constitution, the Moors are compelled to pay taxes because every one of the Nation will be equally represented by it. There is no room in the Science of Masonry (The Zodiac), for mystic god religious worship, race, color, ignorance, war, crime, slavery and human injustice. A rticle 4 Adequate Employment and Protection for Moorish Americans Every lawmaker, the heads of industry and business enterprise of the 50 State Union Order, are obligated members and citizens of the Magna Charta Christian Church and Temple system of Christ the King of Jews, meaning; jury over the wealth and culture of the living Moorish nation of North America. Therefore, by the Moorish Zodiac Constitution, the Moors, the Beys and Els, can demand adequate employment, food, clothing, shelter, medical care, equal rights, respect and protection from mob violence, rape and injustices, otherwise without being obligated to the union church DQGUHOLJLRXVV\VWHPRIWKHRUGHURI&KULVWWKH³:KLWH´VRQLGRO*RG A rticle 5 Immortal Mar riage L icense Code against the Zodiac L aw of Nature Truth cannot be altered and therefore needs no apology nor doctrine, because it is the supreme mental doctor itself for the entire human family, woman and man. 1) Thus the truth is, the Sisterhood Christian Daughters of the American Revolution, (D.A.R.), established the marriage license states right code to prevent Moorish men and women from marrying into their Magna Charta society of White Supremacy. 2) Did you ever stop to think that women and men are already married by the Supreme Law of Nature, and that a marriage license is an act of violation of the law of Nature? The Nature Law Union between women and men spells love and the reproduction of a child in which a marriage license plays no part in. 135 3) Definitely there cannot be any illegitimate children offspring from women and men, because women is supreme gate of creation of both male and female children by the law of nature, which spells I.S.L.A.M., or I, Self, Law, and Master, the Carpenter and the Grand Architecture of the HXPDQ)DPLO\³$GDP´PHDQVWKHSRVLWLYHIRUFHVLQZRPDQ and sons responsible for evolution or the reproduction of children by the law of nature. The Pope, Priests, the Preacher, and Judges of the Christian society definitely cannot SURYH WKDW WKHLU ³$GDP´ DQG ³(YH´ KDG D PDUULDJH OLFHQVH 'LG \RX HYHU VWRS WR WKLQN that the marriage license code is an act of selling women and men back to themselves? The Union, Magna Charta marriage license code unfortunately and unconsciously caused the ³:KLWH´ZRPHQWREHcut off from the human family (The Moorish Nation). In other words, the ³:KLWH´ZRPHQDUHVXSUHPHVRFLDOVODYHVDJDLQVWWKHLUZLOODQGGHVLUH7KLVKDVFDXVHGWKHPWR carry in their mind and heart a secret sorrow and anger, which causes their children to inherit a tendency of crime, hatred, insanity and various other diseases. Islam Supreme Standard of the Zodiac Mar riage L aw (Culture) +HUH DUH WKH HOHPHQWV RI WKH 6LJQV RI WKH =RGLDF DQG ZRPHQ DQG PHQ¶V RSSRVLWH VLJQV involving the first marriage of the Zodiac Law of Nature. No preacher and money and license and neither religion is necessary in the standard zodiac marriage law. In Harmony with Nature: 1. 2. 3. 4. 5. 6. Aries is Fire and Libra is Air. Taurus is Earth and Scorpio is Water. Gemini is Air and Sagittarius is Fire. Cancer is Water and Capricorn is Earth. Leo is Fire and Aquarius is Air. Virgo is Earth and Pisces is Water. 7KH 8QLRQ %LEOH 6WRU\ RI ³(YH´ DQG ³$GDP´ ZHUH IRXQGHG XSRQ WKH 0RRULVK =RGLDF twelve signs law, the negative and the positive forces of nature (female and male). In Harmony with Nature: 1. Aries is Fire and Gemini is Air. 2. Leo is Fire and Libra is Air. 3. Sagittarius is Fire and Aquarius is Air. Persons born under the opposite signs and the angle signs are in harmony with one another in every manner. Thus firsthand knowledge of the sign under which you and your mate were born will guide your destiny in peace, progress and happiness forever. Let us remember that this is 136 not a theory. The Zodiac is absolute universal standard of marriage and human guidance. Woman and man will know their duty toward one another and their children without being forced by the traditional code for the court room. A rticle 6 T he O ne and O nly Universal Moral L aw for Unity, Peace and E conomic and Social Progress. The Moorish Zodiac Constitution is the only Universal Unchanged Moral Law for the Human Family, for Unity, Human Equality, Respect, Peace and Economic and Social Progress. 7KHUHIRUHHYHU\0RRUWKH%H\VDQG(OVPXVWEHJXLGHGE\WKLVFRQVWLWXWLRQDQGERRN³&ORFN RI'HVWLQ\´GRWKDWZKLFKLVULJKWE\UHDVRQDQGKDYHUHVSHFWIRUWKH³:KLWH´/DZPDNHUVDQG citizens of the Magna Charta Union Society of the 50 States, in order to demand respect from them. 7KH ³:KLWH´ 3HRSOHV RI WKH 8QLRQ DUH JXLGHGE\ WKHLU0DJQD &KDUWD WUDGLWLRQV DQG FXVWRPV and the Moors are guided by the Zodiac Constitution Law. Never the less, their customs and traditions, including themselves, must be respected by the Moors, without submitting themselves to any of the Manga Charta customs. That which is termed the Christian Law is, a rule of action recorded on paper and supported by authority and force. The Zodiac Law of Nature, is recorded in the wisdom of women and men, and supported by moral intelligence, The Greatest Law. Knowledge of Zodiac Masonry as shown in this Moorish Constitution, and also in my book ³&ORFN RI 'HVWLQ\´ 9ROXPH DQG ZLOO SUHYHQW D 0RRULVK $PHULFDQ +H RU 6KH IURP indulging in crime. They them would not have to appear in the court room to stand trial. Should a Moorish American who has this Constitution and Book 1 and 2 indulge in crime, such as; narcotics, robbery, forgery, prostitution, illegal whisky or alcohol, illegal schemes, gambling, peace breaking, violence and disrespect for the law of the City, Country, State and Federal, they then have incriminated themselves and therefore will be penalized. This constitution, card and book definitely does not protect criminals. BEWARE. The Clock of Destiny Moorish American Card of Identification and Constitution has been registered in the Library of Congress and signed by author: C. M. Bey. A Moorish American cannot be convicted on false accusation frame-up charges. The evidence against a Moorish American Must be concrete proof beyond a shadow of doubt. The Moorish Nation of 15,000,000 (1951) of U.S.A. shall not be destroyed for lack of truth and knowledge of the Law and constitution of the Moors. A rticle 7 T he Moorish A merican F reedom and L egal in the C hristian Union Court Room 137 In the Christian Union Court Room, the Moors cannot be forced to remove their Red Fez from their heads, nor can they be forced to raise their hand and take Oath over the Christian Bible. Neither FDQ0RRUVWKH%H\VDQG(OVHPSOR\³:KLWH´RU³1HJUR´ODZ\HUVWRUHSUHVHQWWKHP 7KHUHDVRQIRUWKLVLVWKDW³:KLWH´3HRSOHDQGWKHLU³1HJUR´VODYHVGHILQLWHO\FDQQRWUHSUHVHQW free Moorish Americans. The Negro is the property of the Union Slave Holders. The Moors must respect the court by VD\LQJ ³, DIILUP´ +HUH WKH FRXUW KDV QR MXULVGLFWLRQ RYHU WKHP ZKLFK DXWRPDWLFDOO\ PDNHV them qualified to defend themselves by their Zodiac Constitution Law and their mathematical number nine (9). The number nine (9) corresponds with the letter I, based on the nine months IURP FRQFHSWLRQ WR ELUWK ZKLFK PDNHV \RX \RXUVHOI 7KH *UHDW ³, $P´ WKH ILUVW DQG WKH highest law of self protection and self preservation in harmony with your Zodiac 12 signs unchanged constitution Moral Law of 360 degrees squared by your number nine (9). 7KH0RRULVK=RGLDF&RQVWLWXWLRQLVUHIHUUHGWRLQ&KULVWLDQP\WKRORJ\DV³7KH+RO\.RUDQ´ RU ³$O .RUDQ´ PHDQLQJ WKH (DUWK WKH 0RRQ WKH 6XQ DQG WKH VHYHQ SODQHWV RU &KURQRORJ\ Zodiac Record of the Moorish Nation of the North Gate, North America. The name ³0RKDPPHG´3URSKHW5HOLJLRQ*RG&KXUFK7HPSOHDQG0RVTXHZHUHHVWDEOLVKHGE\WKH Dutch-Anglo Saxon Priesthood Franciscan father of North who overthrew the Moorish Society of Islam between 1789 and the Union of 1863. The Moors, the Beys and Els, must never attempt to teach or lecture in the Christian Institutions, namely, Church, Temple, Mosque, School, and Hall. This is a violation of the Union Society States right Magna Charta Code of Mary and Christ. The truth of the Moorish Zodiac Constitution Law and moral human principles definitely conflicts with the Christian Union customs and Doctrine of the Magna Charta from every angle. Nor do not criticize the ³:KLWH´SHRSOH¶VEHOLHILQWKH religion of their son and women image. Nor do ever attempt to LQIOXHQFH WKH ³:KLWH´ SHRSOH WR DFFHSW WKH RUDO WUXWK DQG SULQFLSOHV RI \RXU VLJQV =RGLDF Constitutional Law, because the Magna Charta is a Latin phrase meaning, Magnate Charta of ³:KLWH´SHoples economic and social attraction only, which had its beginning in the Colonies of Ohio, Michigan, Indiana and Illinois in 1848 and 1854. If the lawmakers of the 50 Union States Society of North America, should attempt to ignore the 0RRULVK $PHULFDQ¶V Zodiac Law and birthrights of this constitution, it would be an act of supreme violation of their own Magna Charta Code. Wa Aliaikum As Salaam 138 -+6-+-&7!1(//#+!(-E'&((+8!0!1##$!0&!&'(!&()3!)(/-9(+&!! By: Garry: Webb: Bey January 09, 2009 Resident - One who has his residence in a place Residence - A factual place of abode. Living in a particular locality. It requires only bodily presence as an inhabitant of a place. A bode - ones home; habitation; place of dwelling; or residence. Ordinarily: means dRPLFLOHµ The term Resident is one of the most seminal concepts in the law, relating to status. This term is used in most state laws in this country to identify the party subject to the statutes. Whether it be the requirement to register a car and get a dULYHU¶VOLFHQVHRUWRSD\WD[HVWKHODZLPSRVHVDORW RIGXWLHVDQGUHVSRQVLELOLWLHVRQWKLVWKLQJFDOOHGDĴ5HVLGHQWµ Before we explore what exactly is this thing, called a Resident, it should be abundantly clear that the Resident is the object and subject of legislative authority. As explained in my article 14th A mendment C itizenship Is Not T rue Citizenship, under the original set up of the U.S., based on the principles espoused in The Declaration of Independence, the people were sovereigns. To undersWDQGWKHVLJQLILFDQFHRIVRYHUHLJQW\ZLWKUHVSHFWWROHJLVODWLYHDXWKRULW\,µOOTXRWH from the U.S. Supreme Court. In the case of Yick Wo v. Hopkins, the court stated: ³6RYHUHLJQW\LWVHOILVRIFRXUVHQRWVXEMHFWWRODZIRULWLVWKHDXWKRUDQGVRXUFH of law; but in our system, while sovereign powers are delegated to the agencies of government, sovereignty itself remains with the people, by whom and for whom all government exists and DFWV´ So if sovereignty is not subject to law and the people are sovereign then the people, acting within their sovereign rights, are not subject to the legislative authority. Notice that the statutes GRQµWVD\WKDWWKHSHRSOHRIWKLVVWDWHDUHUHTXLUHGWRUHJLVWHUWKHLUSURSHUW\JHWOLFHQVHVRUSD\ taxes on the fruits of their labor. As a further illustration of the people being the source of the legislative power, consider the enacting clause, which all laws must have to be constitutionally valid, of New York state: ³7KHHQDFWLQJFODXVHRIDOOELOOVVKDOOEH7KH3HRSOHRIWKH6WDWHRI1HZ York, represented in Senate and Assembly, do enact as follows, " and no law shall EHHQDFWHGH[FHSWE\ELOO´ 7KDWµVULJKWWKHOHJLVODWXUHRI1HZ<RUN6WDWHJHWVWKHLUDXWKRULW\WROHJLVODWHIURPĴ7KH 3HRSOHµ With this foundation we can begin to explore what this thing called a Resident is. A little HW\PRORJ\LVUHTXLUHG7KHWHUP5HVLGHQWFDQEHEURNHQGRZQLQWRWZRSDUWVĴ5HVµDQGĴ,GHQWµ 139 Res is a Latin word meaning WKLQJµDnd ,GHQWµLVWKHURRWRIWKHZRUGVĴ,GHQWLW\µDQG,GHQWLI\µ 6RWKHWHUP5HVLGHQWOLWHUDOO\PHDQVʊDWKLQJLGHQWLILHGۅ The next question to be answered is: What is the nature and characteristics of this thing being identified as such? We already know that this thing being identified is not the sovereign and is subject to legislative control. /HWµVJREDFNWRWKHGHILQLWLRQVDQGVHHZKDWFOXHVZHFDQILQG According to the legal definitions, residence is based on physical presence in a particular place. However, before one jumps to the conclusion that by ones mere presence in a particular location one automatically becomes the Resident subject to the statutes, remember that such conclusion would be a contradiction of the rights inherent in the sovereign people. So there must be another element present, that we have yet to take into account. For that missing element we must H[DPLQHWKHWHUPĴ'RPLFLOHµ Domicile. That place where a man has his true, fixed, and permanent home and principle establishment, and to which whenever he is absent he has the intention of returning. There is, in the law, a concept called: Fiction of Law; a fiction of law is something known to be false but assumed to be true. An assumption or supposition of law that something which is or may be false is true, or that a state of facts exists which has never taken place.1 This is what the term domicile is based on ± fictions of law. The ideas of fixed and permanent are fictions. Change being the only constant in the universe, there is nothing on the material plane that is permanent. One of the most basic ways for fictions to be presumed true are by way of contract. In contract law there is such a thing called Situs or Forum Contractus. It means a place where a contract is made ± a place that has jurisdiction over the contract. That contractual place can be fixed and permanent. Corporations are creatures of statute. They are not real. They exist on paper. They are contemplations of law ± hence fictions. The location where they are created it fixed and is indicated by an address. The corporation cannot move around. However, if a corporation sets up operations in a state different from the one in which it was created, it becomes a foreign corporation in that state and is subject to the rules of foreign entities in that state. In other words, it has no inherent rights in that state. Why am I using this example? And what does this have to do with the term Resident? 1Blacks Law Dictionary - 4th Ed. Pg. 751 140 Remember our definition states that residence requires only physical presence in a particular place. So being a Resident implies being foreign to the place where the entity resides, based on where it was created. If that is not clear at this point, let me provide an example, based on the understanding of contract. The 14th Amendment citizen has its origin and creation from the Federal Government. The seat of the Federal Government is in Washington, D.C. This is where the federal legislative authority and jurisdiction exists. Under the defiQLWLRQRI6LWXVLWVWDWHVLQSDUWʊ the place where a thing is considered, for H[DPSOHZLWKUHIHUHQFHWRMXULVGLFWLRQRYHULWRUWKHULJKWRUSRZHUWRWD[LW´ $QGXQGHU)RUXP&RQWUDFWXVLWUHDGVLQSDUWʊ the place where a contract is made, consLGHUHGDVDSODFHRIMXULVGLFWLRQ´ 'R\RXJHWLWQRZ"6WLOOGRQµWVHHKRZ\RXFRQWUDFWHGZLWKWKH'LVWULFWRI&ROXPELD"+RZ about Social Security? /HWµVORRNDWDQRWKHUDVSHFWRIFRQWUDFWODZ± &RQVHQVXDO&RQWUDFWʊ A term derived from the civil law, denoting a contract founded upon and completed by the mere consent of the contracting parties, without any external formality or symbolic act to fix the obligation ۅ Did you read Slavery Is Not F ree"5HDGLWDJDLQ$FFHSWDQFHLVFRQVHQW<RXGRQµWHYHQKDYH to sign anything. You want an example of signing something which places you contractually in the District of Columbia? Whenever you deal formally with the federal government, the form or application you are required to fill out usually has a sworn statement at the end stipulating that the information you provided is true and correct under penalties of perjury. Well there are two kinds of perjury statements ± RQHIRUĴZLWKLQµWKH8QLWHG6WDWHVDQGRQHIRUĴZLWKRXWµWKH8QLWHG6WDWHV Guess which perjury statement is used on the Form W-4? Guess which one is used on Form SS4? Accordingly, this puts you inside of the District of Columbia ± inside the exclusive jurisdiction of the federal government. This is where you exist as a political entity. You are a foreigner in the states of the Union. Therefore, you are a Resident ± a foreigner, with no rights in the states of the Union. Thus as a Resident you have to be regulated as such and are required to follow all codes, rules, regulations, and ordinances of the state. When one has no rights everything becomes a privilege, and a tax must be paid for the privilege. When you pay a tax in New York State, what is the form called? NYS Resident Tax Return. Come out of her my People! M y people are destroyed for lack of knowledge. 141 ,I\RXGRQµWNQRZ\RXUULJKWV\RXGRQµWKDYHDQ\ Oh by the way, under the term Resident it states: ³$OVRa tenant, who was obliged to reside on KLVORUGࣔVODQGDQGQRWWRGHSDUWIURPWKHVDPHFDOOHGDOVR³KRPPHOHYDQWHWFRXFKDQW´ DQGLQ1RUPDQG\³UHVVHDQWGXILHI´ Till next time. Fez Associates, LLC. Fez45@hotmail.com References Blacks Law Dictionary, 4th Edition - pgs. 20, 377, 572, 751, 783,1473, & 1558 Yick Wo v. Hopkins, 118 U.S. 356 NYS Constitution, Art.3 sec.13 U.S. Constitution, Art.1 sec.8 cl.17, Art.1 sec.10 142 -+6-+-&7!1(//#+!+-+(&((+8!"0/-5/!#6!9)06&-+E!0!/,-&(!! W/ Sister Anaid El 7RGD\¶VFODVVLVWKHODVWRID-week course, and is centered on drafting a suit, which LQFOXGHVDQ³,QIRUPD3DXSHULV´DQGD³&HUWLILFDWHRI6HUYLFH´ The Colorable Courts coerce the people into paying them in order for the people to exercise WKHLUULJKWV7KLVLVWKHLUZD\RIGHQ\LQJ³GXHSURFHVVRIODZ´DVRQHcannot be denied WKHLU ULJKWV FDVHG RQ ZKHWKHU RU QRW WKH\ KDYH ³PRQH\´ 7KHUHIRUH DQ ,QIRUPD 3DXSHULV¶ LV submitted to the Courts to that end. A Certificate of Service shows that all involved in the suit have been served. One does not have to utilize and pay a Sheriff to serve paperwork. They can use the United States Post Master, via certified return receipt. The following are some terms, law, and information to assist you in gaining the proper concept(s) for a Suit. ³«&RQJUHVVFDQQRWDXWKRUL]HDWUDGHRUEXVLQHVVZLWKLQD6WDWHLQRUGHUWRWD[LW´ L icense T ax C ases, 72 U.S. 462, 18 L .E d. 497, 5 W all. 462, 2A. F. T .R. 2224 (1866) ³/RVVRI)LUVW$PHQGPHQW)UHHGRPVIRUHYHQPLQLPDOperiods of time, unquestionably FRQVWLWXWHVLUUHSDUDEOHLQMXU\´E lrod Vs Burns, 427 U.S. 347; 6 S. C t. 2673; 49 L . E d. 2d (1976) T he Zodiac Constitution, A rticle I The twelve Signs of the Zodiac, The Code of Mathematics scaling from zero to nine (09), and the Science of Geometry (G), comprise the Constitution of the Living Moorish Nation RI1RUWK$PHULFDUHIHUUHGWR$V³1HJURHV´ZKRUXOHGWKHZRUOGDQGWKH6HYHQ6HDVE\WKH Signs of The Zodiac and the Science of Geometry (D), for eleven hundred and ninety-six years, to the Amazon Dutch-German Catholic Priesthood Fathers of the Revolution of 1789, and the 6LVWHUKRRG 0DJQD &KDUWD (PDQFLSDWLRQ 3URFODPDWLRQ 8QLRQ 6RFLHW\ RI $OELRQ (XURSHDQ¶ erroneously called White) Supremacy, in 1863 North America. The Twelve Jurymen of the 50 United States Society, and also the nine judges of the 6XSUHPH&RXUWZHUHIRXQGHGXSRQWKH0RRULVK1DWLRQ¶V6LJQVRIWKH=RGLDF&RQVWLWXWLRQ and Mathematics scaling from zero to nine (0-9). Thus without our Moorish Constitution, the 0DJQD&KDUWD (PDQFLSDWLRQ 3URFODPDWLRQ 8QLRQ 6RFLHW\ RIWKH 0\WK RI $OELRQ (XURSHDQ¶ erroneously called White) Supremacy, Definitely could have been found in 1863. T he Zodiac Constitution, A rticle I I Zodiac Constitution Birthright of the Moorish A merican (the Beys and Els) Since the 12 Jurymen of the 50 Union States Magna Charta document of Albion (XURSHDQ¶HUURQHRXVO\FDOOHG:KLWH 6XSUHPDF\DQGWKHQLQHMXGJHVRIWKHLU6XSUHPH&RXUW were founded upon our Moorish Zodiac 12 Signs, Mathematical Constitution, the lawmakers 143 have no jurisdiction over the Free Moors, the Beys and Els, in the inherited land of the Moorish Nation, namely: United States for America, Canada, Central and South America. The Moorish American Nationality and their sir names, Beys and Els, and their inherited birthrights without a legal due process of the lawmakers if the Union Society, United States of America what our Moorish forefathers were, we are today without a doubt or contradiction, namely, Moorish! United States Republic Constitution, A rticle V I All debts contracted and engagements entered into, before the adoption of this Constitution, shall be as valid against the United States under this Constitution, as under the Confederation. his Constitution, and the laws of the United States which shall be made in pursuance thereof; and all treaties made, or which shall be made, under the authority of the United States, shall be the supreme law of the land; and the judges in every state be bound thereby, anything in the Constitution or laws of any State to the contrary notwithstanding. he Senators and Representatives before mentioned, and the members of the several state legislatures, and all executive and judicial officers, both of the United States and of the several states, shall be bound by oath or affirmation, to support this Constitution; but no religious test shall ever be required as a qualification to any office or public trust under the United States. United States Republic Constitution, A rticle I I I, Section I I The judicial power shall extend to all cases, in law and equity, arising under this Constitution, the laws of the United States, and treaties made, or which shall be made, under their authority; --to all cases affecting ambassadors, other public ministers and consuls; --to all cases of admiralty and maritime jurisdiction;--to controversies to which the United States shall be a party; -to controversies between two or more states; --between a state and citizens of the another state; --between citizens of different states; -- between citizens of the same state claiming lands under grants of different states, and between a state, or the citizens thereof, and foreign states, citizens or subjects. In all cases affecting ambassadors, other public ministers and consuls, and those in which a state shall be party, the Supreme Court shall have original jurisdiction. In all the other cases before mentioned, the Supreme Court shall have appellate jurisdiction, both as to law and fact, with such exceptions, and under such regulations as the Congress shall make. The trial of all crimes, except in cases of impeachment, shall be by jury; and such trial shall be held in the state where the said crimes shall have been committed; but when not committed within any state, the trial shall be at such place or places as the Congress may by law have directed. T he United States Republic Constitution, A rticle I, Section X, C lause I ± No State shall enter into any T reaty, A lliance, or Confederation; grant Letters of Marque and 144 Reprisal; coin Money; emit Bills of Credit; make any Thing but gold and silver Coin a Tender in Payment of Debts; pass any Bill of Attainder, ex post facto law, or Law impairing, or grant any title of Nobility. United State Republic Constitution, O riginal 13 th A rticle of the Bill of Rights, Section 12 The traffic in slaves with Africa is hereby forever prohibited on pain of death and forfeiture of all the rights and property of persons engages therein; and the descendants of Africans shall not be citizens. Foreign Jurisdiction in Statues for Connecticut: Section 14 ± 40: O peration of motor vehicle owned by resident of foreign country. Any motor vehicle or trailer owned or operated E\DUHVLGHQWIRUDIRUHLJQFRXQWU\ZKLFKFRXQWU\DGKHUHVWRWKHDUWLFOHVRIWKH³,QWHUQDWLRQDl &RQYHQWLRQ´KHOGLQ3DULV$SULOth, 1926, or amendments thereto, relative to the operation of motor vehicles, may be operated on the highways of this state without registration, provided VXFKQRQUHVLGHQWRSHUDWRU¶VOLFHQVHDQGSURYLGHGVXFKPRWRUYHKLcle is legally registered in the country of his residence and also bears an international registration. United States Republic Constitution, A rticle I, Section 8, C lause 17 To exercise legislation in all cases whatsoever, over such District (not exceeding ten miles square) as may, by cession of particular states, and the acceptance of Congress, become the seat of the government of the United States, Requires that all public offices must be exercised O N L Y in the District of Columbia and not elsewhere, except as expressly provided by law. Unites States Republic Constitution, A rticle I, Section I X , C lause V I I I No title of nobility shall be granted by the United States: and no person holding any office of profit or trust under them, shall, without the consent of the Congress, accept of any present, emolument, office, or title, of any kind whatever, from any king, prince, or foreign state. See also Article VI of the Article of Confederation Unites States Republic Constitution, O riginal A rticle X I I I of the Bill of Rights If any citizen of the United States shall accept, claim, receive, or retain any title of nobility or honour, or shall without the consent of Congress, accept or retain any present, pension, office, or emolument of any kind whatever, from any emperor, king, prince, or foreign power, such person shall cease to be a citizen of the United States, and shall be incapable of holding office of trust or profit under them, or either of them. T he above affirms that they cease to be a citizen of the United States therefore they cannot hold any office in federal or states government; A nyone who become a member of the B.A.R. associations headquarters is in the United K ingdom. 145 United States Republic Constitution, A rticle I V , Section I V The United States shall guarantee to every state in this union a republican form of government, and shall protect each of them against invasion; and on application of the legislature, or of the executive (when the legislature cannot be convened) against domestic violence. Protect every state from invasion by either other states of the federal government. A ny attempt to destroy rights, and especially through compelled participation in E uropean foreign jurisdiction (Union States), is an invasion in every sense of the word, even though not a physical or military invasion United States Republic Constitution, A mendment I Congress shall make no law respecting an establishment of religion, or prohibiting the free exercise thereof; or abridging the freedom of speech, or of the press; or the right of the people peaceably to assemble, and to petition the government for a redress of grievances. United States Republic Constitution, A mendment I V The right of the people to be secure in their persons, houses, papers, and effects: against unreasonable searches and seizures, shall not be violated, and no warrants shall issue, but upon probable cause, supported by oath or affirmation, and particularly describing the place to be searched, and the persons of things to be seized. United States Republic Constitution, A mendment V No person shall be held to answer for a capital, or otherwise infamous crime, unless on a presentment or indictment of a grand jury, except in cases arising in the land or naval forces, or in the militia, when in actual service in time of war or public danger; nor shall any person be subject for the same offense to be put in jeopardy of life or limb; nor shall be compelled in any criminal case to be a witness against himself, nor be deprived of life, liberty, or property, without due process of law; nor shall private property be taken for public use, without just compensation. United States Republic Constitution, A mendment V I In all criminal prosecutions, the accused shall enjoy the right to a speedy and public trial, by an impartial jury of the state and district wherein the crime shall have been committed, which district shall have been previously ascertained by law, and to be informed of the nature and cause of the accusation; to be confronted with the witnesses against him; to have compulsory process for obtaining witnesses in his favor, and to have the assistance of counsel for his defense. United States Republic Constitution, A mendment V I I In suits at common law, where the value in controversy shall exceed twenty dollars, the right of trial by jury shall be preserved, and no fact tried by a jury, shall be otherwise reexamined in any court of the United States, than according to the rules of the common law. 146 United States Republic Constitution, A mendment V I I I Excessive bail shall not be required, nor excessive fines imposed, nor cruel and unusual punishments inflicted. United States Republic Constitution, A mendment I X The enumeration in the Constitution, of certain rights, shall not be construed to deny or disparage others retained by the people. United States Republic Constitution, A mendment X The powers not delegated to the United States by the Constitution, nor prohibited by it to the states, are reserved to the states respectively, or to the people. T he United States Department of Justice ± Moorish C redentials: A A 222141 ± T ruth A ± 1 ± See Lesson Book 14 United Nations Declaration of H uman Rights A rticle F ifteen (15) United Nation Rights of Indigenous Peoples Part 1, A rticle Four (4) United Nations Rights of the C hild, Principal T hree (3) T itle 18, Part I, C hapter 13, Section 241 Conspiracy against rights If two or more persons conspire to injure, oppress, threaten, or intimidate any person in any State, Territory, Commonwealth, Possession, or District in the free exercise or enjoyment of any right or privilege secured to him by the constitution or laws of the United States, or because of his so exercised the same; or If two or more persons go in disguise on the highway, or on the premises of another, with intent to prevent or hinder his free exercise or enjoyment of any right or privilege so secured ± They shall be fined under this title or imprisoned not more than ten years, or both; and if death results from the acts committed in violation of this section or if such acts include kidnapping or an attempt to kidnap, aggravated sexual abuse or an attempt to commit aggravated sexual abuse, or an attempt to kill, they shall be fined under this title or imprisoned for any term of years or for life, or both, may be sentenced to death. T itle 18, Part I, C hapter 13, Section 242 Deprivation of rights under color-of-law Whoever, under color of any law, statute, ordinance, regulation, or custom, willfully subjects any person in any State, Territory, Commonwealth, Possession, or District to the deprivation of any rights, privileges, or immunities secured or protected by the Constitution or laws of the United States, or to different punishments, pains, penalties, on account of such person being an alien, or by reason of his color, or race, than are prescribed for the punishment of citizens, shall be fined under this title or imprisoned not more than one year, or both; and if bodily injury results from the acts committed in violation of this section or if such acts include the use, attempted use, or threatened use of a dangerous weapon, explosives, or fire, shall be 147 fined under this title or imprisoned not more than ten years, or both; and if death results from the acts committed in violation of this section or if such acts include kidnapping or an attempt to kidnap, aggravated sexual abuse, or an attempt to commit aggravated sexual abuse, or imprisoned for any term of years or for life, or both, or may be sentenced to death. T I T L E 18 § 219 ± O fficers and employees acting as agents of foreign principals T I T L E 18 § 247 - Damage to religious property; obstruction of persons in the free exercise of religious beliefs T I T L E 18 § 654 ± O fficer or employee of the United State converting property of another T I T L E 18 § 872 ± E xtortion by officers or employees of the United States T I T L E 18 § 873 ± Blackmail T I T L E 18 § 876 ± mailing threatening communications T I T L E 18 § 877 ± Mailing threatening communications from foreign country T I T L E 18 § 878 ± T hreats and extortion against foreign officials, official guests, or internationally protected persons T I T L E 18 § 880 ± Receiving the proceeds of extortion T I T L E 18 § 1581 ± Peonage; obstructing enforcement T I T L E 18 § 1583 ± E nticement into slavery T I T L E 18 § 1584 ± Sale into involuntary servitude T I T L E 18 § 1589 ± Forced labor T I T L E 18 § 1951 ± Interference with commerce by threats or violence T I T L E 18 § 1956 ± L aundering of monetary T I T L E 18 § 1957 ± E ngaging in monetary transactions in property derived from specified unlawful activity T I T L E 18 § 1959 ± V iolent crimes in aid of racketeering activity T itle 18, Part I, C hapter 115, Section 2381 T reason Whoever, owing allegiance to the United States, levies war against them or adheres to their enemies, giving them aid and comfort within the United States or elsewhere, is guilty of treason and shall suffer death, or shall be imprisoned not less than five years and fined not less than 10,000; and shall be incapable of holding any office under the United States. 148 T itle 18, Part I, C hapter 115, Section 2382 Misprision of T reason Whoever, owing allegiance to the United States and having knowledge of the commission of any treason against them, conceals and does not, as soon as may be, disclose and make known the same to the President or to some particular State, is guilty of misprision of treason and shall be fined under this title or imprisoned not more than seven years, or both. 149