e su Is 10 Manufacturers of Visual & Audible Signalling Devices 6LJQDOOLQJ'HYLFHVZZZPRÁDVKFRP INTRODUCTION MOFLASH :HOFRPHWR 0RÀDVK 0RÀDVKLVWKHODUJHVWLQGHSHQGHQW PDQXIDFWXUHURIVLJQDOOLQJGHYLFHVLQWKH8. Based in Birmingham at the heart of Great %ULWDLQ0RÀDVK6LJQDOOLQJLVWKHODUJHVW LQGHSHQGHQWPDQXIDFWXUHURIVLJQDOOLQJ GHYLFHVLQWKH8.)RUPHGIURPWKH0RÀDVK Company Co Ltd in 1998, the company KDVJURZQGUDPDWLFDOO\RYHUWKHODVW years with the introduction of a number of QHZSURGXFWOLQHVDQGZLWKWKHDFTXLVLWLRQRI VLJQDOOLQJSURGXFWVIURPRWKHUPDQXIDFWXUHUV VXFKDVWKH.OD[RQUDQJHRIKRRWHUVDQG KRUQVQRZSURGXFHGLQWKH0RÀDVKIDFWRU\ 7KHFRPSDQ\SURGXFHVWKHIROORZLQJW\SHV RIGHYLFHV,QFDQGHVFHQW%HDFRQVERWK ÀDVKLQJDQGVWDWLF/('/LJKW(PLWWLQJ 'LRGH;HQRQ%HDFRQVDQGWKHWUDGLWLRQDO Rotating Beacons. On the acoustic side of the business, the FRPSDQ\RIIHUVLQFOXGLQJ$LU+RUQV%HOOV %X]]HUV(OHFWURQLF6RXQGHUV+RRWHUVDQG 3LH]RGHYLFHVIRUWKHIROORZLQJPDUNHWV shown on the right. 0RÁDVK0DUNHWV ,QGXVWULDO 3URFHVV&RQWURO 6WDWXV,QGLFDWLRQ )LUHDQG6HFXULW\ ([SORVLYH(QYLURQPHQWV 2EVWUXFWLRQ0DUNLQJ 0RÀDVKVHUYHVDGLYHUVHUDQJHRIFXVWRPHUVIURPHOHFWULFDOZKROHVDOHUVFRQWUDFWRUVWRJOREDO GLVWULEXWLRQRUJDQLVDWLRQVRULJLQDOHTXLSPHQWPDQXIDFWXUHUVDQGDYDULHW\RIHQGXVHUVVXFKDV PLQLQJPDQXIDFWXULQJHOHFWULFDODQGJDVXWLOLWLHVWRQDPHEXWDIHZ :LWK LWV SURJUDPPH RI GHYHORSPHQW 0RÀDVK LV LQ D VWURQJ SRVLWLRQ WR NHHS PHHWLQJ WKH LQFUHDVLQJGHPDQGVRIDVDIHW\FRQVFLRXVZRUOG:LWKDGHGLFDWHGWHDPEDVHGLQWKH8.DQG WKURXJKWKHH[FHOOHQWUHODWLRQVKLSVYLDORFDOGLVWULEXWRUVDQGSDUWQHUV0RÀDVKFDQVXFFHVVIXOO\ SURPRWHDQGVHOOLWVSURGXFWUDQJHWRRYHUFRXQWULHVZRUOGZLGH 2XUSURGXFWVDUHDOZD\VDYDLODEOHWRPHHWWKHFXVWRPHU¶VQHHGV0RÀDVKFDQPRGLI\RUGHVLJQ DEHDFRQWR\RXUVSHFL¿FQHHGV,IRXUVWDQGDUGSURGXFWVDUHRXWVLGHWKHVFRSHRI\RXUSURMHFW SOHDVHVSHDNZLWKRXUWHFKQLFDOGHSDUWPHQWWRVHHLIZHFDQKHOSRUHPDLO\RXUUHTXLUHPHQWV YLDRXUFRQWDFWSDJHRQWKH0RÀDVKZHEVLWHZZZPRÀDVKFRP$OOSURMHFWVZLOOEHFRQVLGHUHG RQWKHLUFRPPHUFLDOYLDELOLW\ $QG¿QDOO\RXUFRPPLWPHQWWRTXDOLW\DQGVHUYLFHFRQWLQXHVWRGD\DVLWGLGZKHQZHIRUPHG \HDUVDJRLWXQGHUSLQVRXUIRFXVDQGSDVVLRQIRURXULQGXVWU\ Marine $XWRPRWLYH 6DIHW\DQG3URWHFWLRQ FM 558977 ,PDJH1HZ0RÀDVK8.+HDGTXDUWHUV &217(176 6HOHFWLRQ$SSOLFDWLRQ 3DJH P (QYLURQPHQWDO)DFWRUV!7\SHVRI%HDFRQV!/HYHOVRI%ULJKWQHVV! /HQV&RORXU!$XGLELOLW\!,QVWDOODWLRQ!0DUNV'LUHFWLYHV!,35DWLQJV!,FRQ/HJHQGV )ODVKLQJ)LODPHQW%HDFRQ5DQJH P ))!))',1))$!))!)) 6WDWLF)LODPHQW%HDFRQ5DQJH P 6)!6)',1 /('%HDFRQ5DQJH P /('!/('!/(''/('$!/('6!/('$/(''!/('!/('!/('! /('()ODUH3RUWDEOH!/('7/0!/('$7ULFRORXU!/('$7ULFRORXU6SHFWUXP! 5RWDWLQJ%HDFRQ5DQJH P 5!5$!5 ;HQRQ%HDFRQ5DQJH P ;!;!;',1!;$!;!;!;!;!;6'6! ;!;!; %HDFRQ$FFHVVRU\5DQJH P :DOO%UDFNHWV!&DJH*XDUGV!3LSH%UDFNHWV! $QWL9LEUDWLRQ0RXQWV!'RPHV $XWRPRWLYH%HDFRQ5DQJH 5!; 2EVWDFOH0DUNLQJ/LJKW5DQJH,&$2$SSURYHG 2EVWDFOH0DUNLQJ&DQGHOD!))&DQGHOD!&DQGHOD ([G([SORVLRQ3URRI5DQJH *53%&!6'!6%!6%!6/!&3!&3!-%!3%!3%! 6WDLQOHVV6WHHO%&!6'!6%!6%!6/!&3!-%!3%! +=()ODUH%HDFRQ $FRXVWLF5DQJH P P P P 3LH]R%X]]HUV!0HFKDQLFDO,QGXVWULDO%X]]HUV!(OHFWURQLF6RXQGHUV!(1!6LUHQV! $%+)%X]]HUV!$GDSWDKRUQV!,QGXVWULDO+RRWHUV!$LUKRUQV!%HOOV 6LJQDOOLQJ'HYLFHVZZZPRÁDVKFRP 6(/(&7,21$33/,&$7,21 MOFLASH 6HOHFWLRQ$SSOLFDWLRQ 7\SHVRI:DUQLQJ6LJQDOV$XGLEOH $XGLEOH9LVXDO:DUQLQJ6LJQDOV $LUKRUQV 7KHHQYLURQPHQWLQZKLFKWKHZDUQLQJVLJQDOLVWREHLQVWDOOHGZLOO GHWHUPLQHWKHSURGXFWVHOHFWLRQ $VLJQDOGHVLJQHGIRUKHDY\LQGXVWULDODSSOLFDWLRQVLQFRUSRUDWLQJ DKLJKGHFLEHOG%UDWLQJKLJKOLJKWLQWHQVLW\-ZRXOGQRWEH VXLWDEOHIRUORFDOVLJQDOOLQJDWDFRQWUROSDQHO$OWHUQDWLYHO\DORZG% OLJKWLQWHQVLW\-ZRXOGEHLQHIIHFWLYHIRUDODUJHIDFWRU\HQYLURQPHQW 0RÀDVKFDQVXSSO\ZDUQLQJVLJQDOVWRFRYHUDOODSSOLFDWLRQVDQGOLVWHG EHORZDUHVRPHRIWKHPDLQPDUNHWDUHDV ,QGXVWULDO0DULQH :DUQLQJVLJQDOVIRUKHDY\GXW\KLJKOLJKWRXWSXWDSSOLFDWLRQVVXFKDV IRXQGULHVIDFWRU\VKRSÀRRUVODUJHZDUHKRXVHVGRFNVSRUWVDQG JHQHUDORIIVKRUHXVHHWF)RUIXUWKHULQIRUPDWLRQVHHRXU,QGXVWULDO 0DULQHDQG$FRXVWLFVHFWLRQV $XWRPRWLYH :DUQLQJEHDFRQVIRUXVHRQDXWRPRELOHVFRPPHUFLDOSULYDWH DJULFXOWXUDORIIURDGYHKLFOHVDQGIRUNOLIWWUXFNVHWF )RUIXUWKHULQIRUPDWLRQVHHRXU$XWRPRWLYHVHFWLRQ )LUH :DUQLQJVLJQDOVGHVLJQHGFRPSO\LQJZLWKWKHODWHVW(XURSHDQ VWDQGDUGVIRUXVHLQDOOFRPPHUFLDOEXLOGLQJVXVHGDV¿UHHYDFXDWLRQ VLJQDOV)RUIXUWKHULQIRUPDWLRQVHHRXU$FRXVWLFVHFWLRQ 2EVWDFOH0DUNLQJIRU$HURGURPHV 9LVXDOZDUQLQJVLJQDOVWKDWFRPSO\ZLWKWKH,QWHUQDWLRQDO&LYLO$YLDWLRQ $XWKRULW\,&$2UHTXLUHPHQWIRUWKHPDUNLQJRIREMHFWVLQDURXQG $HURGURPHV)RUIXUWKHULQIRUPDWLRQVHHRXU2EVWDFOH0DUNLQJVHFWLRQ ([SORVLRQ3URRI :DUQLQJ6LJQDOVGHVLJQHGIRUXVHLQSRWHQWLDOO\H[SORVLYHDWPRVSKHUHV DQGFRPSO\LQJZLWKWKHODWHVWJOREDOVWDQGDUGV7\SLFDOO\XVHGRQRLO ULJVUH¿QHULHVFKHPLFDOSODQWVJUDLQVWRUDJHHWFZKHUHLQQRUPDO RSHUDWLRQVWKHDWPRVSKHUHLVÀDPPDEOHLJQLWDEOHHWF )RUIXUWKHULQIRUPDWLRQVHHRXU([G([SORVLRQ3URRIVHFWLRQ (QYLURQPHQWDO)DFWRUV GHWHUPLQLQJ6HOHFWLRQ $VDIHRUSRWHQWLDOO\H[SORVLYHDWPRVSKHUH 7KHDPELHQWOHYHORIQRLVHDQGRUEULJKWQHVV z The ambient temperature z 7KHGXUDWLRQWKHVLJQDOKDVWRRSHUDWHIRU z 7KH,QJUHVVSURWHFWLRQ,3UHTXLUHGRIWKHVLJQDOHQFORVXUH z 7KHHOHFWULFDOVXSSO\DYDLODEOH z z $LUKRUQVDUHQRQHOHFWULFDOGHYLFHVWKDWRQO\RSHUDWHIURPDFRPSUHVVHG DLUVXSSO\7KH\RIIHUYHU\KLJKG%RXWSXWZLWKYHU\ORZIUHTXHQF\VRXQG PDNLQJWKHPLGHDOIRUYHU\QRLV\HQYLURQPHQWV0RÀDVKRIIHUVDQ LQGXVWULDODQGPDULQHUDQJH%HLQJQRQHOHFWULFDOWKH\FDQEHXVHGLQ hazardous area Category 1 use. %HOOV %HOOVDUHDFRVWHIIHFWLYHWUDGLWLRQDOVLJQDOOLQJGHYLFHZLWKDZLGHUDQJHRI VLJQDOOLQJDSSOLFDWLRQV7KH\RIIHUPHGLXPG%RXWSXWZLWKDXQLTXHVRXQG 0RÀDVKRIIHUVWZRW\SHVRIVROHQRLGGULYHQXQLWVIRUKHDY\GXW\LQGXVWULDO PDULQHDSSOLFDWLRQVDQGDQDOWHUQDWLYHHFRQRP\XQLWIRUOLJKWLQGXVWULDO FRPPHUFLDODSSOLFDWLRQV %X]]HUV (LWKHU(OHFWUR0HFKDQLFDOW\SHZKHUHWKHGLDSKUDJPLVGHÀHFWHGE\D PRYLQJPDJQHWZKLFKLVWULJJHUHGE\DPDNHDQGEUHDNFRQWDFWRURUWKH 3LH]RW\SHZKHUHWKHGLDSKUDJPLVFRQWUROOHGE\DQHOHFWURQLFFLUFXLW 7KH0HFKDQLFDOYHUVLRQVRIIHUPHGLXPKLJKG%RXWSXWZLWKORZIUHTXHQF\ sound and are of robust construction. 3LH]RYHUVLRQVDUHUHODWLYHO\ORZG%DQGKLJKIUHTXHQF\DQGDUHRQO\ VXLWDEOHIRUORFDOVLJQDOOLQJDSSOLFDWLRQV (OHFWURQLF6RXQGHUV (OHFWURQLFVRXQGHUVDUHQRZWKHPRVWYHUVDWLOHDXGLEOHZDUQLQJGHYLFHV RQWKHPDUNHWWRGD\ :LWKPXOWLSOHWRQHGHFLEHOVHOHFWLRQVWKHVHW\SHRISURGXFWVZLOOVDWLVI\ PRVWDSSOLFDWLRQVZLWKWKHDGGHGEHQH¿WRIUHPRWHWRQHVHOHFWLRQYRLFH activation. +RRWHUV +RRWHUVDUHSRZHUIXOPRWRUGULYHQKRUQVSURGXFLQJWKHXQLTXHDQGQHYHU IRUJRWWHQµ.OD[RQ¶VRXQGXVHGWKHZRUOGRYHU$VHUDWHGURWRUGULYHQ DJDLQVWDKDUGHQHGVWHHOGLDSKUDJPVWXGFUHDWHVDKLJKG%RXWSXWZLWK ORZIUHTXHQF\VRXQG7KHVHW\SHVRIVLJQDOVDUHLGHDOIRULQGRRUDQG RXWGRRUDSSOLFDWLRQVZKHUHDUXJJHGDQGGXUDEOHVRXQGHULVUHTXLUHG 6LUHQV 6LUHQVDUHSRZHUIXOPRWRUGULYHQVLJQDOVGULYLQJDQLQWHUQDOLPSHOORU WKURXJKDVORWWHGFRYHUFUHDWLQJDXQLTXHSHQHWUDWLQJVRXQG7UDGLWLRQDOO\ UHFRJQLVDEOHIRUFUHDWLQJWKHµDLUUDLG¶ZDUQLQJVLJQDO 6(/(&7,21$33/,&$7,21 MOFLASH 1RWH: (YHU\WLPHWKHGLVWDQFHLVGRXEOHGWKHGHFLEHOVZLOOEHUHGXFHGE\ P $WWHQXDWLRQ&KDUWG%$ 1 65 70 75 80 85 90 92 94 96 98 100 102 104 106 108 110 112 114 116 118 120 122 124 126 128 130 2 59 64 69 74 79 84 86 88 90 92 94 96 98 100 102 104 106 108 110 112 114 116 118 120 122 124 3 55 60 65 70 75 80 82 84 86 88 90 92 94 96 98 100 102 104 106 108 110 112 114 116 118 120 5 51 56 61 66 71 76 78 80 82 84 86 88 90 92 94 96 98 100 102 104 106 108 110 112 114 116 10 45 50 55 60 65 70 72 74 76 78 80 82 84 86 88 90 92 94 96 98 100 102 104 106 108 110 20 39 44 49 54 59 64 66 68 70 72 74 76 78 80 82 84 86 88 90 92 94 96 98 100 102 104 30 35 40 45 50 55 60 62 64 66 68 70 72 74 76 78 80 82 84 86 88 90 92 94 96 98 100 50 = 36 41 46 51 56 58 60 62 64 66 68 70 72 74 76 78 80 82 84 86 88 90 92 94 96 = = 40 45 50 52 54 56 58 60 62 64 66 68 70 72 74 76 78 80 82 84 86 88 90 = 39 44 46 48 50 52 54 56 58 60 62 64 66 68 70 72 74 76 78 80 82 84 = 40 42 44 46 48 50 52 54 56 58 60 62 64 66 68 70 72 74 76 78 80 = 38 40 42 44 46 48 50 52 54 56 58 60 62 64 66 68 70 72 74 76 = = = 38 40 42 44 46 48 50 52 54 56 58 60 62 64 66 68 70 = = = 38 40 42 44 46 48 50 52 54 56 58 60 62 64 = = 38 40 42 44 46 48 50 52 54 56 58 60 = = 38 40 42 44 46 48 50 52 54 56 100 200 300 500 1000 2000 3000 5000 1RWH: 7KLVFKDUWGLVSOD\VWKHWKHRUHWLFDOGHFLEHODWWHQXDWLRQLQSHUIHFWFRQGLWLRQVLQDQRSHQDUHDZLWKRXWREVWUXFWLRQ,QDGGLWLRQWKHVRXQGIUHTXHQF\RIWKHVLJQDOXVHG ZLOOKDYHDPDUNHGHIIHFWRQWKHGHFLEHOUHDGLQJDWDQ\JLYHQSRLQW$PXFKORZHUWKHVRXQGIUHTXHQF\ZLOODFKLHYHDKLJKHUG%UDWLQJRYHUORQJHUGLVWDQFHVVD\ G%DJDLQVWWKLVWDEOHWKDQDPXFKKLJKHUVRXQGIUHTXHQF\VD\G% 6(/(&7,21$33/,&$7,21 MOFLASH 7\SHVRI:DUQLQJ6LJQDOV9LVXDO /('%HDFRQV¶/('· $OLJKWHPLWWLQJGLRGH/('LVDVHPLFRQGXFWRUGHYLFHWKDWHPLWV YLVLEOHOLJKWZKHQDQHOHFWULFFXUUHQWSDVVHVWKURXJKLW7KHIRXUPDMRU EHQH¿WVRI/('WHFKQRORJ\LQFRUSRUDWHGLQWRZDUQLQJEHDFRQVDUH ,QFDQGHVFHQW%HDFRQV 3URGXFHVOLJKWZLWKDZLUH¿ODPHQWKHDWHGWRDKLJKWHPSHUDWXUHE\DQ HOHFWULFFXUUHQWSDVVLQJWKURXJKLWXQWLOLWJORZVDQGFUHDWHVDEULJKWOLJKW 7KHVHODPSVKDYHEHHQLQFRUSRUDWHGLQWRZDUQLQJEHDFRQVLQWKH IROORZLQJZD\V 5RWDWLQJ%HDFRQV z /RZSRZHUUHTXLUHPHQW +LJKHIÀFLHQF\ z 9HU\ORQJOLIH z 0XOWLSOH&RORXU6LJQDORSWLRQVLQDVLQJOHEHDFRQHQFORVXUH z $SDUDEROLFUHÀHFWRUGULYHQE\DQHOHFWULFPRWRUUHYROYHVDURXQGD FRQWLQXRXVO\LOOXPLQDWHGEXOERQWKHYHUWLFDOD[LVRIWKHEHDFRQFUHDWLQJ DSRZHUIXOEHDPRIOLJKWWUDYHOOLQJWKURXJKGHJUHHV 0RÀDVKRIIHUDUDQJHRI/('RSWLRQVIURPEHDFRQVFRQWDLQLQJRII /('VXSWRRII/('VLQDVLQJOHHQFORVXUH7KH\FDQEHVHWLQ various modes of operation from )ODVKLQJ6WDWLFDQG5RWDWLQJ. 6RPHEHDFRQVKDYHDFRPELQHG$XGLEOH9LVXDO option. (WKHUQHW FRPSDWLEOHDQG3/&FRQWUROODEOHEHDFRQVDOVRPDNHXSWKHUDQJH DORQJZLWKKLJKµ,QJUHVV3URWHFWLRQ¶HQFORVXUHV ,QJHQHUDOWKLVW\SHRIEHDFRQKDVDJUHDWHUGHJUHHRIOLJKWRXWSXWWKDQRWKHU PRGHOVEXWWKLVLVUHGXFHGDVWKHSDUDEROLFUHÀHFWRURQO\LOOXPLQDWHVRQH given point at a time. )ODVKLQJ)LODPHQW /HYHOVRI%ULJKWQHVV Brightness depends upon the type of beacon chosen, the rated power RXWSXWRIWKHXQLWLH:DWWVDQG-RXOHVWKHGLVWDQFHWKDWWKHVLJQDOLV REVHUYHGIURPDQGWKHGRPHFRORXURIWKHEHDFRQXVHG,QJHQHUDOLI WKHYLHZLQJGLVWDQFHLVGRXEOHGWKHOLJKWLQWHQVLW\REVHUYHGLVUHGXFHG WRDTXDUWHUDQGLIWKHGLVWDQFHLVTXDGUXSOHGWKHOLJKWLQWHQVLW\LV UHGXFHGWRDVL[WHHQWK 2SHUDWLQJWKURXJKDQLQWHUQDOFLUFXLWZKLFKVLPSO\F\FOHVWKHEXOE2QDQG 2II7KHVHW\SHVRIEHDFRQVJHQHUDOO\JLYHDPXFKORZHUOLJKW RXWSXWDVLWWDNHVORQJHUIRUWKHEXOEWRIXOO\LOOXPLQDWHLWVHOI 7KHHIIHFWLYHEULJKWQHVVFDQEHLQFUHDVHGE\WKHXVHRID'LRSWULF)UHVQDO OHQVZKLFKLVSODFHGRYHUWKHLQWHUQDOODPSFDSWXULQJWKHOLJKWHPLWWHG PDJQLI\LQJDQGGLUHFWLQJLWWRFUHDWHDPRUHHIIHFWLYHZDUQLQJVLJQDO,QWHUPV RIOLJKWFRYHUDJHWKLVW\SHRIEHDFRQLVPRUHHI¿FLHQWDVLWLOOXPLQDWHVWKHWRWDO VXUIDFHFRQVWDQWO\WKURXJKGHJUHHV 6WDWLF)LODPHQW&RQWLQXRXV%HDFRQV 7KHVHXQLWVDUHLGHQWLFDOWR)ODVKLQJ)LODPHQWEHDFRQVZLWKWKH H[FHSWLRQWKDWWKH\GRQRWRSHUDWHWKURXJKDQ2QDQG2IIF\FOH :KHQWKHXQLWLVHQHUJLVHGWKHOLJKWVRXUFHVWD\VSHUPDQHQWO\µ2Q¶ 7KHPDLQDGYDQWDJHRIWKLVW\SHRIEHDFRQLVWKDWWKHOLJKWFDQEH FRQWUROOHGE\DVHSDUDWHVRXUFHLHDFRQWUROSDQHOJLYLQJWKHXQLW PRUHÀH[LELOLW\ ;HQRQ6WUREH%HDFRQV $GLVFKDUJHFDSDFLWRURSHUDWLQJWKURXJKDFRQYHUWHUFLUFXLWLJQLWHV [HQRQJDVLQVLGHDWXEHFUHDWLQJDEULOOLDQWÀDVKRIOLJKW;HQRQJDV LJQLWHVYLUWXDOO\LQVWDQWDQHRXVO\VRPD[LPXPEULJKWQHVVLVREWDLQHG LPPHGLDWHO\7KLVVLJQDOFDQEHLPSURYHGIXUWKHUE\WKHXVHRID 'LRSWULF)UHVQDOOHQVDVGHVFULEHGHDUOLHU,QVRPH0RÀDVKPRGHOV Dµ'RXEOH)ODVK¶RSWLRQLVDOVRDYDLODEOHZKLFKH[WHQGVWKHVLJQDO GXUDWLRQPDNLQJLWPRUHQRWLFHDEOHWRWKHKXPDQH\H ;HQRQVKDYHDQDGGHGDGYDQWDJHRIORZFXUUHQWFRQVXPSWLRQ FRPELQHGZLWKORQJOLIH7KHWXEHOLIHRID[HQRQEHDFRQLV DSSUR[LPDWHO\PLOOLRQÀDVKHV7KHVHXQLWVDUHWKHPRVWHI¿FLHQW DYDLODEOHLQFRUSRUDWLQJDGHJUHHOLJKWRXWSXWZLWKWKHEULJKWHVW DQGPRVWHIIHFWLYHYLVXDOVLJQDO %HDFRQ/HQV&RORXUV 7KHLQWHQVLW\RIWKHOLJKWFDQEHJUHDWO\UHGXFHGDVLWSDVVHV WKURXJKWKHGRPHRIWKHEHDFRQ7KHH[WHQWRIWKLVUHGXFWLRQ LVGHSHQGHQWXSRQ z 7KHW\SHRIOLJKWVRXUFHXVHGLHFRQYHQWLRQDO¿ODPHQW ,QFDQGHVFHQWEXOEWXQJVWHQKDORJHQEXOERUD[HQRQWXEH z 7KHFRORXURIWKHEHDFRQOHQVWKDWLVXVHG 7KHWDEOHEHORZJLYHVDQLQGLFDWLRQRIWKHSHUFHQWDJHRIOLJKWWKDW ZLOOSDVVWKURXJKWKHEHDFRQGRPHIRUGLIIHUHQWOLJKWVRXUFHVDQG GRPHFRORXUV &2/285 ),/$0(17 +$/2*(1 ;(121 &OHDU 100% 100% 100% $PEHU 70% 70% 70% 5HG 30% 27% 23% *UHHQ 12% 15% 25% %OXH 8% 10% 13% 'RPHFRORXUVFRQYH\GLIIHUHQWPHVVDJHVWRWKHREVHUYHU 5(' $0%(5 *5((1 %/8( 6HULRXVGDQJHUDFWQRZ = Warning proceed with care 2.SURFHHGDVQRUPDO 6SHFL¿FSURFHVVQRWLFHZDUQLQJ $OWHUQDWLYHO\JUHHQFRORXUEHDFRQVDUHXVHGE\'RFWRUVDQG 9HWHULQDULDQVDQGEOXHEHDFRQVIRUWKH3ROLFHDQG)LUHGHSDUWPHQWV 6(/(&7,21$33/,&$7,21 MOFLASH ,35DWLQJV 7KH,3µ,QJUHVV3URWHFWLRQ¶UDWLQJV\VWHPSURYLGHVDPHDQVRIFODVVLI\LQJWKH'HJUHHVRISURWHFWLRQIURPGXVWDQGZDWHUDIIRUGHGE\HOHFWULFDOHTXLSPHQW DQGHQFORVXUHV7KHV\VWHPLVUHFRJQLVHGLQPRVWFRXQWULHVDQGLVVHWRXWLQ%6(1'HJUHHVRI3URWHFWLRQ 6HFRQG1XPEHU )LUVW1XPEHU 3URWHFWLRQ$JDLQVW /LTXLGV 3URWHFWLRQ$JDLQVW 6ROLGV ,3 ,3 7HVW 0 No protection 0 No protection 1 3URWHFWLRQDJDLQVWVROLGREMHFWVRYHU PPHJDFFLGHQWDOWRXFKE\KDQGV 1 3URWHFWLRQDJDLQVWYHUWLFDOO\ IDOOLQJGURSVRIZDWHU 2 3URWHFWLRQDJDLQVWVROLGREMHFWVRYHU PPHJ¿QJHUV 2 Protection against direct sprays of water up to 15IURPWKHYHUWLFDO 3 3URWHFWLRQDJDLQVWVROLGREMHFWVRYHU PPWRROVZLUHV 3 Protection against sprays IURPWKHYHUWLFDO 4 3URWHFWLRQDJDLQVWVROLGREMHFWVRYHU PPWRROVZLUHVVPDOOZLUHV 4 Protection against water sprayed from DOOGLUHFWLRQVOLPLWHG,QJUHVVSHUPLWWHG 5 Protection against dust OLPLWHG,QJUHVVQRKDUPIXOGHSRVLW 5 3URWHFWLRQDJDLQVWORZSUHVVXUHMHWV RIZDWHUVSUD\HGIURPDOOGLUHFWLRQV OLPLWHG,QJUHVVSHUPLWWHG 6 7RWDOO\SURWHFWHGDJDLQVWGXVW 6 Protection against strong pressure MHWVRIZDWHUHJIRUXVHRQVKLSGHFNV OLPLWHG,QJUHVVSHUPLWWHG 7 8 N 7HVW 15cm min 1m 15cm min 1m Protection against the effects of temporary immersion between 15cm DQGP'XUDWLRQRIWHVWPLQXWHV 3URWHFWLRQDJDLQVWORQJSHULRGVRI immersion under pressure 3URWHFWLRQDJDLQVWVVWURQJSUHVVXUHVMHWVRIZDWHU EDUDWDWHPSHUDWXUHRIC for durations RIVHFRQGV6LPXODWLQJSUHVVXUHFOHDQLQJ FRQGLWLRQVRQDSODQÀRRU)RRG,QGXVWU\HWF 6(/(&7,21$33/,&$7,21 MOFLASH 7KH&(0DUN 7KH0RÀDVKSURGXFWVWKDWVKRZWKH&(PDUNDUHGHHPHGWRFRPSO\ ZKHUHDSSOLFDEOHZLWKWKH(0&'LUHFWLYH1R((&DQG DGGLWLRQDODPHQGPHQWVUHJDUGLQJ(OHFWURPDJQHWLF&RPSDWLELOLW\ ZKLFKVWDWHVWKDWµ$QHOHFWULFDOSURGXFWPXVWQRWEHVXVFHSWLEOHWR RUJHQHUDWHFHUWDLQOHYHOVRIHOHFWURPDJQHWLFLQWHUIHUHQFHOLDEOHWR LQWHUIHUHZLWKRWKHUHOHFWURQLFHTXLSPHQW¶DQGWKH/9''LUHFWLYH1R (&UHJDUGLQJORZYROWDJHHOHFWULFDOPDWHULDOZKLFKVWDWHVWKDW µ(OHFWULFDOHTXLSPHQWZLWKLQWKHYROWDJHUDQJHVRIWRY$F DQGWRY'FDUHFRQVWUXFWHGZLWKLQWKHSULQFLSOHVRIJRRG HQJLQHHULQJSUDFWLFHDQGSURYLGHDGHTXDWHOHYHOVRISURWHFWLRQ DJDLQVWDQHOHFWULFVKRFN¶ ,(&&RORXUVRI/XPLQRXV,QGLFDWRUV 3XVK%XWWRQV (VWDEOLVKHVWKHYDULRXVPHDQLQJVRIFRORXUHGOXPLQRXVLQGLFDWRUV and push buttons to conform to the machine directive. &RORXU 5(' '$1*(5$&712: z 'DQJHURIOLYHRUXQJXDUGHG z 0RYLQJPDFKLQHU\RUHVVHQWLDO z (TXLSPHQWLQSURWHFWHG]RQH &RORXU$0%(5 7KH0DFKLQHU\'LUHFWLYH(& :$51,1*352&((':,7+&$5( z 7HPSHUDWXUHRISUHVVXUHGLIIHUHQWIURPQRUPDOOHYHO 7KHVHGLUHFWLYHVDUHGHVLJQHGWRKDUPRQLVHZLGHUDQJHKHDOWKDQG VDIHW\UHTXLUHPHQWVLQPDFKLQHU\GHVLJQDQGGDLO\XVHE\LQGLFDWLQJ DSRWHQWLDOKD]DUGE\WKHXVHRIDQLPPHGLDWHO\UHFRJQLVDEOH DXGLEOHRUYLVXDOZDUQLQJVLJQDO &RORXU *5((1 6$)(7<35(&$87,21*2$+($' z &KHFNVFRPSOHWHWKHPDFKLQHLVDERXWWRVWDUW SU(16DIHW\RI0DFKLQHU\ 9LVXDO:DUQLQJ6LJQDOV &ODVVL¿HVWKHW\SHRIZDUQLQJOLJKWDQGVSHFL¿HVWKHFKDUDFWHULVWLFVWKH ZDUQLQJOLJKWPXVWDFKLHYHWRFRQIRUPWRWKHPDFKLQHGLUHFWLYH :DUQLQJ6LJQDOV &RORXU %/8( 63(&,),&0($1,1**,9(1'(3(1',1*216,78$7,21 z 3UHVHWUHDG\RUUHPRWHFRQWURO 9LVXDOZDUQLQJVLJQDOVPXVWEHDWOHDVW¿YHWLPHVEULJKWHUWKDQWKH area where they are used. 'DQJHU6LJQDOV &OHDUO\YLVLEOHHYHQLQVWURQJOLJKWGLVWLQJXLVKDEOHIURPRWKHUOLJKWV DQG9LVXDOZDUQLQJVLJQDOVDQGEHXQGHUVWRRGLPPHGLDWHO\ (PHUJHQF\6LJQDOV 7KHVHKDYHWKHKLJKHVWSULRULW\DQGPXVWEHDWOHDVWWHQWLPHVEULJKWHU WKDQWKHDUHDWKDWWKH\DUHWREHXVHGLQDQGXQGHUVWRRGLPPHGLDWHO\ &RORXU 1263(&,),&0($1,1* z &RXOGFRQ¿UPDQHDUOLHUPHVVDJH $OO0RÀDVKFRORXUHGGRPHVDUHPDQXIDFWXUHGIURPµ89¶VWDEOH SRO\FDUERQDWHSODVWLFWKDWZLOOQRWWDUQLVKIDGHRUEHFRPHEULWWOHRYHU DSHULRGRIWLPHXQOLNHPDQ\GRPHVDYDLODEOHWKDWDUHSURGXFHGIURP $FU\OLFSODVWLF 6(/(&7,21$33/,&$7,21 MOFLASH ,FRQ/HJHQGV )ODVKHV6LPSOHVR'REOHV SRUPLQXWR0XHVWUDTXH ODXQLGDGWLHQHXQDRSFLRQ GHGREOHÀDVK Einfacher oder GRSSHOWHU%OLW]SUR0LQXWH =HLJWDQGDVVGDV*HUDHW XHEHUHLQH'RSSHOEOLW] )XQNWLRQYHUIXHJW 6LJQDX[FOLJQRWDQWV VLPSOHVRXGRXEOHVSDU PLQXWH,QGLJXHTXH O¶XQLWHHVWHTXLSHHG¶XQH RSWLRQGHVLJQDOFOLJQRWDQW GRXEOH )ODVKVLQJROLRGRSSLH DOPLQXWH,QGLFDFKHLO dispositivo puo fornire ÀDVKGRSSL 5HYROXWLRQVSHUPLQXWH 5HYROXFLRQHVSRUPLQXWR Umdrehungen pro Minute 7RXUVPLQXWH *LULDOPLQXWR ,3 Ingress Protection of the unit Grado de proteccion IP 6FKXW]DUW 3URWHFWLRQGHO¶XQLWH Indice di protezione GHOGLVSRVLWLYR & Operating Temperature in Centigrade Temperatura de funcionamiento Betriebstemperatur Temperatures de service O¶XQLWH Temperatura di funzionamento in gradi centigadi %R[HGZHLJKWLQFOXGLQJ the Dome 3HVRHPSDTXHWDGR LQFOXLGDODFXSXOD *HZLFKWHLQVFKOLHßOLFK +DXEHXQG9HUSDFNXQJ Poids conditionne, y compris partie superieure 3HVRLQVFDWRODWRFRQ FDORWWD +] 2SHUDWHVRQDIUHTXHQF\ RI+]$F Funciona a una IUHFHXQFLDGH+]$F 1HQQIUHTXHQ]+] Fonctionne sur une Funziona con IUHTXHQFHGH+]&$ +]LQ&$ G% ,QGLFDWHV'HFLEHOOHYHO at 1 meter ,QGLFDHOQLYHOGH GHFLEHOLRVDPHWUR /DXWVWDHUNHLQG%EHL P$EVWDQG ,QGLTXHOHQLYHDXGH GHFLEHODP Indica 1 dB a 1m 6XLWDEOHIRUXVHLQ PDULQHDSSOLFDWLRQV 8WLO]DEOHHQ DSOLFDFLRQHVPDULWLPDV Geeignet zum Einsatz im %HUHLFK6FKLIIVEDX und Marine $SSURSULHDX[ DSSOLFDWLRQVHQ PLOLHXQDYDO Idonei per DSSOLFD]RQLQDYDOL ),5( 6XLWDEOHIRUXVHLQ¿UH DODUPV\VWHPV 8WLOL]DEOHHQ VLVWPDVGHDODUPD anti incendios Geeignet zum Einsatz in %UDQGPHOGHDQODJHQ $SSURSULHDX[ LQVWDOODWLRQVGH OXWWHFRQWUHOHIHX Idonei per impianti anticendio ,1'8675,$/ 6XLWDEOHIRUXVHLQ LQGXVWULDODSSOLFDWLRQV 9DOLGRSDUDXVRHQ DSOLFDFLRQHV LQGXVWULDOHV füU$QZHQGXQJHQLP Industriebereich geeignet &RQYLHQWDX[ DSSOLFDWLRQV LQGXVWULHOOHV $GDWWRSHULPSLHJRQHO VHWWRUHLQGXVWULDOH 6XLWDEOHIRUXVHLQ DXWRPRWLYHDSSOLFDWLRQV 9DOLGRSDUDXVRHQ DSOLFDFLRQHVGH automocion füU$QZHQGXQJHQLQGHU $XWRPRELOLQGXVWULH geeignet &RQYLHQWDX[ DSSOLFDWLRQV DXWRPRELOHV $GDWWRSHULPSLHJR QHOVHWWRUHGHOO¶DXWR 6XLWDEOHIRUREVWDFOH PDUNLQJDSSOLFDWLRQV 9DOLGRSDUDXVRHQ DSOLFDFLRQHVGH EDOL]DPLHQWR +LQGHUQLVEHIHXHUXQJ &RQYLHQWDX[ DSSOLFDWLRQVGH PDUTXDJHG¶REVWDFOH $GDWWRSHU VHJQDOD]LRQH RVWDFRORDHUHR 6XLWDEOHIRUHSORVLYHSURRI DSSOLFDWLRQVWR$7(; ,(&([DSSURYDO 9DOLGRSDUDXVRHQ DSOLFDFLRQHVHQ zonas de riesgo FRQFHUWL¿FDFLRQ $7(;,(&([ Geeignet zum Einsatz in H[SORVLRQVJHVFKXHW]WHQ %HUHLFKHQPLW$WH[XQG ,(&([=XODVVXQJ &RQYLHQWDX[ DSSOLFDWLRQV DQWLGHÀDJUDQWHV UHSRQGDQWDOD QRUPD$7(;,(&([ $GDWWRSHULPSHLJR in atmosfera HVSORVLYDVHFRQGR RPRORJD]LRQH$7(; ,(&([ $PEHU $PEDU *HOE -DXQH $UDQFLR 5HG 5RMR 5RW 5RXJH 5RVVR %OXH $]XO %ODX %OHX %OX *UHHQ 9HUGH *UXHQ 9HUW 9HUGH &OHDU 7UDQVSDUHQWH .ODU 7UDQVSDUHQW ,QFRORUH )30 )30 530 o .J WR 0$5,1( $872027,9( 2%67$&/( 0$5.,1* (;3/26,21 3522) /HQV &RORXUV 01 02 03 04 05 6LQJOHRU'RXEOHÀDVKHV per minute. 6KRZVWKHXQLWKDVD GRXEOHÀDVKRSWLRQ 6(/(&7,21$33/,&$7,21 MOFLASH (QYLURQPHQWVZLWK3RWHQWLDOO\ ([SORVLYH$WPRVSKHUHV *DV*URXSV 0RÀDVKRIIHUVDUDQJHRI$XGLEOH9LVXDOZDUQLQJVLJQDOVDORQJZLWKPDQXDO DFWLYDWLRQGHYLFHVWKDWKDYHEHHQGHVLJQHGIRUXVHLQKDUVKHQYLURQPHQWDO FRQGLWLRQVSRWHQWLDOO\H[SORVLYHDWPRVSKHUHVRUDVVRPHWLPHVNQRZQ +D]DUGRXV$UHDVRU+D]DUGRXV/RFDWLRQV $OORIWKHVHSURGXFWVFRPSO\ZLWK(XURSHDQ$7(;GLUHFWLYH(&WREH VXSHUVHGHGE\(8WK$SULODQGWKH,QWHUQDWLRQDO(OHFWULFDO &RPPLVVLRQ,(&IRU([SORVLRQDWPRVSKHUHV,(&([ 0RÀDVK$7(;,(&([FHUWL¿FDWHVKDYHEHHQLVVXHGE\'191(0.2 Norway. 7KHVHGLUHFWLYHVKHOSFODVVLI\DUHDVZKHUHKD]DUGRXVH[SORVLYHDWPRVSKHUHV PD\RFFXULQWR]RQHV7KHFODVVL¿FDWLRQJLYHQWRDSDUWLFXODU]RQHDQGLWV VL]HDQGORFDWLRQGHSHQGVXSRQWKHOLNHOLKRRGRIDQH[SORVLYHDWPRVSKHUH RFFXUULQJDQGLWVSHUVLVWHQFHLILWGRHV$UHDVWKDWKDYHEHHQFODVVL¿HGLQWR ]RQHVPXVWEHSURWHFWHGIURPHIIHFWLYHVRXUFHVRILJQLWLRQ7KHHTXLSPHQW SURWHFWLYHV\VWHPVLQWHQGHGWREHXVHGLQ]RQHGDUHDVPXVWPHHWWKH UHTXLUHPHQWVRIWKH$7(;GLUHFWLYH =RQH&ODVVLÀFDWLRQ (XURSHDQDQG,(& 'H¿QLWLRQRI]RQHRUGLYLVLRQ &ODVVLÀFDWLRQ 1RUWK$PHULFDQ &ODVVL¿FDWLRQ =RQH *DVHV9DSRUV $QDUHDLQZKLFKDQH[SORVLYH PL[WXUHLVFRQWLQXRXVO\SUHVHQWRU SUHVHQWIRUORQJSHULRGV &ODVV, 'LYLVLRQJDVHV =RQH *DVHV9DSRUV $QDUHDLQZKLFKDQH[SORVLYH PL[WXUHLVOLNHO\WRRFFXULQQRUPDO operation. &ODVV, 'LYLVLRQJDVHV =RQH *DVHV9DSRUV $QDUHDLQZKLFKDQH[SORVLYH PL[WXUHLVQRWOLNHO\WRRFFXULQ QRUPDORSHUDWLRQDQGLILWRFFXUVLW ZLOOH[LVWRQO\IRUDVKRUWWLPH &ODVV, 'LYLVLRQJDVHV =RQH 'XVWV $QDUHDLQZKLFKDQH[SORVLYH PL[WXUHLVFRQWLQXRXVO\SUHVHQWRU SUHVHQWIRUORQJSHULRGV &ODVV,, 'LYLVLRQGXVWV =RQH 'XVWV $QDUHDLQZKLFKDQH[SORVLYH PL[WXUHLVOLNHO\WRRFFXULQQRUPDO operation. &ODVV,, 'LYLVLRQGXVWV =RQH 'XVWV $QDUHDLQZKLFKDQH[SORVLYH PL[WXUHLVQRWOLNHO\WRRFFXULQ QRUPDORSHUDWLRQDQGLILWRFFXUVLW ZLOOH[LVWRQO\IRUDVKRUWWLPH &ODVV,, 'LYLVLRQGXVWV ([SORVLYHJDVHVYDSRUVDQGGXVWVKDYHGLIIHUHQWFKHPLFDOSURSHUWLHV WKDWDIIHFWWKHOLNHOLKRRGDQGVHYHULW\RIDQH[SORVLRQ6XFKSURSHUWLHV LQFOXGHÀDPHWHPSHUDWXUHPLQLPXPLJQLWLRQHQHUJ\XSSHUDQGORZHU H[SORVLYHOLPLWVDQGPROHFXODUZHLJKW(PSLULFDOWHVWLQJLVGRQHWR GHWHUPLQHSDUDPHWHUVVXFKDVWKHPD[LPXPH[SHULPHQWDOVDIHJDS PLQLPXPLJQLWLRQFXUUHQWH[SORVLRQSUHVVXUHDQGWLPHWRSHDN SUHVVXUHVSRQWDQHRXVLJQLWLRQWHPSHUDWXUHDQGPD[LPXPUDWHRI pressure rise. Every substance has a differing combination of SURSHUWLHVEXWLWLVIRXQGWKDWWKH\FDQEHUDQNHGLQWRVLPLODUUDQJHV VLPSOLI\LQJWKHVHOHFWLRQRIHTXLSPHQWIRUKD]DUGRXVDUHDV )ODPPDELOLW\RIFRPEXVWLEOHOLTXLGVDUHGH¿QHGE\WKHLUÀDVKSRLQW 7KHÀDVKSRLQWLVWKHWHPSHUDWXUHDWZKLFKWKHPDWHULDOZLOOJHQHUDWH VXI¿FLHQWTXDQWLW\RIYDSRUWRIRUPDQLJQLWDEOHPL[WXUH7KHÀDVKSRLQW GHWHUPLQHVLIDQDUHDQHHGVWREHFODVVL¿HG$PDWHULDOPD\KDYHD UHODWLYHO\ORZDXWRLJQLWLRQWHPSHUDWXUH\HWLILWVÀDVKSRLQWLVDERYH WKHDPELHQWWHPSHUDWXUHWKHQWKHDUHDPD\QRWQHHGWREHFODVVL¿HG &RQYHUVHO\LIWKHVDPHPDWHULDOLVKHDWHGDQGKDQGOHGDERYHLWV ÀDVKSRLQWWKHDUHDPXVWEHFODVVL¿HG (DFKFKHPLFDOJDVRUYDSRXUXVHGLQLQGXVWU\LVFODVVL¿HGLQWRD gas group. *URXS 5HSUHVHQWDWLYH*DVHV , ,,$ $OO8QGHUJURXQG&RDO0LQLQJ)LUHGDPSPHWKDQH ,QGXVWULDOPHWKDQHSURSDQHSHWURODQGWKHPDMRULW\ RILQGXVWULDO (WK\OHQHFRNHRYHQJDVDQGRWKHULQGXVWULDOJDVHV +\GURJHQDFHW\OHQFDUERQGLVXSKLGH ,,% ,,& *URXS,,&LVWKHPRVWVHYHUHJURXS+D]DUGVLQWKLVJURXSFDQEH LJQLWHGYHU\HDVLO\LQGHHG(TXLSPHQWPDUNHGDVVXLWDEOHIRU*URXS,,& LVDOVRVXLWDEOHIRU,,%DQG,,$(TXLSPHQWPDUNHGDVVXLWDEOHIRU ,,%LVDOVRVXLWDEOHIRU,,$EXW127IRU,,&,IHTXLSPHQWLVPDUNHG IRUH[DPSOH([G,,&WKHQLWLVVXLWDEOHIRUDOOVXEJURXSV,,$,,% and IIC. $OLVWPXVWEHGUDZQXSRIHYHU\FKHPLFDOJDVRUYDSRUWKDWLVRQ WKHUH¿QHU\FKHPLFDOFRPSOH[DQGLQFOXGHGLQWKHVLWHSODQRIWKH FODVVL¿HGDUHDV7KHDERYHJURXSVDUHIRUPHGLQRUGHURIKRZYRODWLOH WKHJDVRUYDSRUZRXOGEHLILWZDVLJQLWHG,,&EHLQJWKHPRVWYRODWLOH DQG,,$EHLQJWKHOHDVW7KHJURXSVDOVRLQGLFDWHKRZPXFKHQHUJ\ LVUHTXLUHGWRLJQLWHWKHJDVE\VSDUNLJQLWLRQ*URXS,,$UHTXLULQJWKH PRVWHQHUJ\DQG,,&WKHOHDVW (IIHFWLYH,JQLWLRQ6RXUFHV ,VDWHUPGH¿QHGLQWKH$7(;GLUHFWLYHDVDQHYHQWZKLFKLQ FRPELQDWLRQZLWKVXI¿FLHQWR[\JHQDQGIXHOLQJDVPLVWYDSRXURU GXVWIRUPFDQFDXVHDQH[SORVLRQ(IIHFWLYHVRXUFHVRILJQLWLRQDUH z /LJKWQLQJVWULNHV z 2SHQÀDPHV z 0HFKDQLFDOO\JHQHUDWHGLPSDFWRUIULFWLRQVSDUNV z (OHFWULFVSDUNV z 9HU\KLJKVXUIDFHWHPSHUDWXUHV z (OHFWURVWDWLFGLVFKDUJH$GLDEDWLFFRPSUHVVLRQHWF 6(/(&7,21$33/,&$7,21 MOFLASH (TXLSPHQW3URWHFWLRQ/HYHO $XWRLJQLWLRQ7HPSHUDWXUHV ,QUHFHQW\HDUVDOVRWKH(TXLSPHQW3URWHFWLRQ/HYHO(3/LVVSHFL¿HGIRU VHYHUDONLQGVRISURWHFWLRQ7KHUHTXLUHG3URWHFWLRQOHYHOLVOLQNHGWRWKH LQWHQGHGXVHLQWKH]RQHVGHVFULEHGEHORZ 7KHDXWRLJQLWLRQWHPSHUDWXUHRIDOLTXLGJDVRUYDSRULVWKH WHPSHUDWXUHDWZKLFKWKHVXEVWDQFHZLOOLJQLWHZLWKRXWDQ\H[WHUQDO KHDWVRXUFH7KHH[DFWWHPSHUDWXUHYDOXHGHWHUPLQHGGHSHQGVRQ WKHODERUDWRU\WHVWFRQGLWLRQVDQGDSSDUDWXV6XFKWHPSHUDWXUHV IRUFRPPRQVXEVWDQFHVDUH *URXS ([ULVN ,PLQHV energized Ma ,PLQHV GHHQHUJL]HGLQ SUHVHQFHRI([ atmosphere Mb ,,JDV =RQH (3/ H[SORVLYH DWPRVSKHUH! KUV\U H[SORVLYH atmosphere EHWZHHQDQG KUV\U 1 ,,JDV H[SORVLYH atmosphere EHWZHHQDQG KUV\U 2 ,,,GXVW ,,JDV Ga Gb 0LQLPXPW\SHHFWLRQ ia, ma LEPES[S\HR TV Gc n, ic, pz H[SORVLYHVXUIDFH! KUV\U Da ia ,,,GXVW H[SORVLYHVXUIDFH EHWZHHQDQG KUV\U 21 Db ib ,,,GXVW H[SORVLYHVXUIDFH EHWZHHQDQG KUV\U 22 Dc ic Methane C +\GURJHQ C Propane C (WK\OHQH C $FHW\OHQH C Naphtha C &DUERQ'LVXO¿GH C The surface of a high pressure steam pipe may be above the DXWRLJQLWLRQWHPSHUDWXUHRIVRPHIXHODLUPL[WXUHV $XWRLJQLWLRQWHPSHUDWXUHV 7KHDXWRLJQLWLRQWHPSHUDWXUHRIDGXVWLVXVXDOO\KLJKHUWKDQWKDW RIYDSRXUVJDVHV([DPSOHVIRUFRPPRQPDWHULDOVDUH $QRWKHULPSRUWDQWFRQVLGHUDWLRQLVWKHWHPSHUDWXUHFODVVL¿FDWLRQRIWKH HOHFWULFDOHTXLSPHQW7KHVXUIDFHWHPSHUDWXUHRUDQ\SDUWVRIWKHHOHFWULFDO HTXLSPHQWWKDWPD\EHH[SRVHGWRWKHKD]DUGRXVDWPRVSKHUHVKRXOGEH WHVWHGWKDWLWGRHVQRWH[FHHGRIWKHDXWRLJQLWLRQWHPSHUDWXUHRIWKH VSHFL¿FJDVRUYDSRULQWKHDUHDZKHUHWKHHTXLSPHQWLVLQWHQGHGWREHXVHG 7KHWHPSHUDWXUHFODVVL¿FDWLRQRQWKHHOHFWULFDOHTXLSPHQWODEHOZLOOEHRQHRI WKHIROORZLQJLQGHJUHH&HOVLXV 7 7HPSHUDWXUH $XWRLJQLWLRQ7HPSHUDWXUHVGXVW 7HPSHUDWXUH&ODVVLÀFDWLRQ 86$0& *DV ,QWHUQDWLRQDO ,(&0& *HUPDQ\0&&RQWLQXRXV 6KRUW7LPH 7$ 7 * 7 7% 7 * 7$ 7& 7 * 7% 7 7 * 7& 7$ 7 * 7' 7 7 7 7 7KHDERYHWDEOHWHOOVXVWKDWWKHVXUIDFHWHPSHUDWXUHRIDSLHFHRIHOHFWULFDO HTXLSPHQWZLWKDWHPSHUDWXUHFODVVL¿FDWLRQRI7ZLOOQRWULVHDERYH& 6XEVWDQFH 7HPSHUDWXUH 6XJDU C Wood C )ORXU C Grain Dust C Tea C 6(/(&7,21$33/,&$7,21 MOFLASH 7\SHRI3URWHFWLRQ 7RHQVXUHVDIHW\LQDJLYHQVLWXDWLRQHTXLSPHQWLVSODFHGLQWRSURWHFWLRQOHYHOFDWHJRULHVDFFRUGLQJWRPDQXIDFWXUHPHWKRGDQGVXLWDELOLW\IRUGLIIHUHQWVLWXDWLRQV &DWHJRU\LVWKHKLJKHVWVDIHW\OHYHODQG&DWHJRU\WKHORZHVW$OWKRXJKWKHUHDUHPDQ\W\SHVRISURWHFWLRQDIHZDUHGHWDLOHGEHORZ ([&RGH 'HVFULSWLRQ 6WDQGDUG /RFDWLRQ 8VH )ODPHSURRI d (TXLSPHQWFRQVWUXFWLRQLVVXFKWKDWLWFDQZLWKVWDQGDQLQWHUQDO ,(&(1 H[SORVLRQDQGSURYLGHUHOLHIRIWKHH[WHUQDOSUHVVXUHYLDÀDPHJDSV VXFKDVWKHODE\ULQWKFUHDWHGE\WKUHDGHG¿WWLQJVRUPDFKLQHG ÀDQJHV7KHHVFDSLQJKRWJDVHVPXVWVXI¿FLHQWO\FRROGRZQ DORQJWKHHVFDSHSDWKWKDWE\WKHWLPHWKH\UHDFKWKHRXWVLGHRIWKH HQFORVXUHQRWWREHDVRXUFHRILJQLWLRQRIWKHRXWVLGHSRWHQWLDOO\ LJQLWDEOHVXUURXQGLQJV (TXLSPHQWKDVÀDPHSURRIJDSVPD[´XPSURSDQH HWK\OHQH´XPDFHW\OHQHK\GURJHQ =RQHLI JDVJURXS WHPSFODVV correct 0RWRUVOLJKWLQJ MXQFWLRQER[HV HOHFWURQLFV Increased 6DIHW\ e (TXLSPHQWLVYHU\UREXVWDQGFRPSRQHQWVDUHPDGHWRDKLJK TXDOLW\ ,(&(1 =RQHRU =RQH 0RWRUVOLJKWLQJ MXQFWLRQER[HV 2LO)LOOHG o (TXLSPHQWFRPSRQHQWVDUHFRPSOHWHO\VXEPHUJHGLQRLO ,(&(1 =RQHRU =RQH 6ZLWFKJHDU 6DQG3RZGHU 4XDUW])LOOHG T (TXLSPHQWFRPSRQHQWVDUHFRPSOHWHO\FRYHUHGZLWKDOD\HURI 6DQGSRZGHURUTXDUW] ,(&(1 =RQHRU =RQH (OHFWURQLFV WHOHSKRQHVFKRNHV (QFDSVXODWHG m (TXLSPHQWFRPSRQHQWVRIWKHHTXLSPHQWDUHXVXDOO\HQFDVHGLQD UHVLQW\SHPDWHULDO ,(&(1 =RQH([ PERU=RQH ([PD (OHFWURQLFVQRKHDW 3UHVVXULVHG purged p (TXLSPHQWLVSUHVVXULVHGWRDSRVLWLYHSUHVVXUHUHODWLYHWR the surrounding atmosphere with air or an inert gas, thus the VXUURXQGLQJLJQLWDEOHDWPRVSKHUHFDQQRWFRPHLQFRQWDFWZLWK energized parts of the apparatus. The overpressure is monitored, PDLQWDLQHGDQGFRQWUROOHG ,(&(1 =RQHS[RU $QDO\VHUVPRWRUV py), or zone FRQWUROER[HV S] computers ,QWULQVLFDOO\ safe i $Q\DUFVRUVSDUNVLQWKLVHTXLSPHQWKDVLQVXI¿FLHQWHQHUJ\KHDW to ignite a vapour (TXLSPHQWFDQEHLQVWDOOHGLQ$1<KRXVLQJSURYLGHGWR,3 $µ=HQHU%DUULHU¶RUµRSWRLVRO¶RUµJDOYDQLF¶XQLWPD\EHXVHGWR DVVLVWZLWKFHUWL¿FDWLRQ $VSHFLDOVWDQGDUGIRULQVWUXPHQWDWLRQLV,(&(1 GHVFULELQJUHTXLUHPHQWVIRU)LHOGEXV,QWULQVLFDOO\6DIH&RQFHSW ),6&2]RQHRU ,(&(1 ,(&(1 ,(&(1 µLD¶=RQH µLE¶=RQH µLF]RQH Instrumentation, measurement, FRQWURO Non Incendive n (TXLSPHQWLVQRQLQFHQGLYHRUQRQVSDUNLQJ $VSHFLDOVWDQGDUGIRULQVWUXPHQWDWLRQLV,(&(1 GHVFULELQJUHTXLUHPHQWVIRU)LHOGEXV1RQ,QFHQGLYH&RQFHSW )1,&2]RQH ,(&(1 ,(&(1 =RQH 0RWRUVOLJKWLQJ MXQFWLRQER[HV HOHFWURQLFHTXLSPHQW 6SHFLDO Protection s 7KLVPHWKRGEHLQJE\GH¿QLWLRQVSHFLDOKDVQRVSHFL¿FUXOHV,Q ,(&(1 HIIHFWLWLVDQ\PHWKRGZKLFKFDQEHVKRZQWRKDYHWKHUHTXLUHG GHJUHHRIVDIHW\LQXVH0XFKHDUO\HTXLSPHQWKDYLQJ([V SURWHFWLRQZDVGHVLJQHGZLWKHQFDSVXODWLRQDQGWKLVKDVQRZEHHQ LQFRUSRUDWHGLQWR,(&>([P@([VLVDFRGLQJUHIHUHQFHG LQ,(&7KHXVHRI(3/DQG$7(;&DWHJRU\GLUHFWO\LVDQ DOWHUQDWLYHIRU³V´PDUNLQJ7KH,(&VWDQGDUG(1LVPDGH SXEOLFDQGLVH[SHFWHGWREHFRPHHIIHFWLYHVRRQVRWKDWWKHQRUPDO ([FHUWL¿FDWLRQZLOODOVREHSRVVLEOHIRU([V =RQH depending upon $VLWVFHUWL¿FDWLRQ states 7KHW\SHVRISURWHFWLRQDUHVXEGLYLGHGLQWRVHYHUDOVXEFODVVHVOLQNHGWR(3/PDDQGPES[S\DQGS]LDLEDQGLF7KHDVXEGLYLVLRQVKDYHWKHPRVWVWULQJHQW VDIHW\UHTXLUHPHQWVWDNLQJLQWRDFFRXQWPRUHWKHRQHLQGHSHQGHQWFRPSRQHQWIDXOWVVLPXOWDQHRXVO\ 0XOWLSOH3URWHFWLRQ 0DQ\LWHPVRI(([UDWHGHTXLSPHQWZLOOHPSOR\PRUHWKDQRQHPHWKRGRISURWHFWLRQLQGLIIHUHQWFRPSRQHQWVRIWKHDSSDUDWXV7KHVHZRXOGEHWKHQODEHOHGZLWK HDFKRIWKHLQGLYLGXDOPHWKRGV)RUH[DPSOHDVRFNHWRXWOHWODEHOHG(([¶GH¶PLJKWKDYHDFDVHPDGHWR(([µH¶DQGVZLWFKHVWKDWDUHPDGHWR(([µG¶ 11 INDUSTRIAL MATERIALS HANDLING PROCESS CONTROL & STATUS INDICATION MARINE FIRE & SECURITY EXPLOSION PROOF AUTOMOTIVE ICAO OBSTACLE MARKING 12 162mm Visual Signals - Industrial FLASHING FILAMENT BEACONS Product overview The FF125 DIN and FFA125 series are suitable for security, process control & generally light industrial signalling applications. 7KHVHEHDFRQVDUHRIWKHÀDVKLQJ mode type (single stage alarm). Once the beacon is energised the internal electronics will cycle the Incandescent lamp through a 1Hz on/ off sequence. The design allows for termination inside the enclosure via an M12 sealing grommet in the base. The FFA version incorporates two piezo buzzers situated in the base of the unit that are synchronised to WKHÀDVKUDWHWKHEX]]HUVFDQQRWEH controlled independently of the light) offering a combined audible & visual warning device. ø98mm Optional Piezo Buzzers 3 Holes x ø4.5 on 88 pcd 27.6 Industrial Flashing Filament Beacons > FF125 DIN & FFA125 Series Lead exit position 5mm max cable size 11mm 11º Side knockout position Features Continuously rated FF125 DIN & FFA125 Series > Ordering Information Suitable for surface or wall mounting Code No: Voltage: Light Source: Current: Optional wall bracket & guard available - see accessories FF125-90 FF125-91 FF125-92 FF125-93 12v Dc --24v Dc --115v Ac ~ 230v Ac ~ Ba15d x 21w Ba15d x 21w Ba15d x 15w Ba15d x 15w 1.75 A 0.88 A 0.13 A 0.07 A SRLQW¿[ For Audible Option FFA125-80 FFA125-81 FFA125-82 FFA125-83 12v Dc --24v Dc --115v Ac ~ 230v Ac ~ Ba15d x 21w Ba15d x 21w Ba15d x 15w Ba15d x 15w 1.80 A 0.90 A 0.15 A 0.08 A 360o light output around the vertical axis 180o light output above the horizontal axis Dustproof and Weatherproof Material UV Stable Polycarbonate Lens ADD THE FOLLOWING LENS CODES TO THE PRODUCT WHEN ORDERING Kg 0.25 APPROVALS and CONFORMITIES 50/60 Hz o 01 02 03 04 05 C -25+55 IP 65 UV Stable ABS Plastic Base FPM 60 dB 90 INDUSTRIAL 13 Visual Signals - Industrial FLASHING FILAMENT BEACONS FF201/200 156mm 2 x 5mm x 51mm CRS 205mm 49mm FF201/200 115mm FF401/400 3 holes x 96 PCD to accept No 6 self tap screw (external fitting) Industrial Flashing Filament Beacons > FF201/200 & FF401/400 Series Product overview The FF201/200 & FF401/400 series are suitable for security, process control and industrial applications where a more robust and powerful signal is required. 7KHVHEHDFRQVDUHRIWKHÀDVKLQJ mode type (single stage alarm). Once the beacon is energised the internal electronics will cycle the Incandescent/halogen lamp through a 1Hz on/off sequence. The design allows for termination inside the enclosure through the base. The 15w and 21w units incorporate a Fresnel lens to maximise light intensity. FF201/200 & FF401/400 Series > Ordering Information Code No: Voltage: Light Source: Current: FF201-84 FF201-85 FF201-88 FF201-89 FF200-86 FF200-87 12v Dc --24v Dc --12v Dc --24v Dc --115v Ac ~ 230v Ac ~ Ba15d x 21w Ba15d x 21w H1 x 55w H1 x 70w Ba15d x 15w Ba15d x 15w 1.75 A 0.88 A 4.70 A 3.00 A 0.13 A 0.07 A FF401-84 FF401-85 FF401-88 FF401-89 FF400-86 FF400-87 12v Dc --24v Dc --12v Dc --24v Dc --115v Ac ~ 230v Ac ~ Ba15d x 21w Ba15d x 21w H1 x 55w H1 x 70w E14 x 60w E14 x 60w 1.75 A 0.88 A 4.70 A 3.00 A 0.55 A 0.29 A ADD THE FOLLOWING LENS CODES TO THE PRODUCT WHEN ORDERING Kg 0.70 FF201/200 0.80 FF401/400 APPROVALS and CONFORMITIES 50/60 Hz o 01 02 03 04 05 C -25+55 IP 65 Ø150mm FF401/400 205mm 20mm M20 conduit knockout 3 x Ø6.5 equi-spaced on 130 PCD Features Continuously rated t FF201/200: Suitable for surface, conduit box or wall mounting t FF401/400: Suitable for surface or wall mounting Optional wall bracket & guard available - see accessories SRLQW¿[)) SRLQW¿[)) FF401/400: M20 conduit side entry or bottom cable entry 360o light output around the vertical axis 180o light output above the horizontal axis Dustproof and Weatherproof Material UV Stable Polycarbonate Lens UV Stable ABS Plastic Base FPM 60 INDUSTRIAL 14 Visual Signals - Industrial STATIC FILAMENT BEACONS SF201/200 SF201/200 SF401/400 156mm 2 x 5mm x 51mm CRS 205mm 49mm Industrial Static Filament Beacons > SF201/200 & SF401/400 Series Product overview The SF201/200 & SF401/400 series are suitable for security, process control and industrial applications. These beacons are of the Static mode type (single stage alarm). Once the beacon is energised the Incandescent/Halogen lamp will stay 115mm 3 holes x 96 PCD to accept No 6 self tap screw (external fitting) Ø150mm SF401/400 permanently on. An advantage of this type of beacon is that it can be controlled via a remote source (ie control panel / plc etc ) giving the EHDFRQJUHDWHUÀH[LELOLW\DQGRIIHULQJ DÀDVKLQJVHFRQGVWDJHDODUP The design allows for termination inside the enclosure through the base. The lower wattage units incorporate a Fresnel lens to maximise light intensity. 205mm 20mm M20 conduit knockout 3 x Ø6.5 equi-spaced on 130 PCD Features Continuously rated SF201/200 & SF401/400 Series > Ordering Information SF201/200: Suitable for surface, conduit box or wall mounting Code No: t SF401/400: Suitable for surface Voltage: Light Source: Current: or wall mounting SF201-62 SF201-63 SF201-05 SF201-06 SF201-07 SF200-08 SF200-09 FL200-09 12v Ac/Dc --~ 24v Ac/Dc --~ 12v Ac/Dc --~ 24v Ac/Dc --~ 48v Dc --115v Ac ~ 230v Ac ~ 230v Ac ~ H1 x 55w H1 x 70w Ba15d x 48w Ba15d x 48w Ba15d x 35w Ba15d x 60w Ba15d x 60w E27 x 9w (Fluorescent) 4.60 A 2.90 A 4.00 A 2.00 A 0.65 A 0.55 A 0.29 A --- SF401-62 SF401-63 SF401-05 SF401-06 SF401-07 SF400-08 SF400-09 12v Ac/Dc --~ 24v Ac/Dc --~ 12v Ac/Dc --~ 24v Ac/Dc --~ 48v Dc --115v Ac ~ 230v Ac ~ H1 x 55w H1 x 70w Ba15s x 48w Ba15s x 48w Ba15d x 35w E14 x 60w E14 x 60w 4.60 A 2.90 A 4.00 A 2.00 A 0.65 A 0.55 A 0.29 A ADD THE FOLLOWING LENS CODES TO THE PRODUCT WHEN ORDERING Kg 0.76 SF201/200 0.71 SF401/400 APPROVALS and CONFORMITIES 50/60 Hz o 01 02 03 04 05 C -25+55 IP 65 Optional wall bracket & guard available - see accessories SRLQW¿[)) SRLQW¿[)) FF401/400: M20 conduit side entry or bottom cable entry 360o light output around the vertical axis 180o light output above the horizontal axis Dustproof and Weatherproof Material UV Stable Polycarbonate Lens UV Stable ABS Plastic Base INDUSTRIAL 15 Visual Signals - Industrial LIGHT EMITTING DIODE BEACONS 26mm 50mm ø76mm M4 x 13mm lg studs. Nuts and washers provided Industrial LED Dual Function > LED80 Series Product overview The LED80 incorporates 12 ultra bright Surface Mount LEDs offering an economic solution for a wide range of general signalling solutions. Ideally suited for local indication the beacon is controlled by either two ZLUHVÀDVKLQJPRGHRUWKUHH (static mode). 3 Leads x 500mm lg ø45mm The beacons are supplied fully assembled and ready for immediate installation. 2 off Snap-fit Optional Fixing Plates supplied for Surface mounting 2 x slots 4 x 9mm 55mm The unit offers two mounting options, either Stud Mount or Surface 0RXQWLQJXVLQJWKHWZRSLHFH¿[LQJ SODWHVXSSOLHG2QHSODWHLV¿[HG to the appropriate surface the other to the beacon, the two plates then ‘Snap Fit’ together. 8mm thick Fixing Plate Surface Mount Option Features LED80 Series > Ordering Information LED long life Code No: Voltage: Light Source: Current: LED80-02 10-100v Dc --- LED Array 90 mA 200 mA Extra bright Continuously rated Wide operating voltage Flashing Static at 24v Dc --- 120o prime light output from vertical axis Dustproof & submersible in water LED80-04 115/230v Ac ~ LED Array 20 mA Material UV Stable Polycarbonate ADD THE FOLLOWING LENS CODES TO THE PRODUCT WHEN ORDERING Kg 0.14 APPROVALS and CONFORMITIES o C -20+55 IP 67 01 02 03 04 FPM 60 Lens and Body INDUSTRIAL FIRE MARINE 16 Visual Signals - Industrial LED ECO BEACONS LED100 107mm LED100 33mm Industrial LED ECO Beacons > LED100 Series Ø5.50mm Cable entry hole 51 Fixing Centers Ø66mm The LED100 economy series is suitable for light commercial & industrial signalling applications where local indication is required. The LED ECO range has been designed predominantly to offer a cost effective solution against more traditional incandescent types of lamps, whether through new plant and machinery LQVWDOODWLRQVRUH[LVWLQJIDFLOLW\XSJUDGHV The design allows for termination inside the enclosure through the base (Not ES Version). These beacons have two selectable VWDJHVRIDODUPÀDVKLQJRUFRQWLQXRXV (static) mode, selectable by a jumper link on the PCB. The design also allows for a third wire connection JLYLQJÀH[LELOLW\WRVZLWFKIURPD SUHVHWVWDWLFPRGHWRÀDVKLQJ (Not ES Version). The ES Version has an E27 Edison LEDES100 6FUHZ&DS¿WWHGLQWRWKHEDVHRIWKH E27 beacon. This design lends itself for use threaded contact in temporary signalling locations where a warning or hazard is not normally present, or has the ability to be installed in an area Features XVLQJH[LVWLQJHOHFWULFDOOLJKWLQJSRLQWV Continuously rated avoiding any additional wiring. Ø72mm 25mm 13mm 35mm 147mm Ø72mm Product overview Ø34.10mm LED long life LED100 Series > Ordering Information Low current consumption Code No: Voltage: Light Source: Current: LED100-01 LED100-02 LED100-03 LED100-05 8-20v Ac/Dc --~ 20-30v Ac/Dc --~ 48v Ac ~ 40-380v Dc --85-280v Ac ~ 8 SMT LEDs 8 SMT LEDs 8 SMT LEDs 8 SMT LEDs 430mA z 110mA zz tba 35mA zzz 40-380v Dc --85-280v Ac ~ 8 SMT LEDs ES Version LEDES100-05 Suitable for surface, FRQGXLWER[RUZDOOPRXQWLQJ Optional wall bracket & guard DYDLODEOHH[FHSW(6YHUVLRQ - see accessories SRLQW¿[ 360o light output around WKHYHUWLFDOD[LV 35mA Dustproof and Weatherproof Material z at 12v Dc zz at 24v Dc zzz at 230v Ac ADD THE FOLLOWING LENS CODES TO THE PRODUCT WHEN ORDERING LED100 Kg 0.11 0.145 LEDES100 APPROVALS and CONFORMITIES 50/60 Hz o C -25+55 UV Stable Polycarbonate Lens 01 02 04 IP 65 2 x Ø5.0mm Knockouts UV Stable ABS Plastic Base FPM 160 INDUSTRIAL 17 Visual Signals - Industrial LED ECO BEACONS 45mm 119mm Industrial LED ECO Beacons > LEDD & LEDA 100 Series 90mm 38mm 10mm 66mm The LEDA version incorporates one piezo buzzer situated in the base of the unit that is synchronised to the ÀDVKUDWHWKHEX]]HUFDQQRWEH The LED ECO range has been designed controlled independently of the light) predominantly to offer a cost effective offering a combined audible & visual warning signal. solution against more traditional 38mm Side knockout for cable entry if required 20mm incandescent types of lamps, whether through new plant and machinery LQVWDOODWLRQVRUH[LVWLQJIDFLOLW\XSJUDGHV The design allows for termination inside the enclosure through the base of the beacon enclosure. Ø98mm Ø88mm The LEDD & LEDA 100 economy series are suitable for light commercial & industrial signalling applications where local indication is required. These beacons have two selectable stages RIDODUPÀDVKLQJRUFRQWLQXRXVVWDWLF mode, selectable by a jumper link on the PCB. The design also allows for a third ZLUHFRQQHFWLRQJLYLQJÀH[LELOLW\WRVZLWFK IURPDSUHVHWVWDWLFPRGHWRÀDVKLQJ 6mm Product overview Ø5.80mm Cable entry hole 3 fixing points Ø4.40mm spaced equidistant Ø88.0mm P.C.D. Features LEDD & LEDA 100 Series > Ordering Information Continuously rated Code No: Voltage: Light Source: Current: LEDD100-01 LEDD100-02 LEDD100-03 LEDD100-05 8-20v Ac/Dc --~ 20-30v Ac/Dc --~ 48v Ac ~ 40-380v Dc --85-280v Ac ~ 8 SMT LEDs 8 SMT LEDs 8 SMT LEDs 8 SMT LEDs 430mA z 110mA zz tba 35mA zzz LEDA100-01 LEDA100-02 LEDA100-03 LEDA100-05 8-20v Ac/Dc ~ 20-30v Ac ~ 48v Ac ~ 40-380v Dc --85-280v Ac ~ 8 SMT LEDs 8 SMT LEDs 8 SMT LEDs 8 SMT LEDs 430mA 110mA zz tba 35mA zzz LED long life Low current consumption Suitable for surface or wall mounting Optional wall bracket & guard available - see accessories SRLQW¿[ z at 12v Dc zz at 24v Dc APPROVALS and CONFORMITIES 50/60 Hz 360o light output around WKHYHUWLFDOD[LV Dustproof and Weatherproof Material at 230v Ac zzz ADD THE FOLLOWING LENS CODES TO THE PRODUCT WHEN ORDERING Kg 0.14 z o C -25+55 UV Stable Polycarbonate Lens 01 02 04 IP 65 UV Stable ABS Plastic Base FPM 160 dB 80 INDUSTRIAL 18 14mm 33mm 107mm Visual Signals - Industrial LED ECO BEACONS 2 x M5 Studs Ø65mm Industrial LED ECO Beacons > LEDS 100 Series Product overview Ø72mm 45 Stu dC en tre s 0 This design allows for termination inside the enclosure through the base of the beacon, either from directly below or using a 6mm cabling channel at 90o to the base for surface cabling. The LEDS version incorporates two mounting studs [PPRQPPFHQWUHV Flush mount cable channel 2 These beacons have two selectable VWDJHVRIDODUPÀDVKLQJRUFRQWLQXRXV (static) mode, selectable by a jumper link on the PCB. The design also allows for DWKLUGZLUHFRQQHFWLRQJLYLQJÀH[LELOLW\ to switch from a pre-set static mode to ÀDVKLQJ Ø6 Cable entry hole 12 The LEDS 100 economy series is suitable for light commercial & industrial signalling applications where local indication is required. The LED ECO range has been designed predominantly to offer a cost effective solution against more traditional incandescent types of lamps, whether through new plant and machinery LQVWDOODWLRQVRUH[LVWLQJIDFLOLW\XSJUDGHV Side knockout for cable entry if required 6mm Features Continuously rated LED long life Low current consumption Suitable for surface or wall mounting LEDS 100 Series > Ordering Information Optional wall bracket & guard available - see accessories Code No: Voltage: Light Source: Current: LEDS100-01 LEDS100-02 LEDS100-03 LEDS100-05 8-20v Ac/Dc --~ 20-30v Ac/Dc --~ 48v Ac ~ 40-380v Dc --85-280v Ac ~ 8 SMT LEDs 8 SMT LEDs 8 SMT LEDs 8 SMT LEDs 430mA z 110mA zz tba 35mA zzz z at 12v Dc zz at 24v Dc APPROVALS and CONFORMITIES 50/60 Hz 360o light output around WKHYHUWLFDOD[LV Dustproof and Weatherproof Material zzz at 230v Ac ADD THE FOLLOWING LENS CODES TO THE PRODUCT WHEN ORDERING Kg 0.14 VWXG¿[ o C -25+55 UV Stable Polycarbonate Lens 01 02 04 IP 65 UV Stable ABS Plastic Base FPM 160 INDUSTRIAL 19 Visual Signals - Industrial LED ECO BEACONS 56mm LED Module CAP 16mm Ø70mm Ø70mm Industrial LED ECO Beacons > LED-TLM Series DQGPDFKLQHU\LQVWDOODWLRQVRUH[LVWLQJ facility upgrades. Product overview The LED Tower Light Module series is ideally suited for status indication in light commercial & industrial signalling applications where a local signal is required. These beacons have two VHOHFWDEOHVWDJHVRIDODUPÀDVKLQJRU continuous (static) mode, selectable by a slide switch on the PCB. The LED TLM ECO range has been designed predominantly to offer a cost effective solution against more traditional incandescent types of lamps, whether through new plant The design is modular and is easily assembled. Colour modules are supplied ZLWKTXLFN¿[WHUPLQDWLRQWKDWVLPSO\ push into male terminal in the module below to make a connection. Customer connections are into the base unit only. Audible modules are also available. The two ECO sounders units (Dc or Ac) offer up to 100dB and are either continuous or pulsed tone and rated at IP54. An additional high output sounder unit offers up to a 120dB and is either continuous or pulsed tone and is rated at IP65. Data sheets available. BASE 46mm Base & Cap Module Ø100mm 4 holes Ø5.5mm equi-spaced on Ø88mm pcb Control Termination CABLE ENTRY Ø12mm Base Termination (R) (Y) (G) (B) (W) L or + (POWER) N or (GND) (R) (G) (W) (GND) (Y) (B) Features Continuously rated LED long life LED-TLM Series > Ordering Information Low current consumption Code No: Voltage: Light Source: Current: LED-TLM-02 LED-TLM-04 24v Dc --85-275v Ac ~ 18 SMT LEDs 18 SMT LEDs 45mA 75mA LED-TLM-AUD-02 LED-TLM-AUD-04 24v Dc --85-275v Ac ~ n/a n/a 55mA 20mA LED-TLM-BC Mounting Base and Cap APPROVALS and CONFORMITIES 50/60 Hz 360o light output around WKHYHUWLFDOD[LV Dustproof and Weatherproof Material UV Stable Polycarbonate Lens ADD THE FOLLOWING LENS CODES TO THE PRODUCT WHEN ORDERING (Light Module) Kg 0.70 0.12 (Base & Cap) Suitable for surface mounting o 01 02 03 04 05 C -25+55 IP 65 UV Stable ABS Plastic Base FPM 60 Dc dB 100 100/120 Ac INDUSTRIAL 20 162mm Visual Signals - Industrial LIGHT EMITTING DIODE BEACONS Industrial LED Multi Functional Beacons > LEDD & LEDA 125 Series source (ie. control panel / plc etc ) RIIHULQJWKHSRWHQWLDORIUHPRWHÀDVK option. The design for the DC unit allows for termination inside the enclosure via an M12 sealing grommet in the base. The AC units are supplied ZLWKDPHWUHÀ\LQJOHDG The LEDD and LEDA125 series are suitable for security, process control & industrial applications, where low maintenance and long life are the pre-requisite requirement. These beacons offer a three stage alarm option, selected by a jumper link on the PCB: 1. Continuous mode 2. Flashing mode at 1Hz 3. Flashing mode at 2Hz An advantage of the Continuous mode is that it can be controlled via a remote The LEDA version incorporates two piezo buzzers situated in the base of the unit that are synchronised to the light mode (the buzzers can be controlled separately of the light on the DC version Only) offering a combined audible & visual warning device. LEDD & LEDA 125 Series > Ordering Information ø98mm Optional Piezo Buzzers 3 Holes x ø4.5 on 88 pcd 27.6 Product overview Lead exit position 5mm max cable size 11mm 11º Side knockout position Features t Continuously rated t LED long life and extra bright Code No: Voltage: Light Source: LEDD125-02 24v Dc --- 48 LEDs LEDD125-03 115v Ac ~ 48 LEDs LEDD125-04 230v Ac ~ 48 LEDs Current: 01 02 03 150 mA 60 mA 40 mA 170 mA 60 mA 40 mA 170 mA 60 mA 40 mA t Suitable for surface or wall mounting 04 05 170 mA 170 mA 60 mA 60 mA 40 mA 40 mA t Optional wall bracket & guard available - see accessories t SRLQW¿[ t 360o light output around the vertical axis. For Audible Option LEDA125-02 24v Dc --- 48 LEDs LEDA125-03 115v Ac ~ 48 LEDs LEDA125-04 230v Ac ~ 48 LEDs 155 mA 60 mA 40 mA 175 mA 60 mA 40 mA 175 mA 60 mA 40 mA 175 mA 175 mA 60 mA 60 mA 40 mA 40 mA 1RWH7KHWHFKQLFDOVSHFL¿FDWLRQOLVWHGDERYHZLOORQO\FRPHLQWRVWDQGDUGPDQXIDFWXUHLQWKHQGTXDUWHURI )RUFXUUHQWVWDQGDUGVSHFL¿FDWLRQIRUWKHVHEHDFRQVJRWRRXUZHEVLWH ADD THE FOLLOWING LENS CODES TO THE PRODUCT WHEN ORDERING Kg 0.57 Ac 0.33 Dc APPROVALS and CONFORMITIES 50/60 Hz o Material UV Stable Polycarbonate Lens 01 02 03 04 05 C -20+45 t Dustproof and Weatherproof IP 65 UV Stable ABS Plastic Base FPM 60/120 INDUSTRIAL dB 90 FIRE 21 Visual Signals - Industrial LIGHT EMITTING DIODE BEACONS LED201/200 156mm LED201/200 2 x 5mm x 51mm CRS 205mm 49mm LED401/400 115mm 3 holes x 96 PCD to accept No 6 self tap screw (external fitting) Industrial LED Flashing Rotating Static Beacons > LED201/200 & LED401/400 Series Product overview The LED201/200 and LED401/400 series are suitable for security, process control & industrial applications, where low maintenance and long life are the pre-requisite requirement. These beacons offer a four stage alarm option, selected by a four way switch on the PCB: 1. Continuous mode 2. Flashing mode at 1Hz 3. Rotating mode: Twin column 4. Rotating mode: single column An advantage of the continuous mode is that it can be controlled via a remote source (ie. control panel / plc etc) offering the potential of a remote ÀDVKLQJRSWLRQ7KHGHVLJQDOORZV for termination inside the enclosure through the base. LED201/200 & LED401/400 Series > Ordering Information Code No: Voltage: Light Source: LED201-02 LED200-04 z 24v Dc --115/230v Ac ~ 144 LEDs 144 LEDs LED401-02 LED400-04 z 24v Dc --115/230v Ac ~ 144 LEDs 144 LEDs 0.25 0.09/0.05 Pre-set to 230v Ac ~ z 2 Bar Rotating zz Kg 1.0 Ac 0.6 Dc APPROVALS and CONFORMITIES 50/60 Hz o Rotating Static zz 0.20 0.50 A 0.12/0.06 zz 0.17/0.10 A 0.20 zz 0.50 A zz 0.12/0.06 0.17/0.10 A 01 02 03 04 05 C -20+45 20mm M20 conduit knockout 3 x Ø6.5 equi-spaced on 130 PCD Features t Continuously rated t LED long life and extra bright t LED201/200: Suitable for surface, conduit box or wall mounting t LED401/400: Suitable for surface or wall mounting available - see accessories Note: Current consumption is an average over a 60 second cycle ADD THE FOLLOWING LENS CODES TO THE PRODUCT WHEN ORDERING LED401/400 205mm t Optional wall bracket & guard Current: Flashing 0.25 0.09/0.05 Ø150mm IP 65 t LED401/400: M20 conduit side entry or bottom cable entry. t 360o light output around the vertical axis. t Dustproof and Weatherproof Material UV Stable Polycarbonate Lens UV Stable ABS Plastic Base FPM 60 INDUSTRIAL RPM 140 FIRE 22 Visual Signals - Industrial LIG LIGHT EMITTING DIODE BEACONS Industrial LED Beacons > LED450 Series Product overview The LED450 series is suitable for Industrial & Marine signalling applications where a visual signal is required to operate in very harsh enviromental conditions. The beacons incorporate an ultra bright LED array and offers a three stage alarm option. 7KHXQLWKDVDPXOWLSOHÀDVKUDWHVHWWLQJ that can be set at installation, that ranges IURPÀDVKHVSHUPLQXWHXSWR ÀDVKHVSHUPLQXWHWRFUHDWHDPRUH noticeable warning signal to the human eye. A rotating light mode and a static (steady on) mode are also available. 7KHXQLWVDOVRKDYHWKHDELOLW\WREH¿WWHG with a telephone initiation function and can be used as the second ring output indicator for telephones when installed in very noisy environments. Design allows for termination in the base. t LED long life t Continuously rated t High light output LED450 Series > Ordering Information t Suitable for surface or wall mounting Code No: Voltage: Light Source: Current: LED450-18 12-48v Dc --- LED 10W 1.1/0.53/0.24 A LED450-22 100-240v Ac ~ LED 10W 0.08 A z z Features at 230v Ac~ t Supplied as standard with 1 x M20 threaded side cable entry with provision for up to 4 supplied to special order t 3600 light output around the vertical axis t Dustproof and Weatherproof Material ADD THE FOLLOWING LENS CODES TO THE PRODUCT WHEN ORDERING Kg 0.5 APPROVALS and CONFORMITIES 50/60 Hz o 01 02 03 04 05 C -40+70 IP 66 UV Stable, Flame retardent polycarbonate FPM 60x180 MARINE INDUSTRIAL 23 Visual Signals - Industrial LIGHT EMITTING DIODE BEACONS 76.00mm Product overview Suitable for a wide range of applications the E-Flare beacon has been designed with versatility in mind. The unit provides a highly visible warning zone, day or night. These beacons are single colour only and incorporate a failsafe activation switch to prevent 147.03mm E-Flare Battery Operated > LED Portable Beacon accidental turn on or off and come with a range of accessories. The EF350 beacon is an economy option, powered by four ‘AA’ Cell Alkaline batteries (not supplied) that will provide at least 30 hours of peak brightness operation and comes with a lanyard (as standard) for hanging/ wearing the unit. Features t Continuously rated t LED long life LED Portable Beacon > Ordering Information Code No: Voltage: Light Source: LED-P-EF350-01 (Amber) LED-P-EF350-01B (Amber Pk 12) 3v Dc --3v Dc --- 4 LEDs 4 LEDs LED-P-EF350-02 (Red) LED-P-EF350-02B (Red Pk 12) 3v Dc --3v Dc --- 4 LEDs 4 LEDs t Shock resistant t Ultra quick installation t Versatile accessory options t 360o light output around the vertical axis t Special bulk pack pricing t Dustproof and Weatherproof Accessories Material UV Stable Polycarbonate Lens 50170 50172 Standard Base Magnetic Clip Kg 0.16 APPROVALS and CONFORMITIES 50177 50178 50174 50175 50176 Magnetic Base Flotation Collar Suction Cup Daylight Hood Carry Bag 50173 Cone Clip o C -20+50 IP 66 FPM 160 UV Stable ABS Body INDUSTRIAL AUTOMOTIVE MARINE 24 Audible + Visual > Tri-Colour LED PLC Controllable Beacon Product overview The Spectrum 600 Series utilises ultra-bright, tri-colour LEDs in one enclosure producing amber, green and red light in conjunction with two synchronised piezo sounders. The beacon is a cost-effective alternative to traditional stacking beacons and other process indication applications where multiple signal outputs, long life and low power consumption are required. The Spectrum 600 comes totally assembled and ready for immediate installation. In addition, the enclosure incorporates a high Ingress Protection (IP) rating and is manufactured from a tough, UV stable polycarbonate plastic that makes the beacon suitable for harsh industrial and marine environments. The Spectrum 600 requires external input signals for it to function. If no PLC (or similar) is available, then the Spectrum Interface Unit gives the end user a control option. Features t Three colours in one housing - amber red green t 360o visibility t LED long life and low power t Combined beacon & piezo sounders t 28 signal options t PLC controllable Spectrum 600 Series > Ordering Information Code No: Voltage: Light Source: t Optional interface unit for Current: Amber Red/Green 250 mA LEDA600-01 24v Dc/230v Ac Tri-Colour LED 350 mA LEDA600-03 24v Dc/115v Ac Tri-Colour LED 350 mA 250 mA @ 24v Dc 50165 Interface 230v Ac ~ 50166 Mounting Pole 50004 Right-angled Wall Bracket Kg 0.85 FPM 60x90 APPROVALS and CONFORMITIES 50/60 Hz dB 90 non PLC operation t Ethernet compatible t Tough, UV stable polycarbonate housing t IP66,67 69k Material UV Stable Polycarbonate Plastic o C -35+55 INDUSTRIAL IP 66 67 69k MARINE 25 The Control Signal The Control Signal must consist of a 5-bit word, which has to be assembled and transmitted in parallel mode to the Spectrum %HDFRQ7KHFRORXUÀDVKIUHTXHQF\ and sound are independent of one another but a colour signal is necessary for the control word to be accepted, thus any word beginning with OO will not be accepted. 50165 Interface Unit (optional) for further information download the Interface Datasheet from the website The Interface Unit contains seven electrically isolated prioritised channels. Each channel accepts 24-230v Ac or 12-48v Dc input. A pre-selected audio and/or visual signal is supplied for each of the seven channels. In the event of no signal being applied, the beacon displays continuous green. The operating voltage for the unit is 230v Ac. The design allows for a 12v Dc auxiliary power supply for use in volt free applications. Additionally, the unit incorporates a battery back-up (not VXSSOLHGVXI¿FLHQWWRPDLQWDLQWKHXQLWIRUKRXUVLQFDVHRIPDLQVIDLOXUH Provision is made for mains failure to be signalled from the interface unit (device not supplied). The unit is supplied complete with mounting plate and cover. This can be installed either inside an existing enclosure or into a standard weatherproof ‘Fibox’ IP67 mounting box (ref: MNX PCM200/63 G). 7HFKQLFDO6SHFLÀFDWLRQ Type: LEDA600-01 LEDA600-03 Light Source: Ultra-bright Tri-colour LEDs Amber 3.9 Effective Candela (390 mcd) Green 6.2 Effective Candela (620 mcd) Red 4.4 Effective Candela (440 mcd) Signal Options: Continuous Slow Flash Rapid Flash 1 Rapid Flash 2 Sounder Type: Electronic Piezo Sounders x 2: 20mA dB@1m 90dB +3dB (horn covers not installed) Frequency 3.1Hz +500Hz Visual and audible signalling options can be combined DXGLEOHVLJQDOV\FKURQLVHGZLWKEHDFRQÀDVK Operating Temp: -35 C to 55 C Enclosure Material: UV Stable Polycarbonate Plastic Ingress Protection: IP65 & IP67 as standard as one enclosure. ,3ZLWKVRXQGHUFRYHUV¿WWHG6RXQGHUFRYHUVFDQEH¿WWHG VQDS¿[HGRUSHUPDQHQWO\DGKHUHGLQWRSODFH Sounder covers supplied as standard. Beacon Control: 7KHEHDFRQLVVXSSOLHGZLWKÀ\LQJOHDGV[PHWUH 4 core power cables and 6 core signal cables. 0 0 24v Dc or 230v Ac 24v Dc or 115v Ac On 60 fpm 90 fpm (0.11sec ON, 0.23sec OFF) 90 fpm (0.23sec ON, 0.11sec OFF) Weight: 0.85kg For further information download the Technical Datasheet from the website. Mounting Options The beacon has three mounting options: Surface Mount Plate SRLQW',1¿[¿WWHGDVVWDQGDUG Side knockouts x 2 cabling in/out (15mm x 10mm). Foot and Pole Mount (50166) Right Angled Wall Bracket (50004) 26 162mm Visual Signals - Industrial LIGHT EMITTING DIODE BEACONS ø98mm LED Tri-Colour Visual & Audible Beacon > LEDA125-01 PLC Controllable Series Product overview The LEDA125-01 offers maximum ÀH[LELOLW\LQWHUPVRIYLVXDODQG audible requirements. The beacon can produce 3 colours, Amber, Green and Red in conjunction with an audible signal. Two piezo sounders situated in the base of the unit can be synchronised with any colour DQGÀDVKUDWHUHTXLUHG7KHXQLW requires high or low voltage inputs to function (plc / relays etc). Ideally suited to status control the beacon is a cost effective alternative to the traditional tower light. An M12 sealing grommet in the base allows for cable entry and termination inside the enclosure. Maximum cable size is 5mm. 27.6 3 Holes x ø4.5 on 88 pcd Lead exit position 5mm max cable size 11mm 11º Side knockout position Features t Continuously rated t LED long life and extra bright t Suitable for surface or wall mounting t Optional wall bracket & guard available - see accessories t SRLQW¿[ t 360o light output around the LEDA125-01 Series > Ordering Information Code No: Voltage: Light Source: LEDA125-01 24v Dc --- 48 SM LEDs vertical axis Current: Amber Green/Red 350mA 250mA t Dustproof and Weatherproof Material UV Stable Polycarbonate Lens UV Stable ABS Plastic Base Kg 0.33 APPROVALS and CONFORMITIES o C -20+45 IP 65 dB 90 INDUSTRIAL 27 Visual Signals - Industrial ROTATING BEACONS R201/200 RA201/200 Industrial Rotating Beacons > R201/200 & RA201/200 Series UHÀHFWRULVGULYHQE\DWZLQEHOWGULYH system that is powered by a series wound motor for ‘AC’ units and a The R201/200 & RA201/200 series offer permanent magnet motor for ‘DC’ units. a cost effective, single stage alarm, The design allows for termination inside suitable for a wide range of applications the enclosure through the base. where a powerful & commanding signal is required. The RA201/200 series incorporates a piezo buzzer on the side of the base that ,WLQFRUSRUDWHVDSDUDEROLFUHÀHFWRU is automatically activated when the light which, when energised, revolves around source is energised. a continuously illuminated lamp. This creates a powerful beam of light that Independent buzzer control can be made sweeps through 360 degrees. The to order. Product overview R201/200 & RA201/200 Series > Ordering Information Code No: Voltage: Light Source: Current: R201-13 R201-14 R201-29 z R201-61 z R201-63 R201-64 R200-03 R200-02 R200-04 R200-05 12v Dc --24v Dc --24v Dc --24v Dc --24v Dc --48v Dc --24v Ac ~ 48v Ac ~ 115v Ac ~ 230v Ac ~ H1 x 55w H1 x 70w Ba15s x 10w Ba15d x 21w Ba15d x 48w Ba15d x 35w Ba15d x 48w Ba15d x 35w Ba15d x 60w Ba15d x 60w 4.70 A 3.00 A 0.60 A 0.95 A 2.00 A 0.75 A 2.00 A 0.75 A 0.55 A 0.29 A For Audible Option RA201-20 12v Dc --RA201-21 24v Dc --RA201-64 48v Dc --RA200-03 24v Ac ~ RA200-02 48v Ac ~ RA200-24 115v Ac ~ RA200-25 230v Ac ~ z Diode Polarised for Fire Alarm Systems Piezo Buzzer location RA type only y y Features t Continuously rated Suitable for surface, conduit box or wall mounting Optional wall bracket & guard available - see accessories t SRLQW¿[ t Magnetic base versions available t Low current consumption options H1 x 55w H1 x 70w Ba15d x 35w Ba15d x 48w Ba15d x 35w Ba15d x 60w Ba15d x 60w MB - Magnetic Base 4.70 A 3.00 A 0.75 A 2.00 A 0.75 A 0.55 A 0.29 A t 3600 light output around the vertical axis t Dustproof and Weatherproof Material UV Stable Polycarbonate Lens ADD THE FOLLOWING LENS CODES TO THE PRODUCT WHEN ORDERING Kg 0.83 R201/200 0.86 RA201/200 APPROVALS and CONFORMITIES 50 Hz o 01 02 03 04 05 C -10+55 IP 65 dB 95 RA201/200 UV Stable ABS Mounting Base RPM 160 Dc INDUSTRIAL RPM 120 Ac FIRE 28 Visual Signals - Industrial ROTATING BEACONS Industrial Rotating Beacons > R401/400 Series Product overview The R401/400 series beacon is a cost effective, single stage alarm, suitable for a wide range of applications where a powerful & commanding signal is required. ,WLQFRUSRUDWHVDSDUDEROLFUHÀHFWRU which, when energised, revolves around a continuously illuminated lamp. This creates a powerful beam of light that sweeps through 360 degrees. 7KHUHÀHFWRULVGULYHQE\DWZLQEHOW drive system that is powered by a series wound motor for ‘AC’ units and a permanent magnet motor for ‘DC’ units. The design allows for termination inside the enclosure through the base. Features t Continuously rated R401/400 Series > Ordering Information Code No: Voltage: R401-13 12v Dc --R401-14 24v Dc --z R401-29 24v Dc --R401-60 12v Dc --24v Dc --R401-61 z R401-62 12v Dc --R401-63 24v Dc --R401-64 48v Dc --R400-03 24v Ac ~ R400-02 48v Ac ~ R400-04 115v Ac ~ R400-05 230v Ac ~ z Diode Polarised for Fire Alarm Systems APPROVALS and CONFORMITIES 50 Hz wall mounting Light Source: Current: H1 x 55w H1 x 70w Ba15s x 10w Ba15d x 21w Ba15d x 21w Ba15d x 48w Ba15d x 48w Ba15d x 35w Ba15d x 48w Ba15d x 35w E14 x 60w E14 x 60w 4.70 A 3.00 A 0.60 A 1.85 A 0.95 A 4.00 A 2.00 A 0.75 A 2.00 A 0.75 A 0.55 A 0.29 A t Optional wall bracket & guard available - see accessories t SRLQW¿[ t M20 conduit side entry or bottom cable entry t Low current consumption options t 3600 light output around the vertical axis t Dustproof and Weatherproof Material UV Stable Polycarbonate Lens ADD THE FOLLOWING LENS CODES TO THE PRODUCT WHEN ORDERING Kg 0.98 t Suitable for surface and o 01 02 03 04 05 C -10+55 IP 65 UV Stable ABS Mounting Base RPM 160 Dc FIRE RPM 120 Ac INDUSTRIAL 29 Visual Signals - Industrial XENON BEACONS M4 x 13mm lg studs. Nuts and washers provided 50mm 26mm ø76mm 2 Leads x 500mm lg ø45mm Industrial Xenon Beacons > X80 Series 2 x slots 4 x 9mm 2 off Snap-fit Optional Fixing Plates supplied for Surface mounting Product overview then discharging a large current through the xenon gas. 7KH;LVDÀDVKLQJPRGHW\SHRI beacon (single stage alarm) suitable for a wide range of ‘local’ signalling applications where a low cost and HQHUJ\HI¿FLHQWVROXWLRQLVUHTXLUHG The unit comes fully assembled and ready for installation and has two mounting options, stud mount or surface mount using a two piece ¿[LQJSODWHVXSSOLHG2QHSODWHLV ¿[HGWRWKHDSSURSULDWHVXUIDFHWKH other to the beacon, the two plates WKHQµVQDS¿W¶WRJHWKHU Xenon beacons (sometimes called strobes) are controlled via a PCB and put out a very brief but bright ÀDVKRIZKLWHOLJKWE\LRQL]LQJDQG 55mm 8mm thick Fixing Plate Surface Mount Option Features X80 Series > Ordering Information Code No: Voltage: Light Source: Current: X80-01 18-30v Dc --- Xenon 1.0 J 40 mA X80-02 10-100v Dc --20-72v Ac ~ Xenon 2.0 J 110 mA z 115-230v Ac ~ Xenon 2.0 J t Continuously rated t Wide operating voltage X80-04 z t 120o prime light output from vertical axis t Dustproof and submersible in water 100 / 50 mA Material Average running current at 24v Dc over a 60 second cycle z UV Stable Polycarbonate Lens ADD THE FOLLOWING LENS CODES TO THE PRODUCT WHEN ORDERING Kg 0.13 APPROVALS and CONFORMITIES o C -20+55 01 02 03 04 05 IP 67 FPM 60/65 UV Stable Polycarbonate Base INDUSTRIAL FIRE 30 Visual Signals - Industrial XENON BEACONS X125 Series 102mm 138mm X125 ES Version Industrial Xenon Beacons > X125 Series 2 x 5mm knockouts 51mm 65mm current through the xenon gas. The design allows for termination inside the enclosure through the base (except ES version). Product overview The X125 series are suitable for security, process control and light industrial applications where a lower cost and HQHUJ\HI¿FLHQWVROXWLRQLVUHTXLUHG The ES version has an ES27 Edison 6FUHZFDS¿WWHGLQWRWKHEDVHRIWKH beacon. This design lends itself for use in temporary signalling locations where a warning or hazard is not normally present, or has the ability to be installed in an area using existing electrical lighting points, avoiding any additional wiring. 7KHVHEHDFRQVDUHRIWKHÀDVKLQJPRGH type (single stage alarm) Xenon beacons (sometimes called strobes) are controlled via a PCB and put out a very EULHIEXWEULJKWÀDVKRIZKLWHOLJKWE\ ionizing and then discharging a large X125 Series > Ordering Information 138mm 151mm X125 ES Version Features Continuously rated Suitable for surface, conduit box or wall mounting (except ES version) Optional wall bracket & guard available - see accessories Code No: Voltage: Light Source: Current: X125-Ac/Dc 10-100v Dc --20-72v Ac ~ 115v Ac ~ 230v Ac ~ Xenon 2.0 J 130 mA z 360o light output around the vertical axis Xenon 2.3 J Xenon 2.7 J 30 mA 21 mA 180o light output above the horizontal axis X125-55 X125-56 ES Version X125ES-51 X125ES-52 115v Ac ~ 230v Ac ~ Xenon 2.3 J Xenon 2.7 J 30 mA 21 mA At 24v Dc --- APPROVALS and CONFORMITIES Material UV Stable Polycarbonate Lens ADD THE FOLLOWING LENS CODES TO THE PRODUCT WHEN ORDERING 0.17 X125 0.20 X125ES SRLQW¿[ Dustproof and Weatherproof z Kg 25mm X125 Series 50/60 Hz o 01 02 03 04 05 C -25+55 IP 65 UV Stable ABS Plastic Base FPM 60 INDUSTRIAL 31 162mm Visual Signals - Industrial XENON BEACONS Industrial Xenon Beacons > X125 DIN Base Series The X125 DIN base series are suitable for security, process control & generally light industrial signalling applications. These beacons are of the Flashing mode type (single stage alarm) Xenon beacons (sometimes called strobes) are controlled via a PCB and put out DYHU\EULHIEXWEULJKWÀDVKRIZKLWH light by ionizing and then discharging a large current through the xenon gas. The design allows for termination inside the enclosure via an M12 sealing grommet in the base. The XA version incorporates two piezo buzzers situated in the base of the unit that can either be V\QFKURQLVHGWRWKHÀDVKUDWHRU controlled independently of the light offering a combined audible & visual warning device. Optional Piezo Buzzers 3 Holes x ø4.5 on 88 pcd 27.6 Product overview ø98mm Lead exit position 5mm max cable size 11mm 11º Side knockout position Features t Continuously rated X125 DIN Base Series > Ordering Information t Suitable for surface or wall mounting t Optional wall bracket & guard Code No: Voltage: Light Source: Current: X125-64 10-100v Dc --20-72v Ac ~ 115v Ac ~ 230v Ac ~ Xenon 2.0 J 130 mA z X125-62 X125-63 available - see accessory page t SRLQW¿[ t 360o light output around Xenon 2.3 J Xenon 2.7 J 30 mA 21 mA the vertical axis t 180o light output around the horizontal axis Audible Option XA125-63 230v Ac ~ at 24v Dc --- Xenon 2.7 J With both audible & visual signals operating at the same time z zz ADD THE FOLLOWING LENS CODES TO THE PRODUCT WHEN ORDERING Kg 0.25 X125 0.34 XA125 APPROVALS and CONFORMITIES 120mA zz 50/60 Hz o 01 02 03 04 05 C -25+55 IP 65 t Dustproof and Weatherproof Material UV Stable Polycarbonate Lens UV Stable ABS Plastic Base FPM 60 INDUSTRIAL dB 90 XA125 32 Acoustic & Visual Signals - Industrial XENON BEACONS Top of Combination Unit 100mm ø104mm 73mm Product overview The X194 combination series is suitable for status indication, process control & industrial applications. These units offer a versatile range of multi signalling combinations. Beacons DUH¿WWHGWRJHWKHUWRJLYHXSWR¿YH different colour sequences with the addition of an audible option giving a possible six stage alarm device. The Xenon beacons (sometimes called strobes) are controlled via a PCB and put out a very brief but EULJKWÀDVKRIZKLWHOLJKWE\LRQL]LQJ and then discharging a large current through the xenon gas. Sounder & Beacon Combination M20 ø93mm Industrial Acoustic & Xenon Beacons > X194 Combination Series Gap 6mm 450 93mm Bottom of Combination Unit ø4.5 Sounder 104mm The design allows for termination in the uppermost beacon through an M20 knockout either through top or rear of the enclosure. M20 900 60 450 All signals can be controlled independently from each other. 50 ø4.5 50 X194 Combination Series > Ordering Information 93mm Code No: X194-02RD X194-02RS X194-02WH X194-02WS Description: Voltage: Beacon only, Red Back Box Beacon / Sounder Red Beacon only, White Back Box Beacon / Sounder White 18-28v Dc --18-28v Dc --18-28v Dc --18-28v Dc --- Light Source: Current: Features Xenon 2.5 J Xenon 2.5 J Xenon 2.5 J Xenon 2.5 J t Continuously rated 180 mA 200 mA z 180 mA 200 mA z 6HWDW%6¿UHWRQHG% z X194-05RD X194-05RS X194-05WH X194-05WS 180-265v Ac ~ 180-265v Ac ~ 180-265v Ac ~ 180-265v Ac ~ Xenon 5.0 J Xenon 5.0 J Xenon 5.0 J Xenon 5.0 J 110 mA 130 mA z 110 mA 130 mA z Eg X194-02RS-01-02-04 Part code follows colour sequence order from sounder (last digit dictates top position) (24v Dc Unit, Red Sounder & Back Box + Amber, Red, Green beacons with Red Back Boxes) ADD THE FOLLOWING LENS CODES TO THE PRODUCT WHEN ORDERING APPROVALS and CONFORMITIES t 1200 prime light output above the vertical axis for the beacons t Sounder has 32 selectable tones Beacon only, Red Back Box Beacon / Sounder Red Beacon only, White Back Box Beacon / Sounder White each Sounder Kg 0.21 0.22 each Beacon t Suitable for wall mounting 50/60 Hz o 01 02 03 04 05 C -25+55 IP 65 t Red (RD) or White (WH) back box colour choice t Dustproof and Weatherproof Material UV Stable Polycarbonate Lens VO Rated ABS Back Box FPM 60 dB 100-111 INDUSTRIAL FIRE 60 33 Visual Signals - Industrial XENON BEACONS X195 & X197 Deep Base Option X195 Shallow Base Option 65mm Industrial Xenon Beacons > X195 / X197 Series Product overview The X195 and X197 are suitable for security, process control & general industrial signalling applications. These beacons are of the Flashing mode type (single stage alarm) Xenon beacons (sometimes called strobes) are controlled via a PCB and put RXWDYHU\EULHIEXWEULJKWÀDVKRI white light by ionizing and then discharging a large current through the xenon gas. The design allows for termination inside the enclosure. The X195 deep base version offers 2 x M20 side knockouts and 1 x M20 rear. 7KHVKDOORZEDVHORZSUR¿OHYHUVLRQ allows for cable entry of up to 5mm on the side of the unit (x2) and 1 x M20 knockout at the rear. The X197 high power version only allows for internal connection via the M20 rear knockout. Due to the power rating the unit has a rated ’On’ time of 2 hours in any six (see technical data sheet). Features t Continuously rated - Not X197 X195 / X197 Series > Ordering Information t Suitable for conduit box or wall mounting Code No: Voltage: Light Source: Current: t 1200 prime light output above the vertical axis 5 Joules Version X195-02WH-SB X195-02WH X195-05WH-SB X195-05WH ~ 15-28v Ac/Dc --~ 15-28v Ac/Dc --180-265v Ac ~ 180-265v Ac ~ Xenon 5.0 J Xenon 5.0 J Xenon 5.0 J Xenon 5.0 J 310 mA 310 mA 110 mA 110 mA t WH = White back box 10 Joules Version X197-02WH 24v Dc --- Xenon 10.0 J 650 mA Material ADD THE FOLLOWING LENS CODES TO THE PRODUCT WHEN ORDERING Kg 0.25 APPROVALS and CONFORMITIES 50 Hz o 01 02 03 04 05 C -25+45 IP 65 t SB = Shallow base t Dustproof and Weatherproof UV Stable Polycarbonate Lens UV Stable ABS Plastic Base FPM 60 INDUSTRIAL FIRE 35 Visual Signals - Industrial XENON BEACONS Industrial Xenon Beacons > X201SD-200S Series Product overview The X201SD-200S series are suitable for security & general industrial signalling applications where a more robust and powerful signal is required. These beacons are of the Flashing mode type (single stage alarm) Xenon beacons (sometimes called strobes) are controlled via a PCB and put out a YHU\EULHIEXWYHU\EULJKWÀDVKRIZKLWH light by ionizing and then discharging a large current through the xenon gas. The design allows for termination inside the enclosure. The internal electronics are encapsulated with a resin compound to protect against the harshest of environments, also offering additional protection from vibration. This range of beacons incorporates a Fresnel design on the outside lens designed to maximise the light LQWHQVLW\DQGKDVDGRXEOHÀDVKDV standard on the DC versions, single ÀDVKRQWKH$&YHUVLRQ Features t Continuously rated t High light output t Very robust construction X201SD-200S Series > Ordering Information t Suitable for surface or wall mounting t Optional wall bracket (not pre-drilled) Code No: Voltage: Light Source: Current: & guard available - see accessories t 3600 light output around X201-SD-12 12-48v Dc --- Xenon 11.0J 1.50 A z the vertical axis t 1800 light output above X200S-240 240v Ac ~ Xenon 11.0J 0.05 A the horizontal axis t Dustproof and Weatherproof At 24v Dc --- z Material ADD THE FOLLOWING LENS CODES TO THE PRODUCT WHEN ORDERING Kg 0.92 APPROVALS and CONFORMITIES 50/60 Hz o 01 02 03 04 05 C -35+66 IP 66 UV Stable Polycarbonate Lens Zinc Cast Metal Base FPM 60 Ac 120 Dc MARINE INDUSTRIAL 34 Visual Signals - Industrial XENON BEACONS X201/200 X201/200 X401/400 156mm 2 x 5mm x 51mm CRS 205mm Industrial Xenon Beacons > X201-200 & X401-400 Series 49mm 115mm 3 holes x 96 PCD to accept No 6 Ø150mm Product overview The X201/200 and X401/400 are suitable for security & general industrial signalling applications where a more robust and powerful signal is required. These beacons are of the Flashing mode type (single stage alarm) Xenon beacons (sometimes called strobes) are controlled via a PCB and put out a YHU\EULHIEXWYHU\EULJKWÀDVKRIZKLWH light by ionizing and then discharging a large current through the xenon gas. The design allows for termination inside the enclosure. This series incorporates an internal Fresnel lens designed to maximise the OLJKWLQWHQVLW\DQGKDVDGRXEOHÀDVK option (activated by a slide switch on the PCB) that extends the signal duration making it more noticeable to the human eye. The DC unit is factory set at 24v but a slide switch on the PCB can change it to 12v operation. X401/400 205mm M20 conduit knockout 20mm 3 x Ø6.5 equi-spaced on 130 PCD Features t Continuously rated t High light output t X201/200: Suitable for surface, conduit box or wall mounting X201-200 & X401-400 Series > Ordering Information t X401/400: Suitable for surface Code No: Voltage: Light Source: Current: X201-18 z X201-19 zz X200-88 X200-21 X200-22 12/24v Dc --12/24v Dc --24v Ac ~ 115v Ac ~ 230v Ac ~ Xenon 10J / 7.5J Xenon 10J / 7.5J Xenon 10J / 7.5J Xenon 10J / 7.5J Xenon 10J / 7.5J 1.45 / 0.7 A 1.45 / 0.7 A 0.72 A 0.10 A 0.06 A X401-18 z X401-19 zz X400-88 X400-89 zzz X400-21 X400-22 12/24v Dc --12/24v Dc --24v Ac ~ 48v Ac ~ 115v Ac ~ 230v Ac ~ Xenon 10J / 7.5J Xenon 10J / 7.5J Xenon 10J / 7.5J Xenon 7J / 5J Xenon 10J / 7.5J Xenon 10J / 7.5J 1.45 / 0.7 A 1.45 / 0.7 A 0.72 A 0.37 A 0.10 A 0.06 A z Kg 0.72 X201/200 0.82 X401/400 APPROVALS and CONFORMITIES 50/60 Hz o 01 02 03 04 05 C -25+55 t Optional wall bracket & guard available - see accessories SRLQW¿[; SRLQW¿[; X401/400: M20 conduit side entry or bottom cable entry t 360o light output around the vertical axis t 180o light output above the horizontal axis t Dustproof and Weatherproof Material zz Pre-set at 24v Dc --Diode Polarised for Fire Alarm Systems Ambient Temperature Range -25oC to +35oC zzz ADD THE FOLLOWING LENS CODES TO THE PRODUCT WHEN ORDERING or wall mounting IP 65 UV Stable Polycarbonate Lens UV Stable ABS Plastic Base FPM 60x90 INDUSTRIAL FIRE 36 Visual Signals - Industrial XENON BEACONS Industrial Xenon Beacons > X450 Series Product overview The X450 series is suitable for Industrial & Marine signalling applications where a visual signal is required to operate in very harsh enviromental conditions. 7KHEHDFRQVDUHRIWKHÀDVKLQJPRGH type (single stage alarm). Xenon beacons (sometimes called strobes) are controlled via a PCB and put out a YHU\EULHIEXWEULJKWÀDVKRIZKLWHOLJKW by ionizing and the discharging a large current through the xenon gas in the tube. 7KHEHDFRQKDVPXOWLSOHÀDVKUDWH settings, that can be set at installation, WKDWUDQJHIURPÀDVKHVSHUPLQXWH XSWRÀDVKHVSHUPLQXWHWRFUHDWH a more noticeable warning signal to the human eye. The units also have the ability to be ¿WWHGZLWKDWHOHSKRQHLQLWLDWLRQ function and can be used as the second ring output indicator for telephones when installed in very noisy environments. Design allows for termination in the base. Features t Continuously rated t High light output t Suitable for surface or wall mounting t Supplied as standard with 1 x M20 threaded side cable entry with provision for up to 4 supplied to special order X450 Series > Ordering Information t 3600 light output around Code No: Voltage: Light Source: Current: X450-18 12-48v Dc--- Xenon 10J 0.85/0.49/0.25 A t 1800 light output above X450-22 100-240v Ac~ Xenon 10J 0.06 A z t Dustproof and Weatherproof z the vertical axis at 230v Ac~ Material ADD THE FOLLOWING LENS CODES TO THE PRODUCT WHEN ORDERING Kg 0.5 APPROVALS and CONFORMITIES the horizontal axis 50/60 Hz o 01 02 03 04 05 C -40+70 IP 66 UV Stable, Flame RetardentPolycarbonate FPM 60x180 MARINE INDUSTRIAL 37 Visual Signals - Industrial XENON BEACONS Industrial Xenon Beacons > X501/500 Series Product overview The X501/500 series are suitable for industrial signalling applications where a very powerful signal is required. These beacons are of the Flashing mode type (single stage alarm) Xenon beacons (sometimes called strobes) are controlled via a PCB and put out DYHU\EULHIEXWYHU\EULJKWÀDVK of white light by ionizing and then discharging a large current through the xenon gas. The design allows for termination inside the enclosure. This range of beacons incorporates an internal Fresnel lens designed to maximise the light intensity and has DGRXEOHÀDVKRSWLRQDFWLYDWHGE\D jumper link on the PCB) that extends the signal duration making it more noticeable to the human eye. The DC unit is factory set at 24v but a jumper link on the PCB can change it to 12v operation. The DC version is also supplied with a bi-lateral current limiter that must be used on all installations to protect the PCB from inrush current damage. Due to the power rating of the beacon it is not recommended for use in excess of 12 hours in any 24 hour period. Voltage: t Rated use only t Very high light output t Suitable for surface or wall mounting t Optional wall bracket & guard available - see accessories t SRLQW¿[ X501/500 Series > Ordering Information Code No: Features t M20 side entry or bottom cable entry Light Source: Current: t 3600 light output around the vertical axis X501-18 z X500-21 X500-22 12/24v Dc --115v Ac ~ 230v Ac ~ Xenon 24J / 18J Xenon 24J / 18J Xenon 24J / 18J 2.30 / 1.30 A 0.65 A 0.40 A t 1800 light output above the horizontal axis t Dustproof and Weatherproof Material Pre-set at 24v Dc --- z ADD THE FOLLOWING LENS CODES TO THE PRODUCT WHEN ORDERING Kg 1.25 APPROVALS and CONFORMITIES 50/60 Hz o 01 02 03 04 05 C -25+35 IP 65 UV Stable Polycarbonate Lens UV Stable ABS Plastic Base FPM 60x90 INDUSTRIAL 38 Miscellaneous - Industrial Brackets, Cage Guards, Domes, Mounts ACCESSORIES Brackets > 50001>50158 50001 Right Angled Wall Bracket Suitable for use with 88, 125 & 201/200 series beacons and the LED100 code type. 100 Series Beacon Lenses 50004 Right Angled Wall Bracket Suitable for use with 401/400, 501/500, 600 & X250 series beacons 50045 Amber Lens 50046 Red Lens 50006 Pipe Bracket Suitable for use with 401/400, 501/500, 600 & X250 series beacons 50007 Right Angled Wall Bracket Suitable for use with 125 & 125DIN series beacons and LED100 & LEDD/LEDA100 code types 50158 IP66 Weatherproof Band Suitable for use with 201/200 series beacons (not shown) Note: Brackets and Cage Guards are not interchangeable at this present time. 50007 50048 Green Lens 50004 125 Series Beacon Lenses 50018 Red Lens 50019 Amber Lens 50020 Blue Lens 50021 Green Lens 50001 50022 Clear Lens 50006 201/200, 401/400 & 501/500 Series Beacon Lenses Cage Guards > 50003>50010 50064 Amber Lens 50065 Red Lens 50066 Blue Lens 50003 Small Cage Guard Suitable for use with 100 & 125 series beacons 50067 Green Lens 50068 Clear Lens 50003/1 Optional Mounting Plate Suitable for use with 125 series beacons 50010 Anti-Vibration Mount 50080 Anti-Vibration Mount Suitable for use with LED100 code type (not LEDD/LEDA100) 6HULHVSRLQW¿[ 201/200 Series Large Cage Guard Suitable for use with 201/200, 401/400 & 501/500 series beacons 50010/1 Optional Mounting Plate Suitable for use with 201/200, 401/400 & 501/500 series beacons Brackets and Cage Guards are not interchangeable at this present time. 170mm Note: 39 AUTOMOTIVE 40 Visual Signals - Industrial AUTOMOTIVE BEACONS X88 Magnetic Base R88 Magnetic Base Rotating Version X88 Static Fix R88 Static Fix Automotive Beacons > Xenon or Rotating Series Product overview that extends the signal duration making it more noticeable to the human eye. The X88 Series is suitable for automotive & general signalling applications where a more robust and powerful signal is required. The DC unit is factory set at 24v but a slide switch on the PCB can change it to 12v operation. Xenon beacons (sometimes called strobes) are controlled via a PCB and SXWRXWDYHU\EULHIEXWYHU\EULJKWÀDVK of white light by ionizing and then discharging a large current through the xenon gas. This range of beacons incorporates an internal Fresnel lens designed to maximise the light intensity DQGKDVDGRXEOHÀDVKRSWLRQDFWLYDWHG by a slide switch on the PCB) The R88 Series is a cost effective alternative for automotive applications where a powerful & commanding signal is required. It incorporates a parabolic UHÀHFWRUZKLFKZKHQHQHUJLVHGUHYROYHV around a continuously illuminated lamp. This creates a powerful beam of light that sweeps through 360 degrees. The UHÀHFWRULVGULYHQE\DZRUPGULYHV\VWHP powered by a permanent magnet motor. Features Automotive Beacons > Ordering Information Code No: Voltage: Light Source: Xenon Version Current: t Continuously rated t High light output ROTATING OPTIONS R88-34 (MB) R88-38 (MB) R88-37 (SF) R88-39 (SF) XENON OPTIONS X88-72 z (MB) X88-75 z (SF) z Pre-set to 24v Dc --MB = Magnetic Base 12v Dc --24v Dc --12v Dc --24v Dc --- H1 x 55w H1 x 70w H1 x 55w H1 x 70w 1.11 MB 0.67 SF APPROVALS and CONFORMITIES t X88: 360o light output around the vertical axis and 180o light output above the horizontal axis t R88: 360o degree light output around the vertical axis t Dustproof and Weatherproof 12/24v Dc --12/24v Dc --- Xenon 8.5 / 6.5J Xenon 8.5 / 6.5J 1.40 / 0.7 A 1.40 / 0.7 A o C -25+55 Material UV Stable Polycarbonate Lens SF = Static Fix ADD THE FOLLOWING LENS CODES TO THE PRODUCT WHEN ORDERING Kg 4.70 A 3.00 A 4.70 A 3.00 A 01 02 03 04 05 IP 65 FPM 60x90 (X) RPM 160+30 (R) Acetal Base with Neoprene Seal AUTOMOTIVE 41 OBSTACLE MARKING 42 Obstacle Marking : Low Intensity Mobile Obstacles > 10 Candela 75 88 238 Visual Signals - Obstacle Marking 10 Candela BEACONS 77 ø1 Product overview ø90 These portable marking lights are powered by a maintenance free 3.6v Nickel Metal Hydride battery. $PRQRFU\VWDOVRODUPRGXOH¿WWHG inside the lens keeps the battery fully charged and can provide enough power to keep the beacon operating non stop for 400 hours in continuously cloudy and rainy days. A built in photocell switches the beacon on & off at dusk and dawn. The On/Off level is between 70/100 lux and is automatic. The unit incorporates an automatic switch after 18 hours in the dark to protect the battery life. 3-M8 x 18 G 3/4” x 22 Features t Conforms to ICAO 10 Candela > Ordering Information Code No: Voltage: Annexe 14 Volume 1, Low Intensity Type A Light Source: t LED Long life and low maintenance Effective Cd: t Rugged construction OLF-PS-10-02 3.6v / 10AH LED 10 t 360o light output around the vertical axis t Dustproof and Weatheproof Material Cast Aluminium with UV Stable ADD THE FOLLOWING LENS CODES TO THE PRODUCT WHEN ORDERING Kg 2.3 APPROVALS and CONFORMITIES o C -20+80 IP 65 02 FPM 60 Polycarbonate Lens OBSTACLE MARKING 43 Visual Signals - Obstacle Marking 40 Candela BEACONS 170mm 135mm Rubber Seal Obstacle Marking : Low Intensity Mobile Obstacles > 40 Candela Product overview This range of beacons has been designed primarily for use on vehicles. There are two mounting RSWLRQVHLWKHUDSHUPDQHQW¿[E\ two screws into the base of the beacon or a magnetic base. Both beacons are pulsed through an internal circuit to generate an On/ Off cycle to product the required ÀDVKUDWH7KHW\SLFDODSSOLFDWLRQ is for marking mobile obstacles in or around aerodromes. Emergency & Security vehicles are designated with Blue lenses and all others shall be Amber. The minimum light output for each colour is 40 Cd. 135mm Rubber Seal 2 Holes x No 6 self tap screw x 50mm CRS Ferrite Magnet BASE OPTIONS Features t Conforms to ICAO Annexe 14 Volume 1, Low Intensity Type C t Magnet base provides a 35 40 Candela > Ordering Information Newton force calculated to provide D¿[RQÀDWVXUIDFHVRIXSWR 80 MPH (subject to conditions) Code No: Voltage: Light Source: Current: Effective Cd: Magnetic Base FF98-34-01 FF98-38-01 FF98-35-03 FF98-40-03 12v Dc --24v Dc --12v Dc --24v Dc --- Ba15d x 21w Ba15d x 21w H1 T/H x 70w H1 T/H x 70w 1.75 A 0.88 A 4.70 A 3.00 A 40 40 40 40 Permanent Fix FF98-37-01 FF98-39-01 FF98-36-03 FF98-41-03 170mm t 3HUPDQHQW¿[EDVHLVVXSSOLHG ZLWKPPRIÀ\LQJOHDGZLWK male & female bullet connectors t 3600 light output around the vertical axis t 1800 light output above the horizontal axis 12v Dc --24v Dc --12v Dc --24v Dc --- Ba15d x 21w Ba15d x 21w H1 T/H x 55w H1 T/H x 70w 1.75 A 0.88 A 4.70 A 3.00 A 40 40 40 40 t Dustproof and Weatherproof Material UV Stable Polycarbonate Lens ADD THE FOLLOWING LENS CODES TO THE PRODUCT WHEN ORDERING Kg 1.00 MB 0.65 PF APPROVALS and CONFORMITIES C -25+55 o IP 65 01 03 FPM 60 Acetal Base with Neoprene Cover AUTOMOTIVE OBSTACLE MARKING 44 Visual Signals - Obstacle Marking 10 & 32 Candela BEACONS Obstacle Marking: Low Intensity Lights > 10 & 32 Candela Series Product overview lend themselves for use with photocell control if required. The typical application is marking ¿[HGREMHFWVLQRUDURXQG aerodromes where the object is a less extensive one and its height above the surrounding ground is less than 45m. These beacons can be used in conjunction with medium and high intensity lights. This range of Obstacle Lights have been designed to offer a more cost effective option for compliance to the low intensity ICAO regulations. The 10 and 32 Candela both incorporate low consumption Red LED arrays. A power rating of 8 watts for the 10 Cd and 12 watts for the 32Cd Features t Conforms to ICAO Annexe 14 Volume 1, Low Intensity Type A (10Cd) & Type B (32Cd) t Continuously rated t LED long life and extra bright t Suitable for surface, 10 & 32 Candela > Ordering Information conduit box or wall mounting t Optional wall bracket & guard Code No: Voltage: Light Source: Mode: Current: Effective Candela: OLS-02-10-02 OLS-03-10-02 OLF-02-10-02 OLS-04-10-02 OLF-04-10-02 24v Ac/Dc --~ 48v Ac/Dc --~ 24v Ac/Dc --~ 230v Ac/Dc --~ 230v Ac/Dc --~ LED LED LED LED LED Static Static Flashing Static Flashing 0.33 A 0.16 A 0.33 A 0.04 A 0.04 A 10 10 10 10 10 OLS-02-32-02 OLS-03-32-02 OLF-02-32-02 OLS-04-32-02 24v Ac/Dc --~ 48v Ac/Dc --~ 24v Ac/Dc --~ 230v Ac/Dc--~ LED LED LED LED Static Static Flashing Static 0.50 A 0.24 A 0.50 A 0.05 A 32 32 32 32 Kg 0.6 APPROVALS and CONFORMITIES 50/60 Hz o C -20+45 IP 66 available - see accessories t SRLQW¿[ t 360o light output around the vertical axis t Dustproof and Weatherproof Material UV Stable Polycarbonate Lens & Base Stainless Steel Sealing Band FPM 60/90 OBSTACLE MARKING 45 AUDIBLE & VISUAL SIGNALS FOR USE IN POTENTIALLY EXPLOSIVE ATMOSPHERES 46 Visual Signals - Explosion Proof GRP BEACON /HQV*XDUGQRW VXSSOLHGDVVWDQGDUG Explosion Proof Beacon > GRP BC150 Series Product overview The BC150 range has been approved for use in potentially explosive atmospheres and very harsh environmental conditions. Typical applications are Oil and Gas, On-shore and Offshore, Chemical, 3HWURFKHPLFDO5H¿QHULHV0DULQH locations etc. )HDWXUHV&HUWLÀFDWLRQV t Approved by ATEX, IECEx t CQST (Available on request only) These beacons have a choice of two types of light source: either Xenon VWUREHZLWKPXOWLSOHÀDVKUDWHDQG power ratings or an LED array with three status type indication options and two power ratings. The design allows for termination inside the enclosure. t ATEX: Ex d IIC T4~ T6 Gb, Ex tb IIIC T1350C~T850C t =RQHV The units also have the ability to be ¿WWHGZLWKDWHOHSKRQHLQLWLDWLRQIXQFWLRQ and can be used as the second ring output indicator for telephones when installed in very noisy environments. t Conforms to: EN 60079-0:2012 (IEC 60079-0:2011), EN-60079-1:2007 (IEC 60079-1:2007) EN 60079-31:2009 (IEC 60079-31:2008) t 3600 light output around the vertical axis t 'XVWSURRI:HDWKHUSURRI BC150 Series > Ordering Information Lens Colour BC150 A = Amber + Standard Product Selection R = RED Beacon Type X = Xenon B = BLUE G = Green C = Clear Follow the chart (right) to generate your part code. O = Other Power (Xenon) 05 = 5J 10 = 10J Power (LED) Voltage 05 = : DC 12 - 48v Duty Tag Lens Label Label Guard Y = Yes Y = Yes Cable Entry Finish Colour Telephone Initiated RD = Red Y = Yes A 0 YW = Yellow Y = Yes BU = Blue L = LED 15 = 15J 20 = 20J 10 = : AC 100 - 240v N = No N = No N = No B 0 BL %ODFN N = No OR = Other MODEL CONFIGURATOR (By using the table above, complete this box sequence to select your required beacon). BC150 Lens Beacon Power Power Voltage Duty Colour Type (Xenon) (LED) Label Tag Label Lens Guard Cable Finish Telephone Entry Colour Initiated 1RWH$OOFXVWRPHUVRUGHUVZLOOEHFRQ¿UPHGLQZULWLQJ&DUHVKRXOGEHWDNHQWKDWWKHFRUUHFWFRGHKDVEHHQRUGHUHG DVEHVSRNHPDQXIDFWXUHGSURGXFWVFDQQRWEHUHWXUQHGIRUH[FKDQJHRUFUHGLWODWHU Kg 3.8 APPROVALS and &21)250,7,(6 C -40+70 R IP 66 INDUSTRIAL MARINE GRP 47 XENO Explosion Proof Beacon > GRP BC150 Series General Information EX CODE: CERTIFICATION: Ex d IIC T4~ T6 Gb, Ex tb IIIC T1350C~T850C $7(;1HPNR;,(&([1(0; CQST (Available on request only) Xenon or LED Visual Beacon TYPE: ;HQRQ:RUNLQJ6WDWXV ;HQRQ)ODVKLQJ )ODVK5DWH 6HOHFWDEOHIURP)ODVKHVSHU0LQXWH 3RZHU5DWLQJ -:0D[ -:0D[ -:0D[ -:0D[ 109 293 395 424 (IIHFWLYH&DQGHOD $FFHVVRULHV /(':RUNLQJ6WDWXV /(')ODVKLQJ5RWDWLQJ6WDWLF )ODVK5DWH 6HOHFWDEOHIURP)ODVKHVSHU0LQXWH 50023: Cage Guard (Stainless Steel) 5RWDWLRQ5DWH 6HOHFWDEOHIURP5HYROXWLRQVSHU0LQXWH 6WDWLF0RGH Permanently ON (ie Steady) 3RZHU5DWLQJ : : (IIHFWLYH&DQGHOD 128 312 0((;1LFNHO3ODWHG%UDVV*ODQG 0XOWL$UPRXU&RQH$WH[&DW (([GH,,&*' &DEOH,'PP 2'PP *ODQGIRU0XOWL$UPRXUHG&DEOH 08/7,3/<,1*)$&725)25&2/285('/(16(6 Amber x 0.51, Red x 0.15, Blue x 0.12, Green x 0.49, Clear x 1 0$(;1LFNHO3ODWHG%UDVV*ODQG $WH[&DW(([GH,,&*' &DEOH2'PP *ODQGIRU8QDUPRXUHG&DEOH 0HFKDQLFDO6SHFLÀFDWLRQV 0$7(5,$/ LENS COLOURS: ENCLOSURE COLOUR: :(,*+7 ',0(16,216 INGRESS PROTECTION: $0%,(177(03(5$785( +80,',7< GRP (Glass Reinforced Plastic) Amber, Red, Blue, Green, Clear or Other (specify) Red (RAL3001), Yellow (RAL1003) %OXH5$/%ODFN5$/ 3.8 Kg / 8.38 Ib /HQJWK:LGWKPP´+HLJKWPP´ IP 66 -40 to +70 5+ (OHFWULFDO6SHFLÀFDWLRQV 32:(56833/< 7(50,1$7,21 <Y'FRUY$F+] $FFHSWVXSWRPP2 incorporating rising clamp protectors CABLE ENTRY: 0((;461LFNHO3ODWHG%UDVV*ODQG ([G,,&([H,,&([Q5,,&([WE,,,& &DEOH2'PP %DUULHU*ODQGIRU6WHHODQG $OXPLQLXP$UPRXUHG&DEOH 0$(;4XLFN6WRS1LFNHO Plated Brass Gland ([G,,&([Q5,,&([WE,,& &DEOH2'PP %DUULHU*ODQGIRU8QDUPRXUHG&DEOH 01LFNHO3ODWHG%UDVV6WRSSLQJ3OXJ $WH[(([GH,,,& 6WDQGDUG0%ODQNLQJ3OXJ (SR[\0LQXWH$GKHVLYHPOWXEH 2QHWXEHVXIÀFLHQWIRUÀYHEDUULHUJODQGV [0RU0 PP7KUHDGOHQJWKIRU*53SURGXFWV )RU´RU´137UHTXLUHPHQWVPDOHIHPDOHDGDSWHU glands are available. Contact sales dept for further part codes. Note: 0RSWLRQVDYDLODEOHIRUWKHDERYH BC150 Series > :RUNLQJ&XUUHQW ;HQRQ LED ENERGY Y'F Y'F Y'F Y$F Y$F 5J 460 mA 280 mA 140 mA 60 mA 35 mA : 530 mA 260 mA 120 mA 80 mA 40 mA 60 mA : 1100 mA 530 mA 240 mA 160 mA 80 mA 10 J 850 mA 490 mA 250 mA 100 mA 15 J 1200 mA 700 mA 360 mA 140 mA 80 mA 20 J N/A 960 mA 480 mA 180 mA 110 mA POWER Y'F Y'F Y'F Y$F Y$F 48 Audible Signals - Explosion Proof GRP SOUNDER Explosion Proof Sounder > GRP SD150 Series )HDWXUHV&HUWLÀFDWLRQV Product overview The SD150 electronic sounder range has been approved for use in potentially explosive atmospheres and very harsh environmental conditions. Typical applications are Oil and Gas, On-shore and Offshore, Chemical, 3HWURFKHPLFDO5H¿QHULHV0DULQH locations etc. All tones can be pre-set during installation. t Approved by ATEX, IECEx The units also have the ability to be ¿WWHGZLWKDWHOHSKRQHLQLWLDWLRQIXQFWLRQ and can be used as the second ring output indicator for telephones when installed in very noisy environments. t ATEX: Ex d IIC T4~ T6 Gb, t CQST (Available on request only) The design allows for termination inside the enclosure. Ex tb IIIC T1350C~T850C t =RQHV t Conforms to: EN 60079-0:2012 (IEC 60079-0:2011), EN-60079-1:2007 (IEC 60079-1:2007) EN 60079-31:2009 (IEC 60079-31:2008) t Volume control The unit incorporates a three stage alarm The sounder is supplied with a PRXQWLQJEUDFNHWDVVWDQGDUG option with 60 tones to choose from. t 'XVWSURRI:HDWKHUSURRI SD150 Series > Ordering Information Voltage SD150 Standard Product Selection Duty Tag Label Label + DC 12 - 48v Y = Yes Y = Yes Cable Entry Finish Colour Telephone Initiated RD = Red A 0 YW = Yellow Y = Yes BU = Blue AC 100 - 240v Follow the chart (right) to generate your part code. N = No N = No B 0 BL %ODFN N = No OR = Other MODEL CONFIGURATOR (By using the table above, complete this box sequence to select your required sounder). SD150 Voltage Kg 5.4 APPROVALS and &21)250,7,(6 Duty Label Tag Label C -40+70 R Cable Entry Finish Telephone Colour Initiated IP 66 G% 115* MARINE INDUSTRIAL GRP 49 XENO Explosion Proof Sounder > GRP SD150 Series General Information EX CODE: CERTIFICATION: Ex d IIC T4~ T6 Gb, Ex tb IIIC T1350C~T850C $7(;1HPNR;,(&([1(0; CQST (Available on request only) TYPE: Electronic Sounder SOUNDER: 3 Stage alarm with 60 Selectable tones 32:(55$7,1* :DWWV$GMXVWDEOH SOUND OUTPUT: Up to 115 dB at 1 metre (+/- 3 dB) * $0%,(177(03(5$785( -40 to +70 +80,',7< 5+ 0HFKDQLFDO6SHFLÀFDWLRQV 0$7(5,$/ ENCLOSURE COLOUR: :(,*+7 ',0(16,216 INGRESS PROTECTION: (QFORVXUH*53*ODVV5HLQIRUFHG3ODVWLF %UDFNHW6WDLQOHVV6WHHO Red (RAL3001), Yellow (RAL1003) %OXH5$/%ODFN5$/ 5.4 Kg / 11.9 Ib /HQJWKPP´ See outline drawing for other dimensions IP 66 (OHFWULFDO6SHFLÀFDWLRQV 32:(56833/< 7(50,1$7,21 CABLE ENTRY: <Y'FRUY$F+]<: $FFHSWVXSWRPP2 incorporating rising clamp protectors [0RU0 )RU´RU´137UHTXLUHPHQWVPDOHIHPDOHDGDSWHU glands are available. Contact sales dept for further part codes. &855(17&2168037,21 6RXQGHUP$P$$GMXVWDEOHE\WRQHVHOHFWLRQ SD150 Series > :RUNLQJ&XUUHQW Y'F Y'F Y'F Y$F Y$F P$0D[: 960 mA 500 mA 210 mA 100 mA $FFHVVRULHV 0((;1LFNHO3ODWHG%UDVV*ODQG 0XOWL$UPRXU&RQH$WH[&DW (([GH,,&*' &DEOH,'PP 2'PP *ODQGIRU0XOWL$UPRXUHG&DEOH 0$(;1LFNHO3ODWHG%UDVV*ODQG $WH[&DW(([GH,,&*' &DEOH2'PP *ODQGIRU8QDUPRXUHG&DEOH 0((;461LFNHO3ODWHG%UDVV*ODQG ([G,,&([H,,&([Q5,,&([WE,,,& &DEOH2'PP %DUULHU*ODQGIRU6WHHODQG $OXPLQLXP$UPRXUHG&DEOH 0$(;4XLFN6WRS1LFNHO Plated Brass Gland ([G,,&([Q5,,&([WE,,& &DEOH2'PP %DUULHU*ODQGIRU8QDUPRXUHG&DEOH 01LFNHO3ODWHG%UDVV6WRSSLQJ3OXJ $WH[(([GH,,,& 6WDQGDUG0%ODQNLQJ3OXJ (SR[\0LQXWH$GKHVLYHPOWXEH 2QHWXEHVXIÀFLHQWIRUÀYHEDUULHUJODQGV PP7KUHDGOHQJWKIRU*53SURGXFWV Note: 0RSWLRQVDYDLODEOHIRUWKHDERYH 50 $XGLEOH9LVXDO6LJQDOV([SORVLRQ3URRI GRP SOUNDER/BEACON Explosion Proof Sounder/Beacon > GRP 6%6HULHV )HDWXUHV&HUWLÀFDWLRQV Product overvie The SB150-1 electronic combined sounder beacon range has been approved for use in potentially explosive atmospheres and very harsh environmental conditions. All tones can be pre-set during installation. In addition, the unit also incorporates a visual warning signal with a choice of two types of light source: either xenon (strobe) ZLWKPXOWLSOHÀDVKUDWHVDQGSRZHUUDWLQJV or an LED array with three status type indication options. Typical applications are Oil and Gas, On-shore and Offshore, Chemical, 3HWURFKHPLFDO5H¿QHULHV0DULQH locations etc. The units also have the ability to be ¿WWHGZLWKDWHOHSKRQHLQLWLDWLRQIXQFWLRQ and can be used as the second ring output indicator for telephones when installed in very noisy environments. The unit incorporates a three stage alarm option with 60 tones to choose from. The design allows for termination inside the enclosure. The unit can be EUDFNHWPRXQWHGRQO\ t Approved by ATEX, IECEx t CQST (Available on request only) t ATEX:Ex d IIC T4~ T6 Gb Ex tb IIIC T1350C~T850C t =RQHV t Conforms to: EN 60079-0:2012 (IEC 60079-0:2011), EN-60079-1:2007 (IEC 60079-1:2007) EN 60079-31:2009 (IEC 60079-31:2008) t 3600 light output around the vertical axis t Volume control t 'XVWSURRI:HDWKHUSURRI 6%6HULHV! Ordering Information Lens Colour Standard Product Selection A = Amber 6% + R = Red Beacon Type X = Xenon Follow the chart (right) to generate your part code. C = Clear Power (LED) Voltage 05 = : DC 12 ~ 48v 02 = 2J 05 = 5J Duty Tag Lens Label Label Guard Y = Yes Y = Yes Y = Yes Cable Entry L = LED 15 = 15J Finish Colour Telephone Initiated RD = Red A 0 10 = 10J B = Blue G = Green Power (Xenon) YW = Yellow Y = Yes BU = Blue 10 = : AC 100-240v N = No N = No N = No B 0 BL %ODFN N = No OR = Other 20 = 20J MODEL CONFIGURATOR (By using the table above, complete this box sequence to select your required sounder beacon). 6% Lens Beacon Power Power Voltage Colour Type (Xenon) (LED) Duty Label Tag Label Lens Guard Cable Finish Telephone Entry Colour Initiated 1RWH$OOFXVWRPHUVRUGHUVZLOOEHFRQ¿UPHGLQZULWLQJ&DUHVKRXOGEHWDNHQWKDWWKHFRUUHFWFRGHKDVEHHQRUGHUHG DVEHVSRNHPDQXIDFWXUHGSURGXFWVFDQQRWEHUHWXUQHGIRUH[FKDQJHRUFUHGLWODWHU Kg 6.5 APPROVALS and &21)250,7,(6 C -40+70 R IP 66 G% 115* MARINE INDUSTRIAL GRP 51 XENO Explosion Proof Sounder/Beacon > GRP 6%6HULHV General Information EX CODE: CERTIFICATION: Ex d IIC T4~ T6 Gb, Ex tb IIIC T1350C~T850C $7(;1HPNR;,(&([1(0; CQST (Available on request only) ;HQRQRU/('$XGLEOHDQG9LVXDO6LJQDO:DUQLQJ'HYLFH 3 Stage alarm with 60 Selectable tones :DWWV$GMXVWDEOH Up to 115 dB at 1 metre (+/- 3 dB) * TYPE: SOUNDER: 32:(55$7,1* SOUND OUTPUT: ;HQRQ:RUNLQJ6WDWXV ;HQRQ)ODVKLQJ )ODVK5DWH 6HOHFWDEOHIURP)ODVKHVSHU0LQXWH 3RZHU5DWLQJ (IIHFWLYH&DQGHOD 2.5 J :0D[ 5J :0D[ 10 J :0D[ 15 J :0D[ 20 J :0D[ 67 109 293 395 424 /(':RUNLQJ6WDWXV /(')ODVKLQJ5RWDWLQJ6WDWLF )ODVK5DWH 6HOHFWDEOHIURP)ODVKHVSHU0LQXWH 5RWDWLRQ5DWH 6HOHFWDEOHIURP5HYROXWLRQVSHU0LQXWH 6WDWLF0RGH Permanently ON (ie Steady) 3RZHU5DWLQJ : (IIHFWLYH&DQGHOD 128 $FFHVVRULHV 08/7,3/<,1*)$&725)25&2/285('/(16(6 Amber x 0.51, Red x 0.15, Blue x 0.12, Green x 0.49, Clear x 1 0HFKDQLFDO6SHFLÀFDWLRQV 0$7(5,$/ Enclosure: GRP (Glass Reinforced Plastic) %UDFNHW6WDLQOHVV6WHHO/HQV7HPSHUHG*ODVV LENS COLOURS: Amber, Red, Blue, Green, Clear or Other (specify) ENCLOSURE COLOUR: Red (RAL3001), Yellow (RAL1003) %OXH5$/%ODFN5$/ $0%,(177(03(5$785( -40 to +70 +80,',7< 5+ :(,*+7 6.5 Kg / 14.3 Ib ',0(16,216 /HQJWKPP´1R/HQV*XDUG)LWWHG See outline drawing for other dimensions INGRESS PROTECTION: IP 66 (OHFWULFDO6SHFLÀFDWLRQV 32:(56833/< <Y'FRUY$F+]%HDFRQ<: Sounder: <: 7(50,1$7,21 $FFHSWVXSWRPP2 incorporating rising clamp protectors 0((;1LFNHO3ODWHG%UDVV*ODQG 0XOWL$UPRXU&RQH$WH[&DW (([GH,,&*' &DEOH,'PP 2'PP *ODQGIRU0XOWL$UPRXUHG&DEOH 0$(;1LFNHO3ODWHG%UDVV*ODQG $WH[&DW(([GH,,&*' &DEOH2'PP *ODQGIRU8QDUPRXUHG&DEOH 0((;461LFNHO3ODWHG%UDVV*ODQG ([G,,&([H,,&([Q5,,&([WE,,,& &DEOH2'PP %DUULHU*ODQGIRU6WHHODQG $OXPLQLXP$UPRXUHG&DEOH 0$(;4XLFN6WRS1LFNHO Plated Brass Gland ([G,,&([Q5,,&([WE,,& &DEOH2'PP %DUULHU*ODQGIRU8QDUPRXUHG&DEOH 01LFNHO3ODWHG%UDVV6WRSSLQJ3OXJ $WH[(([GH,,,& 6WDQGDUG0%ODQNLQJ3OXJ (SR[\0LQXWH$GKHVLYHPOWXEH 2QHWXEHVXIÀFLHQWIRUÀYHEDUULHUJODQGV [0RU0 )RU´RU´137UHTXLUHPHQWVPDOHIHPDOHDGDSWHU PP7KUHDGOHQJWKIRU*53SURGXFWV glands are available. Contact sales dept for further part codes. &855(17&2168037,21 6RXQGHUP$P$$GMXVWDEOHE\WRQHVHOHFWLRQ Note: 0RSWLRQVDYDLODEOHIRUWKHDERYH CABLE ENTRY: 6%6HULHV! 3RZHU&RQVXPSWLRQ:RUNLQJ&XUUHQW 3RZHU&RQVXPSWLRQ6RXQGHU:/(': ;HQRQ -RXOH :0D[ -RXOH -RXOH -RXOH :RUNLQJ&XUUHQW 6RXQGHUP$P$/('P$0D[ -RXOH :0D[ :0D[ :0D[ :0D[ ;HQRQ -RXOH -RXOH -RXOH -RXOH -RXOH 160 mA 320 mA 650 mA $0D[ $0D[ 52 $XGLEOH9LVXDO6LJQDOV GRP COMBINATION UNITS WITH ACTIVATION CONTROL SB150-4-P Explosion Proof Sounder/Beacon > GRP 6%6HULHV 7KHXQLWVRIIHUDFRPELQHGDXGLEOH visual warning signal with the option RIHLWKHUDMXQFWLRQER[DOORZLQJH[WUD 7KH6%FRPELQHGVRXQGHU VSDFHIRUHDVHRILQVWDOODWLRQ¿QDO beacon range has been approved for connections. This is particularly helpful use in potentially explosive atmospheres LIWKHXQLWLVWREHLQVWDOOHGLQWRD¿UHRU and very harsh environmental conditions. telecom system where additional cabling is required to monitor external devices or Typical applications are Oil and Gas, a push button unit for manual activation. On-shore and Offshore, Chemical, 3HWURFKHPLFDO5H¿QHULHV The units are mounted on a heavy duty 0DULQHORFDWLRQVHWF 316 stainless steel, pre-drilled, mounting SODWHWKHXQLWVDUHSUHZLUHGDV The unit incorporates a three stage standard, so that on the basic model alarm option with 60 tones to choose a single input operates both units simultaneously. from. Product overview )HDWXUHV&HUWLÀFDWLRQV t Approved by ATEX, IECEx t CQST (Available on request only) t ATEX: II 2G ([G,,&77 LQFRUSRUDWLQJ,,$,,% t =RQHV t Conforms to EN (IEC) 60079-0 EN (IEC) 60079-1 and EN54 t 'XVWSURRI:HDWKHUSURRI 6%6HULHV! Ordering Information Combination &RPELQHG:LWK Lens Colour (Optional) Type SB150 + Follow the chart (right) to generate your part code. 2 = 1xS, 1xB = Junction Box = 1xS, 2xB A = Amber R = Red Beacon Type 4 = 1xS, 3xB G = Green C = Clear 02 = 2J X = Xenon 05 = 5J Power (LED) Voltage 05 = : DC 12 ~ 48v Duty Tag Lens Label Label Guard Y = Yes Y = Yes Y = Yes Cable Entry A = 0 Finish Colour Telephone Initiated RD = Red L = LED 15 = 15J Y = Yes YW = Yellow 10 = 10J B = Blue P = Push Button Power (Xenon) BU = Blue 10 = : N = No AC 100-240v N = No N = No B = 0 N = No BL %ODFN OR = Other 20 = 20J Note: S= Sounder, B= Beacon MODEL CONFIGURATOR (%\XVLQJWKHWDEOHDERYHFRPSOHWHWKLVER[VHTXHQFHWRVHOHFW\RXUUHTXLUHGMXQFWLRQER[ SB150 Combination Combined Lens Beacon Power Power Voltage Type :LWK Colour Type (Xenon) (LED) Duty Label Tag Label Lens Guard Cable Finish Telephone Entry Colour Initiated 1RWH$OOFXVWRPHUVRUGHUVZLOOEHFRQ¿UPHGLQZULWLQJ&DUHVKRXOGEHWDNHQWKDWWKHFRUUHFWFRGHKDVEHHQRUGHUHG DVEHVSRNHPDQXIDFWXUHGSURGXFWVFDQQRWEHUHWXUQHGIRUH[FKDQJHRUFUHGLWODWHU Kg 10.0 6% 14.5 6% 19.0 6% APPROVALS and &21)250,7,(6 C -40+70 R IP 66 INDUSTRIAL MARINE FIRE GRP 53 Explosion Proof Sounder/Beacon > GRP XENO 6%6HULHV 300.0mm Ø282.7mm 20mm 0mm 60.0mm 210.0mm 9.0mm General Information Ex d IIC T4~ T6 Gb, Ex tb IIIC T1350C~T850C $7(;1HPNR;,(&([1(0; CQST (Available on request only) ;HQRQRU/('$XGLEOHDQG9LVXDO6LJQDO:DUQLQJ'HYLFH 3 Stage alarm with 60 Selectable tones :DWWV$GMXVWDEOH Up to 115 dB at 1 metre (+/- 3 dB) * TYPE: SOUNDER: 32:(55$7,1* SOUND OUTPUT: ;HQRQ:RUNLQJ6WDWXV ;HQRQ)ODVKLQJ )ODVK5DWH 6HOHFWDEOHIURP)ODVKHVSHU0LQXWH 3RZHU5DWLQJ (IIHFWLYH&DQGHOD 2.5 J :0D[ 5J :0D[ 10 J :0D[ 15 J :0D[ 20 J :0D[ 67 109 293 395 424 /(':RUNLQJ6WDWXV /(')ODVKLQJ5RWDWLQJ6WDWLF )ODVK5DWH 6HOHFWDEOHIURP)ODVKHVSHU0LQXWH 5RWDWLRQ5DWH 6HOHFWDEOHIURP5HYROXWLRQVSHU0LQXWH 6WDWLF0RGH Permanently ON (ie Steady) Ø150.0 510.0mm L EX CODE: CERTIFICATION: 360.0mm 15.0mm Centres Ø15.0mm 660.0mm Cable Entries (x3) 810.0mm 60.0mm 1.8mm 180.0mm 140.0mm 232.3mm 200.0mm SB150-4-J &RPELQDWLRQ 1R.H\6ORWV ‘L’ 6% 6 450.0 6%-RU3 8 619.0 6%-RU3 10 788.0 6%-RU3 12 957.0 $FFHVVRULHV 3RZHU5DWLQJ : : 50023: Cage Guard (Stainless Steel) (IIHFWLYH&DQGHOD 128 312 0((;1LFNHO3ODWHG%UDVV*ODQG 0XOWL$UPRXU&RQH$WH[&DW (([GH,,&*' &DEOH,'PP 2'PP *ODQGIRU0XOWL$UPRXUHG&DEOH 08/7,3/<,1*)$&725)25&2/285('/(16(6 Amber x 0.51, Red x 0.15, Blue x 0.12, Green x 0.49, Clear x 1 0HFKDQLFDO6SHFLÀFDWLRQV 0$7(5,$/ Enclosure: GRP (Glass Reinforced Plastic) with 6WDLQOHVV6WHHO0RXQWLQJ%UDFNHW Lens: Tempered Glass LENS COLOURS: Amber, Red, Blue, Green, Clear or Other (specify) ENCLOSURE COLOUR: Red (RAL3001), Yellow (RAL1003) %OXH5$/%ODFN5$/ $0%,(177(03(5$785( -40 to +70 +80,',7< 5+ :(,*+7 SB150-2: 10 Kg / 22 lb, SB150-3: 14.5 Kg / 32 lb SB150-4: 19 Kg / 42 lb ',0(16,216 See outline drawings and table for dimensions. INGRESS PROTECTION: IP 66 (OHFWULFDO6SHFLÀFDWLRQV 32:(56833/< <Y'FRUY$F+]%HDFRQ<: Sounder: <: 7(50,1$7,21 $FFHSWVXSWRPP2 incorporating rising clamp protectors CABLE ENTRY: 0$(;1LFNHO3ODWHG%UDVV*ODQG $WH[&DW(([GH,,&*' &DEOH2'PP *ODQGIRU8QDUPRXUHG&DEOH 0((;461LFNHO3ODWHG%UDVV*ODQG ([G,,&([H,,&([Q5,,&([WE,,,& &DEOH2'PP %DUULHU*ODQGIRU6WHHODQG $OXPLQLXP$UPRXUHG&DEOH 0$(;4XLFN6WRS1LFNHO Plated Brass Gland ([G,,&([Q5,,&([WE,,& &DEOH2'PP %DUULHU*ODQGIRU8QDUPRXUHG&DEOH 01LFNHO3ODWHG%UDVV6WRSSLQJ3OXJ $WH[(([GH,,,& 6WDQGDUG0%ODQNLQJ3OXJ (SR[\0LQXWH$GKHVLYHPOWXEH [0RU0 2QHWXEHVXIÀFLHQWIRUÀYHEDUULHUJODQGV )RU´RU´137UHTXLUHPHQWVPDOHIHPDOHDGDSWHU glands are available. Contact sales dept for further part codes. PP7KUHDGOHQJWKIRU*53SURGXFWV Note: 0RSWLRQVDYDLODEOHIRUWKHDERYH &855(17&2168037,21 6RXQGHUP$P$$GMXVWDEOHE\WRQHVHOHFWLRQ 6%6HULHV! :RUNLQJ&XUUHQW 3RZHU&RQVXPSWLRQ6RXQGHU:/(': ;HQRQ -RXOH :0D[ -RXOH -RXOH -RXOH -RXOH :0D[ :0D[ :0D[ :0D[ :RUNLQJ&XUUHQW 6RXQGHUP$P$/('P$0D[ ;HQRQ -RXOH -RXOH -RXOH -RXOH -RXOH 160 mA 320 mA 650 mA $0D[ $0D[ LED POWER Y'F Y'F Y'F Y$F Y$F : 530 mA 260 mA 120 mA 80 mA 40 mA : 1100 mA 530 mA 240 mA 160 mA 80 mA 54 Visual Signals GRP COMBINATION UNITS WITH ACTIVATION CONTROL SL150-4-J Explosion Proof Status Lights > GRP SL150 Series The units offer a visual warning signal ZLWKWKHRSWLRQRIHLWKHUDMXQFWLRQER[ allowing extra space for ease of LQVWDOODWLRQ¿QDOFRQQHFWLRQV7KLVLV particularly helpful if the unit is to be LQVWDOOHGLQWRD¿UHRUWHOHFRPV\VWHP where additional cabling is required to monitor external devices or a push button unit for manual activation. Product overview The SL150 status light range has been approved for use in potentially explosive atmospheres and very harsh environmental conditions. Typical applications are Oil and Gas, On-shore and Offshore, Chemical, 3HWURFKHPLFDO5H¿QHULHV 0DULQHORFDWLRQVHWF )HDWXUHV&HUWLÀFDWLRQV t Approved by ATEX, IECEx t CQST (Available on request only) t ATEX: II 2G ([G,,&77 LQFRUSRUDWLQJ,,$,,% t =RQHV The units are mounted on a heavy duty 316 stainless steel, pre-drilled, mounting SODWHWKHXQLWVDUHSUHZLUHGDVVWDQGDUG t Conforms to EN (IEC) 60079-0 EN (IEC) 60079-1 and EN54 t 'XVWSURRI:HDWKHUSURRI SL150 Series > Ordering Information Combination &RPELQHG:LWK Lens Type (Optional) Colour SL150 2 = 2xB + Follow the chart (right) to generate your part code. = 3xB = Junction Box A = Amber R = Red Beacon Type P = Push Button 5 = 5xB * G = Green C = Clear 02 = 2J X = Xenon 05 = 5J Power (LED) Voltage 05 = : DC 12 ~ 48v Duty Tag Lens Label Label Guard Y = Yes Y = Yes Y = Yes Cable Entry A = 0 Finish Colour Telephone Initiated RD = Red L = LED 15 = 15J Y = Yes YW = Yellow 10 = 10J B = Blue 4 = 4xB Power (Xenon) BU = Blue 10 = : N = No AC 100-240v N = No N = No B = 0 N = No BL %ODFN OR = Other 20 = 20J Note: S= Sounder, B= Beacon * Combination Type 5: - or P additions not available with this selection. MODEL CONFIGURATOR (%\XVLQJWKHWDEOHDERYHFRPSOHWHWKLVER[VHTXHQFHWRVHOHFW\RXUUHTXLUHGMXQFWLRQER[ SL150 Combination Combined Lens Beacon Power Power Voltage Duty Label Type :LWK Colour Type (Xenon) (LED) Tag Lens Label Guard Cable Entry Finish Colour Telephone Initiated 1RWH$OOFXVWRPHUVRUGHUVZLOOEHFRQ¿UPHGLQZULWLQJ&DUHVKRXOGEHWDNHQWKDWWKHFRUUHFWFRGHKDVEHHQRUGHUHG DVEHVSRNHPDQXIDFWXUHGSURGXFWVFDQQRWEHUHWXUQHGIRUH[FKDQJHRUFUHGLWODWHU Kg 8.9 2 17.4 4 13.1 21.6 5 APPROVALS and &21)250,7,(6 C -40+70 R IP 66 INDUSTRIAL MARINE FIRE GRP 55 Explosion Proof Status Lights > GRP XENO SL150 Series 0mm 9.0mm General Information 360.0mm ‘L’ Ø15.0mm 510.0mm Ex d IIC T4~ T6 Gb, Ex tb IIIC T135 C~T85 C ATEX and IECEx CQST (Available on request only) ;HQRQRU/('9LVXDO6LJQDO:DUQLQJ'HYLFH 0 TYPE: Ø150.0 210.0mm 15.0mm Centres EX CODE: CERTIFICATION: 20mm 60.0mm 0 660.0mm Cable Entries (x3) 810.0mm 60.0mm 180.0mm ;HQRQ:RUNLQJ6WDWXV ;HQRQ)ODVKLQJ )ODVK5DWH 6HOHFWDEOHIURP)ODVKHVSHU0LQXWH 3RZHU5DWLQJ 2.5 J :0D[ 5J :0D[ 10 J :0D[ 15 J :0D[ 20 J :0D[ 67 109 293 395 424 (IIHFWLYH&DQGHOD 1.8mm 140.0mm 200.0mm SL150-4-J &RPELQDWLRQ 232.3mm 1R.H\6ORWV ‘L’ 6/ 6 450.0 6/-RU3 8 619.0 /(':RUNLQJ6WDWXV /(')ODVKLQJ5RWDWLQJ6WDWLF 6/-RU3 10 788.0 )ODVK5DWH 6HOHFWDEOHIURP)ODVKHVSHU0LQXWH 6/-RU3 12 957.0 5RWDWLRQ5DWH 6HOHFWDEOHIURP5HYROXWLRQVSHU0LQXWH 6WDWLF0RGH Permanently ON (ie Steady) $FFHVVRULHV 3RZHU5DWLQJ : : (IIHFWLYH&DQGHOD 128 312 50023: Cage Guard (Stainless Steel) 0((;1LFNHO3ODWHG%UDVV*ODQG 0XOWL$UPRXU&RQH$WH[&DW (([GH,,&*' &DEOH,'PP 2'PP *ODQGIRU0XOWL$UPRXUHG&DEOH 08/7,3/<,1*)$&725)25&2/285('/(16(6 Amber x 0.51, Red x 0.15, Blue x 0.12, Green x 0.49, Clear x 1 0HFKDQLFDO6SHFLÀFDWLRQV 0$7(5,$/ LENS COLOURS: ENCLOSURE COLOUR: $0%,(177(03(5$785( +80,',7< :(,*+7 ',0(16,216 INGRESS PROTECTION: 0$(;1LFNHO3ODWHG%UDVV*ODQG $WH[&DW(([GH,,&*' &DEOH2'PP *ODQGIRU8QDUPRXUHG&DEOH Enclosure: GRP (Glass Reinforced Plastic) with 6WDLQOHVV6WHHO0RXQWLQJ%UDFNHW Amber, Red, Blue, Green, Clear or Other (specify) Red (RAL3001), Yellow (RAL1003) %OXH5$/%ODFN5$/ -40 to +70 5+ SL150-A: 8.9 Kg / 19.6 lb, SL150-B: 13.1 Kg / 28.9 lb SL150-C: 17.4 Kg /38.3 lb, SL150-D: 21.6 Kg / 47.6 lb See outline drawings and table for dimensions. IP 66 (OHFWULFDO6SHFLÀFDWLRQV 32:(56833/< 7(50,1$7,21 CABLE ENTRY: 0((;461LFNHO3ODWHG%UDVV*ODQG ([G,,&([H,,&([Q5,,&([WE,,,& &DEOH2'PP %DUULHU*ODQGIRU6WHHODQG $OXPLQLXP$UPRXUHG&DEOH 0$(;4XLFN6WRS1LFNHO Plated Brass Gland ([G,,&([Q5,,&([WE,,& &DEOH2'PP %DUULHU*ODQGIRU8QDUPRXUHG&DEOH <Y'FRUY$F+]%HDFRQ<: $FFHSWVXSWRPP2 incorporating rising clamp protectors [0RU0 )RU´RU´137UHTXLUHPHQWVPDOHIHPDOHDGDSWHU glands are available. Contact sales dept for further part codes. &855(17&2168037,21 6RXQGHUP$P$$GMXVWDEOHE\WRQHVHOHFWLRQ 01LFNHO3ODWHG%UDVV6WRSSLQJ3OXJ $WH[(([GH,,,& 6WDQGDUG0%ODQNLQJ3OXJ (SR[\0LQXWH$GKHVLYHPOWXEH 2QHWXEHVXIÀFLHQWIRUÀYHEDUULHUJODQGV PP7KUHDGOHQJWKIRU*53SURGXFWV Note: 0RSWLRQVDYDLODEOHIRUWKHDERYH SL150 Series > :RUNLQJ&XUUHQW 3RZHU&RQVXPSWLRQ6RXQGHU:/(': ;HQRQ -RXOH :0D[ -RXOH -RXOH -RXOH -RXOH :0D[ :0D[ :0D[ :0D[ :RUNLQJ&XUUHQW 6RXQGHUP$P$/('P$0D[ ;HQRQ -RXOH -RXOH -RXOH -RXOH -RXOH 160 mA 320 mA 650 mA $0D[ $0D[ LED POWER Y'F Y'F Y'F Y$F Y$F : 530 mA 260 mA 120 mA 80 mA 40 mA : 1100 mA 530 mA 240 mA 160 mA 80 mA 56 0DQXDO$FWLYDWLRQ&RQWURO GRP CALL POINT ([SORVLRQ3URRI0DQXDO&DOO3RLQW!*53 &36HULHV Product overview The CP135 manual call point range has been approved for use in potentially explosive atmospheres and harsh environmental conditions. RXWSXW,WLVLGHDOO\VXLWHGIRUXVHLQ¿UH alarm systems and an addressable RSWLRQZLWKGLRGH¿WWHGLVDYDLODEOH Typical applications are Oil and Gas, On-shore and Offshore, Chemical, 3HWURFKHPLFDO5H¿QHULHV0DULQH locations etc. The range also offers an additional visual LED indication option; red, green RUERWKFDQEH¿WWHG:KHQIDXOWRU alarm status arises the green LED will be overridden by the red LED. It is compatible for use with a PLC, DCS and ESD systems via 4-20mA The design allows for termination inside the unit. )HDWXUHV&HUWLÀFDWLRQV t Approved by ATEX, IECEx t CQST (Available on request only) t ATEX: II 2G ([G,,%+277 (incorporating IIA) t =RQHV t Conforms to EN (IEC) 60079-0 EN (IEC) 60079-1 and EN54 t 'XVWSURRI:HDWKHUSURRI &36HULHV! Ordering Information Switch &3 + Standard Product Selection S = Single Switch D = Double Switch Follow the chart (right) to generate your part code. Duty Tag Label Label Y = Yes Y = Yes Glass Label* LED Indicator Features Y = Glass Label (standard) L = Red *UHHQ F= Lift Flap R = Red R= Resistor (specify) G = Green D = Diode (specify) N = No Glass Label N = No N = No O = Other (specify) N = No LED Cable Entry N = No Features A 0 Entry T = Top Face Finish Colour RD = Red YW = Yellow BU = Blue B 0 B = Bottom Face BL %ODFN OR = Other 6WDQGDUGEUHDNJODVVODEHOZRUGLQJLVµ%UHDN*ODVV3UHVV+HUH¶ MODEL CONFIGURATOR (By using the table above, complete this box sequence to select your required manual call point). &3 Switch Duty Label Tag Label LED Features Cable Entry Finish Glass Label* Indicator Entry Colour 6WDQGDUGEUHDNJODVVODEHOZRUGLQJLVµ%UHDN*ODVV3UHVV+HUH¶ 1RWH$OOFXVWRPHUVRUGHUVZLOOEHFRQ¿UPHGLQZULWLQJ&DUHVKRXOGEHWDNHQWKDWWKHFRUUHFWFRGHKDVEHHQRUGHUHG DVEHVSRNHPDQXIDFWXUHGSURGXFWVFDQQRWEHUHWXUQHGIRUH[FKDQJHRUFUHGLWODWHU Kg 1.5 APPROVALS and &21)250,7,(6 C -40+70 R IP 66 INDUSTRIAL MARINE FIRE GRP 57 XENO ([SORVLRQ3URRI0DQXDO&DOO3RLQW!*53 &36HULHV General Information EX CODE: CERTIFICATION: TYPE: 0HFKDQLFDO6SHFLÀFDWLRQV 0$7(5,$/ ENCLOSURE COLOUR: $0%,(177(03(5$785( +80,',7< :(,*+7 ',0(16,216 INGRESS PROTECTION: (OHFWULFDO6SHFLÀFDWLRQV 6:,7&+5$7,1* OUTPUT: 7(50,1$7,21 CABLE ENTRY: ([G,,%+2 T4 - T6 $7(;1HPNR;,(&([1(0; CQST (Available on request only) 0DQXDO&DOO3RLQW Enclosure: GRP (Glass Reinforced Plastic) Red (RAL3001), Yellow (RAL1003) %OXH5$/%ODFN5$/ -40 to +70 5+ 1.5 Kg / 3.31 Ib :LGWK/HQJWKPP´+HLJKWPP´ IP 66 Y'F 6A (Resistive), 6A (Inductive) Y$F 11A (Resistive), 6A (Inductive) On-Off Output (NC/NO) $FFHSWVXSWRPP2 incorporating rising clamp protectors [0RU0 )RU´RU´137UHTXLUHPHQWVPDOHIHPDOHDGDSWHU glands are available. Contact sales dept for further part codes. $FFHVVRULHV 0((;1LFNHO3ODWHG%UDVV*ODQG 0XOWL$UPRXU&RQH$WH[&DW (([GH,,&*' &DEOH,'PP 2'PP *ODQGIRU0XOWL$UPRXUHG&DEOH 0$(;1LFNHO3ODWHG%UDVV*ODQG $WH[&DW(([GH,,&*' &DEOH2'PP *ODQGIRU8QDUPRXUHG&DEOH 0((;461LFNHO3ODWHG%UDVV*ODQG ([G,,&([H,,&([Q5,,&([WE,,,& &DEOH2'PP %DUULHU*ODQGIRU6WHHODQG $OXPLQLXP$UPRXUHG&DEOH 0$(;4XLFN6WRS1LFNHO Plated Brass Gland ([G,,&([Q5,,&([WE,,& &DEOH2'PP %DUULHU*ODQGIRU8QDUPRXUHG&DEOH 01LFNHO3ODWHG%UDVV6WRSSLQJ3OXJ $WH[(([GH,,,& 6WDQGDUG0%ODQNLQJ3OXJ (SR[\0LQXWH$GKHVLYHPOWXEH 2QHWXEHVXIÀFLHQWIRUÀYHEDUULHUJODQGV PP7KUHDGOHQJWKIRU*53SURGXFWV Note: 0RSWLRQVDYDLODEOHIRUWKHDERYH 58 0DQXDO$FWLYDWLRQ&RQWURO GRP CALL POINT ([SORVLRQ3URRI0DQXDO&DOO3RLQW!*53 CP150 Series It is compatible for use with a PLC, DCS and ESD systems via 4-20mA RXWSXW,WLVLGHDOO\VXLWHGIRUXVHLQ¿UH alarm systems and an addressable RSWLRQZLWKGLRGH¿WWHGLVDYDLODEOH Product overview The CP150 manual call point range has been approved for use in potentially explosive atmospheres and harsh environmental conditions. The range also offers an additional visual LED indication option; red, JUHHQRUERWKFDQEH¿WWHG:KHQ fault or alarm status arises the green LED will be overridden by the red LED. The design allows for termination inside the unit. Typical applications are Oil and Gas, On-shore and Offshore, Chemical, 3HWURFKHPLFDO5H¿QHULHV 0DULQHORFDWLRQVHWF )HDWXUHV&HUWLÀFDWLRQV t Approved by ATEX, IECEx t CQST (Available on request only) t ATEX: II 2G ([G,,&77 ,QFRUSRUDWLQJ,,$,,% t =RQHV t Conforms to EN (IEC) 60079-0 EN (IEC) 60079-1 and EN54 t 'XVWSURRI:HDWKHUSURRI CP150 Series > Ordering Information Switch CP150 Standard Product Selection + Duty Tag Label Label S = Single Switch D = Double Switch Follow the chart (right) to generate your part code. Y = Yes N = No Y = Yes N = No LED Indicator Features L = Red *UHHQ F= Lift Flap R = Red R= Resistor (specify) G = Green D = Diode (specify) Cable Entry RD = Red A 0 N = No Features YW = Yellow BU = Blue B 0 N = No LED Finish Colour BL %ODFN OR = Other MODEL CONFIGURATOR (By using the table above, complete this box sequence to select your required manual call point). CP150 Switch Duty Label LED Features Cable Finish Tag Label Indicator Entry Colour 1RWH$OOFXVWRPHUVRUGHUVZLOOEHFRQ¿UPHGLQZULWLQJ&DUHVKRXOGEHWDNHQWKDWWKHFRUUHFWFRGHKDVEHHQRUGHUHG DVEHVSRNHPDQXIDFWXUHGSURGXFWVFDQQRWEHUHWXUQHGIRUH[FKDQJHRUFUHGLWODWHU Kg 4.2 APPROVALS and &21)250,7,(6 C -40+70 R IP 66 INDUSTRIAL MARINE FIRE GRP 59 XENO ([SORVLRQ3URRI0DQXDO&DOO3RLQW!*53 CP150 Series General Information EX CODE: CERTIFICATION: TYPE: 0HFKDQLFDO6SHFLÀFDWLRQV 0$7(5,$/ ENCLOSURE COLOUR: $0%,(177(03(5$785( +80,',7< :(,*+7 ',0(16,216 INGRESS PROTECTION: (OHFWULFDO6SHFLÀFDWLRQV 6:,7&+5$7,1* OUTPUT: 7(50,1$7,21 CABLE ENTRY: Exd IIC T4 - T6 $7(;1HPNR;,(&([1(0; CQST (Available on request only) 0DQXDO&DOO3RLQW Enclosure: GRP (Glass Reinforced Plastic) Red (RAL3001), Yellow (RAL1003) %OXH5$/%ODFN5$/ -40 to +70 5+ 4.2 Kg / 9.26 Ib :LGWK/HQJWKPP´+HLJKWPP´ IP 66 Y'F 6A (Resistive), 6A (Inductive) Y$F 11A (Resistive), 6A (Inductive) On-Off Output (NC/NO) $FFHSWVXSWRPP2 incorporating rising clamp protectors [0RU0 )RU´RU´137UHTXLUHPHQWVPDOHIHPDOHDGDSWHU glands are available. Contact sales dept for further part codes. $FFHVVRULHV 0((;1LFNHO3ODWHG%UDVV*ODQG 0XOWL$UPRXU&RQH$WH[&DW (([GH,,&*' &DEOH,'PP 2'PP *ODQGIRU0XOWL$UPRXUHG&DEOH 0$(;1LFNHO3ODWHG%UDVV*ODQG $WH[&DW(([GH,,&*' &DEOH2'PP *ODQGIRU8QDUPRXUHG&DEOH 0((;461LFNHO3ODWHG%UDVV*ODQG ([G,,&([H,,&([Q5,,&([WE,,,& &DEOH2'PP %DUULHU*ODQGIRU6WHHODQG $OXPLQLXP$UPRXUHG&DEOH 0$(;4XLFN6WRS1LFNHO Plated Brass Gland ([G,,&([Q5,,&([WE,,& &DEOH2'PP %DUULHU*ODQGIRU8QDUPRXUHG&DEOH 01LFNHO3ODWHG%UDVV6WRSSLQJ3OXJ $WH[(([GH,,,& 6WDQGDUG0%ODQNLQJ3OXJ (SR[\0LQXWH$GKHVLYHPOWXEH 2QHWXEHVXIÀFLHQWIRUÀYHEDUULHUJODQGV PP7KUHDGOHQJWKIRU*53SURGXFWV Note: 0RSWLRQVDYDLODEOHIRUWKHDERYH 60 Enclosure - Explosion Proof GRP -81&7,21%2; Explosion Proof Junction Box > GRP -%6HULHV )HDWXUHV&HUWLÀFDWLRQV Product overview t Approved by ATEX, IECEx 7KH-%MXQFWLRQER[UDQJHKDV been approved for use in potentially explosive atmospheres and harsh environmental conditions. The enclosures are machined from marine grade glass reinforced plastic (GRP) and are supplied with four pre-drilled conduit entries. Typical applications are Oil and Gas, On-shore and Offshore, Chemical, 3HWURFKHPLFDO5H¿QHULHV 0DULQHORFDWLRQVHWF They have been designed to offer maximum space for cable termination with a choice of either an 8 or 10 way WHUPLQDOEORFN t CQST (Available on request only) t ATEX: II 2G ([G,,&77 LQFRUSRUDWLQJ,,$,,% t =RQHV t Conforms to EN (IEC) 60079-0 EN (IEC) 60079-1 and EN54 t 'XVWSURRI:HDWKHUSURRI -%6HULHV! Ordering Information Terminal %ORFN -% Follow the chart (right) to generate your part code. + 08 = +ROHV Cable Entry Finish Colour RD = Red A 0 YW = Yellow BU = Blue 10 = +ROHV B 0 BL %ODFN OR = Other MODEL CONFIGURATOR (%\XVLQJWKHWDEOHDERYHFRPSOHWHWKLVER[VHTXHQFHWRVHOHFW\RXUUHTXLUHGMXQFWLRQER[ -% Terminal Cable %ORFN Entry Finish Colour 1RWH$OOFXVWRPHUVRUGHUVZLOOEHFRQ¿UPHGLQZULWLQJ&DUHVKRXOGEHWDNHQWKDWWKHFRUUHFWFRGHKDVEHHQRUGHUHG DVEHVSRNHPDQXIDFWXUHGSURGXFWVFDQQRWEHUHWXUQHGIRUH[FKDQJHRUFUHGLWODWHU Kg 3.5 APPROVALS and &21)250,7,(6 C -40+70 R IP 66 INDUSTRIAL MARINE FIRE GRP 150mm 61 Ø150mm M20 XENO Explosion Proof Junction Box> GRP -%6HULHV General Information EX CODE: CERTIFICATION: 120mm 60mm 105mm 150mm $FFHVVRULHV 0((;1LFNHO3ODWHG%UDVV*ODQG 0XOWL$UPRXU&RQH$WH[&DW (([GH,,&*' &DEOH,'PP 2'PP *ODQGIRU0XOWL$UPRXUHG&DEOH TYPE: Exd IIC T4 - T6 ATEX and IECEx CQST (Available on request only) Junction Box 0$(;1LFNHO3ODWHG%UDVV*ODQG $WH[&DW(([GH,,&*' &DEOH2'PP *ODQGIRU8QDUPRXUHG&DEOH 0HFKDQLFDO6SHFLÀFDWLRQV 0$7(5,$/ ENCLOSURE COLOUR: $0%,(177(03(5$785( +80,',7< :(,*+7 ',0(16,216 INGRESS PROTECTION: Enclosure: GRP (Glass Reinforced Plastic) Red (RAL3001), Yellow (RAL1003) %OXH5$/%ODFN5$/ -40 to +70 5+ 3.5 Kg / 7.7 Ib :LGWK/HQJWKPP´+HLJKWPP´ IP 66 0$(;4XLFN6WRS1LFNHO Plated Brass Gland ([G,,&([Q5,,&([WE,,& &DEOH2'PP %DUULHU*ODQGIRU8QDUPRXUHG&DEOH (OHFWULFDO6SHFLÀFDWLRQV 7(50,1$7,21 CABLE ENTRY: 0((;461LFNHO3ODWHG%UDVV*ODQG ([G,,&([H,,&([Q5,,&([WE,,,& &DEOH2'PP %DUULHU*ODQGIRU6WHHODQG $OXPLQLXP$UPRXUHG&DEOH 01LFNHO3ODWHG%UDVV6WRSSLQJ3OXJ $WH[(([GH,,,& 6WDQGDUG0%ODQNLQJ3OXJ (SR[\0LQXWH$GKHVLYHPOWXEH 2QHWXEHVXIÀFLHQWIRUÀYHEDUULHUJODQGV $FFHSWVXSWRPP incorporating rising clamp protectors [0RU0 PP7KUHDGOHQJWKIRU*53SURGXFWV )RU´RU´137UHTXLUHPHQWVPDOHIHPDOHDGDSWHU glands are available. Contact sales dept for further part codes. Note: 0RSWLRQVDYDLODEOHIRUWKHDERYH 2 62 0DQXDO$FWLYDWLRQ&RQWURO GRP PUSH BUTTON Explosion Proof Push Button > GRP 3%6HULHV It is compatible for use with a PLC, DCS and ESD systems via 4-20mA RXWSXW,WLVLGHDOO\VXLWHGIRUXVHLQ¿UH alarm systems and an addressable RSWLRQZLWKGLRGH¿WWHGLVDYDLODEOH Product overview The PB135 push button range has been approved for use in potentially explosive atmospheres and harsh environmental conditions. )HDWXUHV&HUWLÀFDWLRQV t Approved by ATEX, IECEx t CQST (Available on request only) 7KHXQLWKDVWKHRSWLRQIRUHLWKHUDNH\ reset or self reset. The range also offers an additional visual LED indication option; red, green (or both) FDQEH¿WWHG:KHQIDXOWRUDODUP status arises the green LED will be overridden by the red LED. The design allows for termination inside the unit. Typical applications are Oil and Gas, On-shore and Offshore, Chemical, 3HWURFKHPLFDO5H¿QHULHV0DULQH locations etc. t ATEX: II 2G ([G,,%+277 (incorporating IIA) t =RQHV t Conforms to EN (IEC) 60079-0 EN (IEC) 60079-1 and EN54 t 'XVWSURRI:HDWKHUSURRI 3%6HULHV! Ordering Information Switch 3% Standard Product Selection + Duty Tag Reset Label Label S = Single Switch D = Double Switch Follow the chart (right) to generate your part code. Y = Yes N = No Y = Yes N = No S = Self Reset K = Key Reset LED Indicator Features L = Red *UHHQ F= Lift Flap R = Red R= Resistor (specify) G = Green D = Diode (specify) Cable Entry Entry A 0 T = Top Face RD = Red YW = Yellow BU = Blue B 0 N = No LED Finish Colour N = No Features B = Bottom Face BL %ODFN OR = Other MODEL CONFIGURATOR (By using the table above, complete this box sequence to select your required push button). 3% Switch Duty Label Tag Label Reset LED Features Cable Indicator Entry Entry Finish Colour 1RWH$OOFXVWRPHUVRUGHUVZLOOEHFRQ¿UPHGLQZULWLQJ&DUHVKRXOGEHWDNHQWKDWWKHFRUUHFWFRGHKDVEHHQRUGHUHG DVEHVSRNHPDQXIDFWXUHGSURGXFWVFDQQRWEHUHWXUQHGIRUH[FKDQJHRUFUHGLWODWHU Kg 1.5 APPROVALS and &21)250,7,(6 C -40+70 R IP 66 INDUSTRIAL MARINE FIRE GRP 63 XENO Explosion Proof Push Button > GRP 3%6HULHV General Information EX CODE: CERTIFICATION: TYPE: 0HFKDQLFDO6SHFLÀFDWLRQV 0$7(5,$/ ENCLOSURE COLOUR: $0%,(177(03(5$785( +80,',7< :(,*+7 ',0(16,216 INGRESS PROTECTION: (OHFWULFDO6SHFLÀFDWLRQV 6:,7&+5$7,1* OUTPUT: 7(50,1$7,21 CABLE ENTRY: ([G,,%+2 T4 - T6 $7(;1HPNR;,(&([1(0; CQST (Available on request only) Push Button Enclosure: GRP (Glass Reinforced Plastic) Red (RAL3001), Yellow (RAL1003) %OXH5$/%ODFN5$/ -40 to +70 5+ 1.5 Kg / 3.31 Ib :LGWK/HQJWKPP´+HLJKWPP´ IP 66 Y'F 6A (Resistive), 6A (Inductive) Y$F11A (Resistive), 6A (Inductive) On-Off Output (NC/NO) $FFHSWVXSWRPP2 incorporating rising clamp protectors [0RU0 )RU´RU´137UHTXLUHPHQWVPDOHIHPDOHDGDSWHU glands are available. Contact sales dept for further part codes. $FFHVVRULHV 0((;1LFNHO3ODWHG%UDVV*ODQG 0XOWL$UPRXU&RQH$WH[&DW (([GH,,&*' &DEOH,'PP 2'PP *ODQGIRU0XOWL$UPRXUHG&DEOH 0$(;1LFNHO3ODWHG%UDVV*ODQG $WH[&DW(([GH,,&*' &DEOH2'PP *ODQGIRU8QDUPRXUHG&DEOH 0((;461LFNHO3ODWHG%UDVV*ODQG ([G,,&([H,,&([Q5,,&([WE,,,& &DEOH2'PP %DUULHU*ODQGIRU6WHHODQG $OXPLQLXP$UPRXUHG&DEOH 0$(;4XLFN6WRS1LFNHO Plated Brass Gland ([G,,&([Q5,,&([WE,,& &DEOH2'PP %DUULHU*ODQGIRU8QDUPRXUHG&DEOH 01LFNHO3ODWHG%UDVV6WRSSLQJ3OXJ $WH[(([GH,,,& 6WDQGDUG0%ODQNLQJ3OXJ (SR[\0LQXWH$GKHVLYHPOWXEH 2QHWXEHVXIÀFLHQWIRUÀYHEDUULHUJODQGV PP7KUHDGOHQJWKIRU*53SURGXFWV Note: 0RSWLRQVDYDLODEOHIRUWKHDERYH 64 0DQXDO$FWLYDWLRQ&RQWURO GRP PUSH BUTTON Explosion Proof Push Button > GRP PB150 Series It is compatible for use with a PLC, DCS and ESD systems via 4-20mA RXWSXW,WLVLGHDOO\VXLWHGIRUXVHLQ¿UH alarm systems and an addressable RSWLRQZLWKGLRGH¿WWHGLVDYDLODEOH Product overview The PB150 push button range has been approved for use in potentially explosive atmospheres and harsh environmental conditions. )HDWXUHV&HUWLÀFDWLRQV t Approved by ATEX, IECEx t CQST (Available on request only) 7KHXQLWKDVWKHRSWLRQIRUHLWKHUDNH\ reset or self reset. The range also offers an additional visual LED indication option; red, green (or both) FDQEH¿WWHG:KHQIDXOWRUDODUP status arises the green LED will be overridden by the red LED. The design allows for termination inside the unit. Typical applications are Oil and Gas, On-shore and Offshore, Chemical, 3HWURFKHPLFDO5H¿QHULHV0DULQH locations etc. t ATEX: II 2G ([G,,&77 LQFRUSRUDWLQJ,,$,,% t =RQHV t Conforms to EN (IEC) 60079-0 EN (IEC) 60079-1 and EN54 t 'XVWSURRI:HDWKHUSURRI PB150 Series > Ordering Information Switch PB150 Standard Product Selection + Duty Tag Reset Label Label S = Single Switch D = Double Switch Follow the chart (right) to generate your part code. Y = Yes N = No Y = Yes N = No S = Self Reset K = Key Reset LED Indicator Features L = Red *UHHQ F= Lift Flap R = Red R= Resistor (specify) G = Green D = Diode (specify) N = No LED Cable Entry Finish Colour RD = Red A 0 YW = Yellow BU = Blue B 0 N = No Features BL %ODFN OR = Other MODEL CONFIGURATOR (By using the table above, complete this box sequence to select your required push button). PB150 Switch Duty Label Tag Label Reset LED Features Cable Indicator Entry Finish Colour 1RWH$OOFXVWRPHUVRUGHUVZLOOEHFRQ¿UPHGLQZULWLQJ&DUHVKRXOGEHWDNHQWKDWWKHFRUUHFWFRGHKDVEHHQRUGHUHG DVEHVSRNHPDQXIDFWXUHGSURGXFWVFDQQRWEHUHWXUQHGIRUH[FKDQJHRUFUHGLWODWHU Kg 4.2 APPROVALS and &21)250,7,(6 C -40+70 R IP 66 INDUSTRIAL MARINE FIRE GRP 65 XENO Explosion Proof Push Button > GRP PB150 Series General Information EX CODE: CERTIFICATION: TYPE: 0HFKDQLFDO6SHFLÀFDWLRQV 0$7(5,$/ ENCLOSURE COLOUR: $0%,(177(03(5$785( +80,',7< :(,*+7 ',0(16,216 INGRESS PROTECTION: (OHFWULFDO6SHFLÀFDWLRQV 6:,7&+5$7,1* OUTPUT: 7(50,1$7,21 CABLE ENTRY: Exd IIC T4 - T6 $7(;1HPNR;,(&([1(0; CQST (Available on request only) Push Button Enclosure: GRP (Glass Reinforced Plastic) Red (RAL3001), Yellow (RAL1003) %OXH5$/%ODFN5$/ -40 to +70 5+ 4.2 Kg / 9.26 Ib :LGWK/HQJWKPP´+HLJKWPP´ IP 66 Y'F 6A (Resistive), 6A (Inductive) Y$F: 11A (Resistive), 6A (Inductive) On-Off Output (NC/NO) $FFHSWVXSWRPP2 incorporating rising clamp protectors [0RU0 )RU´RU´137UHTXLUHPHQWVPDOHIHPDOHDGDSWHU glands are available. Contact sales dept for further part codes. $FFHVVRULHV 0((;1LFNHO3ODWHG%UDVV*ODQG 0XOWL$UPRXU&RQH$WH[&DW (([GH,,&*' &DEOH,'PP 2'PP *ODQGIRU0XOWL$UPRXUHG&DEOH 0$(;1LFNHO3ODWHG%UDVV*ODQG $WH[&DW(([GH,,&*' &DEOH2'PP *ODQGIRU8QDUPRXUHG&DEOH 0((;461LFNHO3ODWHG%UDVV*ODQG ([G,,&([H,,&([Q5,,&([WE,,,& &DEOH2'PP %DUULHU*ODQGIRU6WHHODQG $OXPLQLXP$UPRXUHG&DEOH 0$(;4XLFN6WRS1LFNHO Plated Brass Gland ([G,,&([Q5,,&([WE,,& &DEOH2'PP %DUULHU*ODQGIRU8QDUPRXUHG&DEOH 01LFNHO3ODWHG%UDVV6WRSSLQJ3OXJ $WH[(([GH,,,& 6WDQGDUG0%ODQNLQJ3OXJ (SR[\0LQXWH$GKHVLYHPOWXEH 2QHWXEHVXIÀFLHQWIRUÀYHEDUULHUJODQGV PP7KUHDGOHQJWKIRU*53SURGXFWV Note: 0RSWLRQVDYDLODEOHIRUWKHDERYH 66 Vi Visual Signals - Explosion Proof S STAINLESS STEEL BEACON /HQV*XDUGQRW VXSSOLHGDVVWDQGDUG Explosion Proof Beacon > Stainless Steel BC125 Series Product overview The BC125 range has been approved for use in potentially explosive atmospheres and very harsh environmental conditions. Typical applications are Oil and Gas, On-shore and Offshore, Chemical, 3HWURFKHPLFDO5H¿QHULHV0DULQH locations etc. )HDWXUHV&HUWLÀFDWLRQV t Approved by ATEX, IECEx t CQST (Available on request only) These beacons have a choice of two types of light source: either Xenon VWUREHZLWKPXOWLSOHÀDVKUDWHDQG power ratings or an LED array with three status type indication options and two power ratings. The design allows for termination inside the enclosure. t ATEX: Ex d IIC T4~ T6 Gb Ex tb IIIC T1350C~T850C t =RQHV The units also have the ability to be ¿WWHGZLWKDWHOHSKRQHLQLWLDWLRQIXQFWLRQ and can be used as the second ring output indicator for telephones when installed in very noisy environments. t Conforms to: EN 60079-0:2012 (IEC 60079-0:2011), EN-60079-1:2007 (IEC 60079-1:2007) EN 60079-31:2009 (IEC 60079-31:2008) t 3600 light output around the vertical axis t 'XVWSURRI:HDWKHUSURRI BC125 Series > Ordering Information Lens Colour BC125 A = Amber + R = Red Follow the chart (right) to generate your part code. Beacon Type X = Xenon B = Blue G = Green C = Clear O = Other Power (Xenon) 05 = 5J 10 = 10J Power (LED) Voltage 05 = : DC 12 - 48v Duty Tag Lens Label Label Guard Y = Yes Y = Yes Cable Entry Finish Colour Telephone Initiated RD = Red Y = Yes A 0 YW = Yellow Y = Yes BU = Blue L = LED 15 = 15J 20 = 20J 10 = : AC 100 - 240v N = No N = No N = No B 0 BL %ODFN N = No OR = Other MODEL CONFIGURATOR (By using the table above, complete this box sequence to select your required beacon). BC125 Lens Beacon Power Power Voltage Duty Colour Type (Xenon) (LED) Label Tag Label Lens Guard Cable Finish Telephone Entry Colour Initiated 1RWH$OOFXVWRPHUVRUGHUVZLOOEHFRQ¿UPHGLQZULWLQJ&DUHVKRXOGEHWDNHQWKDWWKHFRUUHFWFRGHKDVEHHQRUGHUHG DVEHVSRNHPDQXIDFWXUHGSURGXFWVFDQQRWEHUHWXUQHGIRUH[FKDQJHRUFUHGLWODWHU Kg 5.4 APPROVALS and &21)250,7,(6 C -40+70 R IP 66 INDUSTRIAL MARINE STAINLESS STEEL 67 XENO Explosion Proof Beacon > Stainless Steel BC125 Series General Information EX CODE: CERTIFICATION: Ex d IIC T4~ T6 Gb, Ex tb IIIC T1350C~T850C $7(;1HPNR;,(&([1(0; CQST (Available on request only) Xenon or LED Visual Beacon TYPE: ;HQRQ:RUNLQJ6WDWXV ;HQRQ)ODVKLQJ )ODVK5DWH 6HOHFWDEOHIURP)ODVKHVSHU0LQXWH 3RZHU5DWLQJ -:0D[ -:0D[ -:0D[ -:0D[ 109 293 395 424 (IIHFWLYH&DQGHOD $FFHVVRULHV /(':RUNLQJ6WDWXV /(')ODVKLQJ5RWDWLQJ6WDWLF )ODVK5DWH 6HOHFWDEOHIURP)ODVKHVSHU0LQXWH 50023: Cage Guard (Stainless Steel) 5RWDWLRQ5DWH 6HOHFWDEOHIURP5HYROXWLRQVSHU0LQXWH 6WDWLF0RGH Permanently ON (ie Steady) 3RZHU5DWLQJ : : (IIHFWLYH&DQGHOD 128 312 0((;6WDLQOHVV6WHHO*ODQG 0XOWL$UPRXU&RQH$WH[&DW (([GH,,&*' &DEOH,'PP 2'PP *ODQGIRU0XOWL$UPRXUHG&DEOH 08/7,3/<,1*)$&725)25&2/285('/(16(6 Amber x 0.51, Red x 0.15, Blue x 0.12, Green x 0.49, Clear x 1 0HFKDQLFDO6SHFLÀFDWLRQV 0$7(5,$/ Enclosure: Stainless Steel 316 Lens: Tempered Glass LENS COLOURS: Amber, Red, Blue, Green, Clear or Other (specify) ENCLOSURE COLOUR: Red (RAL3001), Yellow (RAL1003) %OXH5$/%ODFN5$/ :(,*+7 5.4 Kg / 11.9 Ib ',0(16,216 /HQJWK:LGWKPP´+HLJKWPP´ INGRESS PROTECTION: IP 66 $0%,(177(03(5$785( -40 to +70 +80,',7< 5+ (OHFWULFDO6SHFLÀFDWLRQV 32:(56833/< <Y'FRUY$F+]<: 7(50,1$7,21 $FFHSWVXSWRPP2 incorporating rising clamp protectors CABLE ENTRY: 0$(;6WDLQOHVV6WHHO*ODQG $WH[&DW(([GH,,&*' &DEOH2'PP *ODQGIRU8QDUPRXUHG&DEOH 0((;466WDLQOHVV6WHHO*ODQG ([G,,&([H,,&([Q5,,&([WE,,,& &DEOH2'PP %DUULHU*ODQGIRU6WHHODQG $OXPLQLXP$UPRXUHG&DEOH 0$(;4XLFN6WRS Stainless Steel Gland ([G,,&([Q5,,&([WE,,& &DEOH2'PP %DUULHU*ODQGIRU8QDUPRXUHG&DEOH 06WDLQOHVV6WHHO6WRSSLQJ3OXJ $WH[(([GH,,,& 6WDQGDUG0%ODQNLQJ3OXJ (SR[\0LQXWH$GKHVLYHPOWXEH 2QHWXEHVXIÀFLHQWIRUÀYHEDUULHUJODQGV [0RU0 PP7KUHDGOHQJWKIRU6WDLQOHVV6WHHOSURGXFWV )RU´RU´137UHTXLUHPHQWVPDOHIHPDOHDGDSWHU glands are available. Contact sales dept for further part codes. Note: 0RSWLRQVDYDLODEOHIRUWKHDERYH BC125 Series > :RUNLQJ&XUUHQW ;HQRQ LED ENERGY Y'F Y'F Y'F Y$F Y$F 5J 460 mA 280 mA 140 mA 60 mA 35 mA : 530 mA 260 mA 120 mA 80 mA 40 mA 60 mA : 1100 mA 530 mA 240 mA 160 mA 80 mA 10 J 850 mA 490 mA 250 mA 100 mA 15 J 1200 mA 700 mA 360 mA 140 mA 80 mA 20 J N/A 960 mA 480 mA 180 mA 110 mA POWER Y'F Y'F Y'F Y$F Y$F 68 Audible Signals - Explosion Proof STAINLESS STEEL SOUNDER Explosion Proof Sounder > Stainless Steel SD125 Series Product overview )HDWXUHV&HUWLÀFDWLRQV All tones can be pre-set during installation. The SD125 electronic sounder range has been approved for use in potentially explosive atmospheres and very harsh environmental conditions. Typical applications are Oil and Gas, On-shore and Offshore, Chemical, 3HWURFKHPLFDO5H¿QHULHV0DULQH locations etc. t Approved by ATEX, IECEx The units also have the ability to be ¿WWHGZLWKDWHOHSKRQHLQLWLDWLRQIXQFWLRQ and can be used as the second ring output indicator for telephones when installed in very noisy environments. t CQST (Available on request only) t ATEX: Ex d IIC T4~ T6 Gb Ex tb IIIC T1350C~T850C t =RQHV t Conforms to: EN 60079-0:2012 (IEC 60079-0:2011) EN-60079-1:2007 (IEC 60079-1:2007) EN 60079-31:2009 (IEC 60079-31:2008) The design allows for termination inside the enclosure. The unit incorporates a three stage alarm The sounder is supplied with a option with 60 tones to choose from. PRXQWLQJEUDFNHWDVVWDQGDUG t Volume control t 'XVWSURRI:HDWKHUSURRI SD125 Series > Ordering Information Voltage SD125 Duty Tag Label Label + DC 12 - 48v Follow the chart (right) to generate your part code. Y = Yes Y = Yes Cable Entry Finish Colour Telephone Initiated RD = Red A 0 YW = Yellow Y = Yes BU = Blue AC 100 - 240v N = No N = No B 0 BL %ODFN N = No OR = Other MODEL CONFIGURATOR (By using the table above, complete this box sequence to select your required sounder). SD125 Voltage Duty Label Tag Label Cable Entry Finish Telephone Colour Initiated 1RWH$OOFXVWRPHUVRUGHUVZLOOEHFRQ¿UPHGLQZULWLQJ&DUHVKRXOGEHWDNHQWKDWWKHFRUUHFWFRGHKDVEHHQRUGHUHG DVEHVSRNHPDQXIDFWXUHGSURGXFWVFDQQRWEHUHWXUQHGIRUH[FKDQJHRUFUHGLWODWHU Kg 6.2 APPROVALS and &21)250,7,(6 C -40+70 R IP 66 G% 115* MARINE INDUSTRIAL STAINLESS STEEL 69 XENO Explosion Proof Sounder > Stainless Steel SD125 Series )L[LQJ+ROHVIRU 0RXQWLQJ%UDFNHW General Information EX CODE: CERTIFICATION: Ex d IIC T4~ T6 Gb, Ex tb IIIC T1350C~T850C $7(;1HPNR;,(&([1(0; CQST (Available on request only) TYPE: Electronic Sounder SOUNDER: 3 Stage alarm with 60 Selectable tones 32:(55$7,1* :DWWV$GMXVWDEOH SOUND OUTPUT: Up to 115 dB at 1 metre (+/- 3dB) * $0%,(177(03(5$785( -40 to +70 +80,',7< 5+ 0HFKDQLFDO6SHFLÀFDWLRQV 0$7(5,$/ ENCLOSURE COLOUR: :(,*+7 ',0(16,216 INGRESS PROTECTION: (QFORVXUH%UDFNHW6WDLQOHVV6WHHO Red (RAL3001), Yellow (RAL1003) %OXH5$/%ODFN5$/ 6.2 Kg / 13.7 Ib /HQJWKPP´ See outline drawing for other dimensions IP 66 (OHFWULFDO6SHFLÀFDWLRQV 32:(56833/< 7(50,1$7,21 CABLE ENTRY: <Y'FRUY$F+]<: $FFHSWVXSWRPP2 incorporating rising clamp protectors [0RU0 )RU´RU´137UHTXLUHPHQWVPDOHIHPDOHDGDSWHU glands are available. Contact sales dept for further part codes. &855(17&2168037,21 6RXQGHUP$P$$GMXVWDEOHE\WRQHVHOHFWLRQ SD125 Series > :RUNLQJ&XUUHQW Y'F Y'F Y'F Y$F Y$F P$0D[: 960 mA 500 mA 210 mA 100 mA $FFHVVRULHV 0((;6WDLQOHVV6WHHO*ODQG 0XOWL$UPRXU&RQH$WH[&DW (([GH,,&*' &DEOH,'PP 2'PP *ODQGIRU0XOWL$UPRXUHG&DEOH 0$(;6WDLQOHVV6WHHO*ODQG $WH[&DW(([GH,,&*' &DEOH2'PP *ODQGIRU8QDUPRXUHG&DEOH 0((;466WDLQOHVV6WHHO*ODQG ([G,,&([H,,&([Q5,,&([WE,,,& &DEOH2'PP %DUULHU*ODQGIRU6WHHODQG $OXPLQLXP$UPRXUHG&DEOH 0$(;4XLFN6WRS Stainless Steel Gland ([G,,&([Q5,,&([WE,,& &DEOH2'PP %DUULHU*ODQGIRU8QDUPRXUHG&DEOH 06WDLQOHVV6WHHO6WRSSLQJ3OXJ $WH[(([GH,,,& 6WDQGDUG0%ODQNLQJ3OXJ (SR[\0LQXWH$GKHVLYHPOWXEH 2QHWXEHVXIÀFLHQWIRUÀYHEDUULHUJODQGV PP7KUHDGOHQJWKIRU6WDLQOHVV6WHHOSURGXFWV Note: 0RSWLRQVDYDLODEOHIRUWKHDERYH 70 $XGLEOH9LVXDO6LJQDOV([SORVLRQ3URRI STAINLESS STEEL SOUNDER/BEACON Explosion Proof Sounder/Beacon> Stainless Steel 6%6HULHV Product overview The SB125-1 electronic combined sounder beacon range has been approved for use in potentially explosive atmospheres and very harsh environmental conditions. Typical applications are Oil and Gas, On-shore and Offshore, Chemical, 3HWURFKHPLFDO5H¿QHULHV0DULQH locations etc. )HDWXUHV&HUWLÀFDWLRQV All tones can be pre-set during installation. In addition, the unit also incorporates a visual warning signal with a choice of two types of light source: either xenon (strobe) with PXOWLSOHÀDVKUDWHVDQGSRZHUUDWLQJV or an LED array with three status type indication options. t Approved by ATEX, IECEx t CQST (Available on request only) t ATEX: Ex d IIC T4~ T6 Gb Ex tb IIIC T1350C~T850C t =RQHV The units also have the ability to be ¿WWHGZLWKDWHOHSKRQHLQLWLDWLRQIXQFWLRQ and can be used as the second ring output indicator for telephones when installed in very noisy environments. t Conforms to: EN 60079-0:2012 (IEC 60079-0:2011), EN-60079-1:2007 (IEC 60079-1:2007) EN 60079-31:2009 (IEC 60079-31:2008) t Volume control t 3600 light output The design allows for termination The unit incorporates a three stage alarm inside the enclosure. The unit can be option with 60 tones to choose from. EUDFNHWPRXQWHGRQO\ around the vertical axis t 'XVWSURRI:HDWKHUSURRI 6%6HULHV! Ordering Information Lens Colour A = Amber 6% + R = Red Beacon Type X = Xenon G = Green C = Clear Power (LED) Voltage 05 = : DC 12 - 48v 02 = 2.5J 05 = 5J Duty Tag Lens Label Label Guard Y = Yes Y = Yes Y = Yes Cable Entry L = LED 15 = 15J Finish Colour Telephone Initiated RD = Red A 0 YW = Yellow Y = Yes BU = Blue 10 = 10J B = Blue Follow the chart (right) to generate your part code. Power (Xenon) 10 = : AC 100 - 240v N = No N = No N = No B 0 BL %ODFN N = No OR = Other 20 = 20J MODEL CONFIGURATOR (By using the table above, complete this box sequence to select your required sounder beacon). 6% Lens Beacon Power Power Voltage Colour Type (Xenon) (LED) Duty Label Tag Label Lens Guard Cable Finish Telephone Entry Colour Initiated 1RWH$OOFXVWRPHUVRUGHUVZLOOEHFRQ¿UPHGLQZULWLQJ&DUHVKRXOGEHWDNHQWKDWWKHFRUUHFWFRGHKDVEHHQRUGHUHG DVEHVSRNHPDQXIDFWXUHGSURGXFWVFDQQRWEHUHWXUQHGIRUH[FKDQJHRUFUHGLWODWHU Kg 8.0 APPROVALS and &21)250,7,(6 C -40+70 R IP 66 G% 115* MARINE INDUSTRIAL STAINLESS STEEL 71 Explosion Proof Sounder/Beacon > XENO Stainless Steel 6%6HULHV General Information EX CODE: CERTIFICATION: Ex d IIC T4~ T6 Gb, Ex tb IIIC T1350C~T850C $7(;1HPNR;,(&([1(0; CQST (Available on request only) ;HQRQRU/('$XGLEOHDQG9LVXDO6LJQDO:DUQLQJ'HYLFH 3 Stage alarm with 60 Selectable tones :DWWV$GMXVWDEOH Up to 115 dB at 1 metre (+/- 3 dB) * TYPE: SOUNDER: 32:(55$7,1* SOUND OUTPUT: ;HQRQ:RUNLQJ6WDWXV ;HQRQ)ODVKLQJ )ODVK5DWH 6HOHFWDEOHIURP)ODVKHVSHU0LQXWH 3RZHU5DWLQJ (IIHFWLYH&DQGHOD 2.5 J :0D[ 5J :0D[ 10 J :0D[ 15 J :0D[ 20 J :0D[ 67 109 293 395 424 /(':RUNLQJ6WDWXV /(')ODVKLQJ5RWDWLQJ6WDWLF )ODVK5DWH 6HOHFWDEOHIURP)ODVKHVSHU0LQXWH 5RWDWLRQ5DWH 6HOHFWDEOHIURP5HYROXWLRQVSHU0LQXWH 6WDWLF0RGH Permanently ON (ie Steady) 3RZHU5DWLQJ : (IIHFWLYH&DQGHOD 128 $FFHVVRULHV 08/7,3/<,1*)$&725)25&2/285('/(16(6 Amber x 0.51, Red x 0.15, Blue x 0.12, Green x 0.49, Clear x 1 0HFKDQLFDO6SHFLÀFDWLRQV 0$7(5,$/ (QFORVXUH%UDFNHW6WDLQOHVV6WHHO Lens: Tempered Glass LENS COLOURS: Amber, Red, Blue, Green, Clear or Other (specify) ENCLOSURE COLOUR: Red (RAL3001), Yellow (RAL1003) %OXH5$/%ODFN5$/ $0%,(177(03(5$785( -40 to +70 +80,',7< 5+ :(,*+7 8 Kg / 17.6 Ib ',0(16,216 /HQJWKPP´1R/HQV*XDUG)LWWHG See outline drawing for other dimensions INGRESS PROTECTION: IP 66 (OHFWULFDO6SHFLÀFDWLRQV 32:(56833/< <Y'FRUY$F+]%HDFRQ<: Sounder: <: 7(50,1$7,21 $FFHSWVXSWRPP2 incorporating rising clamp protectors 0((;6WDLQOHVV6WHHO*ODQG 0XOWL$UPRXU&RQH$WH[&DW (([GH,,&*' &DEOH,'PP 2'PP *ODQGIRU0XOWL$UPRXUHG&DEOH 0$(;6WDLQOHVV6WHHO*ODQG $WH[&DW(([GH,,&*' &DEOH2'PP *ODQGIRU8QDUPRXUHG&DEOH 0((;466WDLQOHVV6WHHO*ODQG ([G,,&([H,,&([Q5,,&([WE,,,& &DEOH2'PP %DUULHU*ODQGIRU6WHHODQG $OXPLQLXP$UPRXUHG&DEOH 0$(;4XLFN6WRS Stainless Steel Gland ([G,,&([Q5,,&([WE,,& &DEOH2'PP %DUULHU*ODQGIRU8QDUPRXUHG&DEOH 06WDLQOHVV6WHHO6WRSSLQJ3OXJ $WH[(([GH,,,& 6WDQGDUG0%ODQNLQJ3OXJ (SR[\0LQXWH$GKHVLYHPOWXEH 2QHWXEHVXIÀFLHQWIRUÀYHEDUULHUJODQGV CABLE ENTRY: [0RU0 PP7KUHDGOHQJWKIRU6WDLQOHVV6WHHOSURGXFWV )RU´RU´137UHTXLUHPHQWVPDOHIHPDOHDGDSWHU glands are available. Contact sales dept for further part codes. Note: 0RSWLRQVDYDLODEOHIRUWKHDERYH &855(17&2168037,21 6RXQGHUP$P$$GMXVWDEOHE\WRQHVHOHFWLRQ 6%6HULHV! 3RZHU&RQVXPSWLRQ:RUNLQJ&XUUHQW 3RZHU&RQVXPSWLRQ6RXQGHU:/(': ;HQRQ -RXOH :0D[ -RXOH -RXOH -RXOH :RUNLQJ&XUUHQW 6RXQGHUP$P$/('P$0D[ -RXOH :0D[ :0D[ :0D[ :0D[ ;HQRQ -RXOH -RXOH -RXOH -RXOH -RXOH 160 mA 320 mA 650 mA $0D[ $0D[ 72 $XGLEOH9LVXDO6LJQDOV STAINLESS STEEL COMBINATION UNITS WITH ACTIVATION CONTROL SB125-4-P Explosion Proof Sounder/Beacon > Stainless Steel 6%6HULHV 7KHXQLWVRIIHUDFRPELQHGDXGLEOH visual warning signal with the option RIHLWKHUDMXQFWLRQER[DOORZLQJH[WUD 7KH6%FRPELQHGVRXQGHU VSDFHIRUHDVHRILQVWDOODWLRQ¿QDO beacon range has been approved for connections. This is particularly helpful use in potentially explosive atmospheres LIWKHXQLWLVWREHLQVWDOOHGLQWRD¿UHRU and very harsh environmental conditions. telecom system where additional cabling is required to monitor external devices or Typical applications are Oil and Gas, a push button unit for manual activation. On-shore and Offshore, Chemical, 3HWURFKHPLFDO5H¿QHULHV The units are mounted on a heavy duty 0DULQHORFDWLRQVHWF 316 stainless steel, pre-drilled, mounting SODWHWKHXQLWVDUHSUHZLUHGDV The unit incorporates a three stage standard, so that on the basic model alarm option with 60 tones to a single input operates both units choose from. simultaneously. Product overview )HDWXUHV&HUWLÀFDWLRQV t Approved by ATEX, IECEx t CQST (Available on request only) t ATEX: II 2G ([G,,&77 LQFRUSRUDWLQJ,,$,,% t =RQHV t Conforms to EN (IEC) 60079-0 EN (IEC) 60079-1 and EN54 t 'XVWSURRI:HDWKHUSURRI 6%6HULHV! Ordering Information Combination &RPELQHG:LWK Lens Colour Type (Optional) SB125 + Follow the chart (right) to generate your part code. 2 = 1xS, 1xB = Junction Box = 1xS, 2xB A = Amber R = Red Beacon Type 4 = 1xS, 3xB G = Green C = Clear 02 = 2J X = Xenon 05 = 5J Power (LED) Voltage 05 = : DC 12 ~ 48v Duty Tag Lens Label Label Guard Y = Yes Y = Yes Y = Yes Cable Entry A = 0 Finish Colour Telephone Initiated RD = Red YW = Yellow 10 = 10J B = Blue P = Push Button Power (Xenon) L = LED 15 = 15J Y = Yes BU = Blue 10 = : N = No AC 100-240v N = No N = No B = 0 BL %ODFN N = No OR = Other 20 = 20J Note: S= Sounder, B= Beacon MODEL CONFIGURATOR (%\XVLQJWKHWDEOHDERYHFRPSOHWHWKLVER[VHTXHQFHWRVHOHFW\RXUUHTXLUHGMXQFWLRQER[ SB125 Combination Combined Lens Beacon Power Power Voltage Type :LWK Colour Type (Xenon) (LED) Duty Label Tag Label Lens Guard Cable Finish Telephone Entry Colour Initiated 1RWH$OOFXVWRPHUVRUGHUVZLOOEHFRQ¿UPHGLQZULWLQJ&DUHVKRXOGEHWDNHQWKDWWKHFRUUHFWFRGHKDVEHHQRUGHUHG DVEHVSRNHPDQXIDFWXUHGSURGXFWVFDQQRWEHUHWXUQHGIRUH[FKDQJHRUFUHGLWODWHU Kg 11.9 6% 16.7 6% 22.0 6% APPROVALS and &21)250,7,(6 C -40+70 R IP 66 INDUSTRIAL MARINE FIRE STAINLESS STEEL 73 Explosion Proof Sounder/Beacon > XENO Stainless Steel 6%6HULHV 233.8mm 20mm Ø185.4mm 0mm 47.5mm 9.0mm 192.5mm General Information Ex d IIC T4~ T6 Gb, Ex tb IIIC T1350C~T850C $7(;1HPNR;,(&([1(0; CQST (Available on request only) ;HQRQRU/('$XGLEOHDQG9LVXDO6LJQDO:DUQLQJ'HYLFH 3 Stage alarm with 60 Selectable tones :DWWV$GMXVWDEOH Up to 115 dB at 1 metre (+/- 3 dB) * TYPE: SOUNDER: 32:(55$7,1* SOUND OUTPUT: 337.5mm Ø15.0mm ‘L’ EX CODE: CERTIFICATION: 15.0mm Centres 482.5mm 627.5mm Cable Entries (x3) 44.0mm 160.0mm 1.8mm 185.0mm 199.2mm SB125-4-J ;HQRQ:RUNLQJ6WDWXV ;HQRQ)ODVKLQJ &RPELQDWLRQ 1R.H\6ORWV ‘L’ )ODVK5DWH 6HOHFWDEOHIURP)ODVKHVSHU0LQXWH 6% 6 400.0 6%-RU3 8 545.0 6%-RU3 8 690.0 6%-RU3 10 835.0 3RZHU5DWLQJ (IIHFWLYH&DQGHOD 2.5 J :0D[ 5J :0D[ 10 J :0D[ 15 J :0D[ 20 J :0D[ 67 109 293 395 424 /(':RUNLQJ6WDWXV /(')ODVKLQJ5RWDWLQJ6WDWLF )ODVK5DWH 6HOHFWDEOHIURP)ODVKHVSHU0LQXWH 5RWDWLRQ5DWH 6HOHFWDEOHIURP5HYROXWLRQVSHU0LQXWH 6WDWLF0RGH Permanently ON (ie Steady) $FFHVVRULHV 50023: Cage Guard (Stainless Steel) 3RZHU5DWLQJ : : (IIHFWLYH&DQGHOD 128 312 08/7,3/<,1*)$&725)25&2/285('/(16(6 Amber x 0.51, Red x 0.15, Blue x 0.12, Green x 0.49, Clear x 1 0HFKDQLFDO6SHFLÀFDWLRQV 0$7(5,$/ (QFORVXUH%UDFNHW6WDLQOHVV6WHHO Lens: Tempered Glass LENS COLOURS: Amber, Red, Blue, Green, Clear or Other (specify) ENCLOSURE COLOUR: Red (RAL3001), Yellow (RAL1003) %OXH5$/%ODFN5$/ $0%,(177(03(5$785( -40 to +70 +80,',7< 5+ :(,*+7 SB125-2: 11.9 Kg / 26.2 lb, SB125-3: 16.7 Kg / 37 lb SB125-4: 22 Kg / 49 lb ',0(16,216 See outline drawings and table for dimensions. INGRESS PROTECTION: IP 66 (OHFWULFDO6SHFLÀFDWLRQV 32:(56833/< <Y'FRUY$F+]%HDFRQ<: Sounder: <: 7(50,1$7,21 $FFHSWVXSWRPP2 incorporating rising clamp protectors CABLE ENTRY: [0RU0 )RU´RU´137UHTXLUHPHQWVPDOHIHPDOHDGDSWHU glands are available. Contact sales dept for further part codes. &855(17&2168037,21 6RXQGHUP$P$$GMXVWDEOHE\WRQHVHOHFWLRQ 0((;6WDLQOHVV6WHHO*ODQG 0XOWL$UPRXU&RQH$WH[&DW (([GH,,&*' &DEOH,'PP 2'PP *ODQGIRU0XOWL$UPRXUHG&DEOH 0$(;6WDLQOHVV6WHHO*ODQG $WH[&DW(([GH,,&*' &DEOH2'PP *ODQGIRU8QDUPRXUHG&DEOH 0((;466WDLQOHVV6WHHO*ODQG ([G,,&([H,,&([Q5,,&([WE,,,& &DEOH2'PP %DUULHU*ODQGIRU6WHHODQG $OXPLQLXP$UPRXUHG&DEOH 0$(;4XLFN6WRS Stainless Steel Gland ([G,,&([Q5,,&([WE,,& &DEOH2'PP %DUULHU*ODQGIRU8QDUPRXUHG&DEOH 06WDLQOHVV6WHHO6WRSSLQJ3OXJ $WH[(([GH,,,& 6WDQGDUG0%ODQNLQJ3OXJ (SR[\0LQXWH$GKHVLYHPOWXEH 2QHWXEHVXIÀFLHQWIRUÀYHEDUULHUJODQGV PP7KUHDGOHQJWKIRU6WDLQOHVV6WHHOSURGXFWV Note: 0RSWLRQVDYDLODEOHIRUWKHDERYH 6%6HULHV! :RUNLQJ&XUUHQW 3RZHU&RQVXPSWLRQ6RXQGHU:/(': ;HQRQ -RXOH -RXOH -RXOH -RXOH :0D[ -RXOH :0D[ :0D[ :0D[ :0D[ :RUNLQJ&XUUHQW 6RXQGHUP$P$/('P$0D[ ;HQRQ -RXOH -RXOH -RXOH -RXOH -RXOH 160 mA 320 mA 650 mA $0D[ $0D[ LED POWER Y'F Y'F Y'F Y$F Y$F : 530 mA 260 mA 120 mA 80 mA 40 mA : 1100 mA 530 mA 240 mA 160 mA 80 mA 74 Visual Signals STAINLESS STEEL COMBINATION UNITS WITH ACTIVATION CONTROL SL125-2-J Explosion Proof Status Lights > Stainless Steel SL125 Series The units offer a visual warning signal ZLWKWKHRSWLRQRIHLWKHUDMXQFWLRQER[ allowing extra space for ease of LQVWDOODWLRQ¿QDOFRQQHFWLRQV7KLVLV particularly helpful if the unit is to be LQVWDOOHGLQWRD¿UHRUWHOHFRPV\VWHP where additional cabling is required to monitor external devices or a push button unit for manual activation. Product overview The SL125 status light range has been approved for use in potentially explosive atmospheres and very harsh environmental conditions. Typical applications are Oil and Gas, On-shore and Offshore, Chemical, 3HWURFKHPLFDO5H¿QHULHV0DULQH locations etc. )HDWXUHV&HUWLÀFDWLRQV t Approved by ATEX, IECEx t CQST (Available on request only) t ATEX: II 2G ([G,,&77 LQFRUSRUDWLQJ,,$,,% t =RQHV The units are mounted on a heavy duty 316 stainless steel, pre-drilled, mounting SODWHWKHXQLWVDUHSUHZLUHGDVVWDQGDUG t Conforms to EN (IEC) 60079-0 EN (IEC) 60079-1 and EN54 t 'XVWSURRI:HDWKHUSURRI SL125 Series > Ordering Information Combination &RPELQHG:LWK Lens Type (Optional) Colour SL125 2 = 2xB + Follow the chart (right) to generate your part code. = 3xB = Junction Box A = Amber R = Red Beacon Type P = Push Button 5 = 5xB* G = Green C = Clear 02 = 2J X = Xenon 05 = 5J Power (LED) Voltage 05 = : DC 12 ~ 48v Duty Tag Lens Label Label Guard Y = Yes Y = Yes Y = Yes Cable Entry A = 0 Finish Colour Telephone Initiated RD = Red YW = Yellow 10 = 10J B = Blue 4 = 4xB Power (Xenon) L = LED 15 = 15J Y = Yes BU = Blue 10 = : N = No AC 100-240v N = No N = No B = 0 BL %ODFN N = No OR = Other 20 = 20J Note: S= Sounder, B= Beacon * Combination Type 5: - or P additions not available with this selection. MODEL CONFIGURATOR (%\XVLQJWKHWDEOHDERYHFRPSOHWHWKLVER[VHTXHQFHWRVHOHFW\RXUUHTXLUHGMXQFWLRQER[ SL125 Combination Combined Lens Beacon Power Power Voltage Duty Label Type :LWK Colour Type (Xenon) (LED) Tag Lens Label Guard Cable Entry Finish Colour Telephone Initiated 1RWH$OOFXVWRPHUVRUGHUVZLOOEHFRQ¿UPHGLQZULWLQJ&DUHVKRXOGEHWDNHQWKDWWKHFRUUHFWFRGHKDVEHHQRUGHUHG DVEHVSRNHPDQXIDFWXUHGSURGXFWVFDQQRWEHUHWXUQHGIRUH[FKDQJHRUFUHGLWODWHU Kg 10.2 2 22 4 15.0 25 5 APPROVALS and &21)250,7,(6 C -40+70 R IP 66 INDUSTRIAL MARINE FIRE STAINLESS STEEL 75 Explosion Proof Status Lights > XENO Stainless Steel SL125 Series 0mm 9.0mm 192.5mm 15.0mm Centres General Information EX CODE: CERTIFICATION: 337.5mm ‘L’ Ø15.0mm Ex d IIC T4~ T6 Gb, Ex tb IIIC T1350C~T850C ATEX and IECEx CQST (Available on request only) ;HQRQRU/('9LVXDO6LJQDO:DUQLQJ'HYLFH TYPE: 20mm 47.5mm 482.5mm 627.5mm Cable Entries (x3) 44.0mm ;HQRQ:RUNLQJ6WDWXV ;HQRQ)ODVKLQJ 160.0mm )ODVK5DWH 6HOHFWDEOHIURP)ODVKHVSHU0LQXWH 185.0mm 3RZHU5DWLQJ 2.5 J :0D[ 5J :0D[ 10 J :0D[ 15 J :0D[ 20 J :0D[ 67 109 293 395 424 (IIHFWLYH&DQGHOD /(':RUNLQJ6WDWXV /(')ODVKLQJ5RWDWLQJ6WDWLF )ODVK5DWH 6HOHFWDEOHIURP)ODVKHVSHU0LQXWH 5RWDWLRQ5DWH 6HOHFWDEOHIURP5HYROXWLRQVSHU0LQXWH 6WDWLF0RGH Permanently ON (ie Steady) &RPELQDWLRQ 1.8mm SL125-4-J 199.2mm 1R.H\6ORWV ‘L’ 6/ 6 400.0 6/-RU3 8 545.0 6/-RU3 8 690.0 6/-RU3 10 835.0 $FFHVVRULHV 3RZHU5DWLQJ : : (IIHFWLYH&DQGHOD 128 312 50023: Cage Guard (Stainless Steel) 0((;6WDLQOHVV6WHHO*ODQG 0XOWL$UPRXU&RQH$WH[&DW (([GH,,&*' &DEOH,'PP 2'PP *ODQGIRU0XOWL$UPRXUHG&DEOH 08/7,3/<,1*)$&725)25&2/285('/(16(6 Amber x 0.51, Red x 0.15, Blue x 0.12, Green x 0.49, Clear x 1 0HFKDQLFDO6SHFLÀFDWLRQV 0$7(5,$/ 0$(;6WDLQOHVV6WHHO*ODQG $WH[&DW(([GH,,&*' &DEOH2'PP *ODQGIRU8QDUPRXUHG&DEOH (QFORVXUH%UDFNHW6WDLQOHVV6WHHO Lens: Tempered Glass LENS COLOURS: Amber, Red, Blue, Green, Clear or Other (specify) ENCLOSURE COLOUR: Red (RAL3001), Yellow (RAL1003) %OXH5$/%ODFN5$/ $0%,(177(03(5$785( -40 to +70 +80,',7< 5+ :(,*+7 SL125-A: 10.2 Kg / 22.5 lb, SL125-B: 15.0 Kg / 33 lb SL125-C: 20.0 Kg / 44 lb, SL125-D: 25.0 Kg / 55 lb ',0(16,216 See outline drawings and table for dimensions. INGRESS PROTECTION: IP 66 (OHFWULFDO6SHFLÀFDWLRQV 32:(56833/< 7(50,1$7,21 CABLE ENTRY: 0((;466WDLQOHVV6WHHO*ODQG ([G,,&([H,,&([Q5,,&([WE,,,& &DEOH2'PP %DUULHU*ODQGIRU6WHHODQG $OXPLQLXP$UPRXUHG&DEOH 0$(;4XLFN6WRS Stainless Steel Gland ([G,,&([Q5,,&([WE,,& &DEOH2'PP %DUULHU*ODQGIRU8QDUPRXUHG&DEOH <Y'FRUY$F+]%HDFRQ<: $FFHSWVXSWRPP2 incorporating rising clamp protectors [0RU0 )RU´RU´137UHTXLUHPHQWVPDOHIHPDOHDGDSWHU glands are available. Contact sales dept for further part codes. &855(17&2168037,21 6RXQGHUP$P$$GMXVWDEOHE\WRQHVHOHFWLRQ 06WDLQOHVV6WHHO6WRSSLQJ3OXJ $WH[(([GH,,,& 6WDQGDUG0%ODQNLQJ3OXJ (SR[\0LQXWH$GKHVLYHPOWXEH 2QHWXEHVXIÀFLHQWIRUÀYHEDUULHUJODQGV PP7KUHDGOHQJWKIRU6WDLQOHVV6WHHOSURGXFWV Note: 0RSWLRQVDYDLODEOHIRUWKHDERYH SL125 Series > :RUNLQJ&XUUHQW 3RZHU&RQVXPSWLRQ6RXQGHU:/(': ;HQRQ -RXOH :0D[ -RXOH -RXOH -RXOH -RXOH :0D[ :0D[ :0D[ :0D[ :RUNLQJ&XUUHQW 6RXQGHUP$P$/('P$0D[ ;HQRQ -RXOH -RXOH -RXOH -RXOH -RXOH 160 mA 320 mA 650 mA $0D[ $0D[ LED POWER Y'F Y'F Y'F Y$F Y$F : 530 mA 260 mA 120 mA 80 mA 40 mA : 1100 mA 530 mA 240 mA 160 mA 80 mA 76 Visual Signals - Explosion Proof STAINLESS STEEL CALL POINT ([SORVLRQ3URRI0DQXDO&DOO3RLQW! Stainless Steel CP125 Series Product overview The CP125 manual call point range has been approved for use in potentially explosive atmospheres and harsh environmental conditions. Typical applications are Oil and Gas, On-shore and Offshore, Chemical, 3HWURFKHPLFDO5H¿QHULHV 0DULQHORFDWLRQVHWF It is compatible for use with a PLC, DCS and ESD systems via 4-20mA RXWSXW,WLVLGHDOO\VXLWHGIRUXVHLQ¿UH alarm systems and an addressable RSWLRQZLWKGLRGH¿WWHGLVDYDLODEOH )HDWXUHV&HUWLÀFDWLRQV The range also offers an additional visual LED indication option; red, JUHHQRUERWKFDQEH¿WWHG:KHQ fault or alarm status arises the green LED will be overridden by the red LED. The design allows for termination inside the unit. t ATEX: II 2G ([G,,&77 LQFRUSRUDWLQJ,,$,,% t Approved by ATEX, IECEx t CQST (Available on request only) t =RQHV t Conforms to EN (IEC) 60079-0 EN (IEC) 60079-1 and EN54 t 'XVWSURRI:HDWKHUSURRI CP125 Series > Ordering Information Switch CP125 Follow the chart (right) to generate your part code. + Duty Tag Label Label S = Single Switch D = Double Switch Y = Yes N = No Y = Yes N = No LED Indicator Features L = Red *UHHQ F= Lift Flap R = Red R= Resistor (specify) G = Green D = Diode (specify) N = No LED N = No Features Cable Entry Finish Colour RD = Red A 0 YW = Yellow BU = Blue B 0 BL %ODFN OR = Other MODEL CONFIGURATOR (By using the table above, complete this box sequence to select your required manual call point). CP125 Switch Duty Label LED Features Cable Finish Tag Label Indicator Entry Colour 1RWH$OOFXVWRPHUVRUGHUVZLOOEHFRQ¿UPHGLQZULWLQJ&DUHVKRXOGEHWDNHQWKDWWKHFRUUHFWFRGHKDVEHHQRUGHUHG DVEHVSRNHPDQXIDFWXUHGSURGXFWVFDQQRWEHUHWXUQHGIRUH[FKDQJHRUFUHGLWODWHU Kg 4.9 APPROVALS and &21)250,7,(6 C -40+70 R IP 66 INDUSTRIAL MARINE FIRE STAINLESS STEEL 77 XENO ([SORVLRQ3URRI0DQXDO&DOO3RLQW! Stainless Steel CP125 Series General Information EX CODE: CERTIFICATION: TYPE: 0HFKDQLFDO6SHFLÀFDWLRQV 0$7(5,$/ ENCLOSURE COLOUR: $0%,(177(03(5$785( +80,',7< :(,*+7 ',0(16,216 INGRESS PROTECTION: (OHFWULFDO6SHFLÀFDWLRQV 6:,7&+5$7,1* OUTPUT: 7(50,1$7,21 CABLE ENTRY: Exd IIC T4 - T6 $7(;1HPNR;,(&([1(0; CQST (Available on request only) 0DQXDO&DOO3RLQW Enclosure: Stainless Steel 316 Red (RAL3001), Yellow (RAL1003) %OXH5$/%ODFN5$/ -40 to +70 5+ 4.9 Kg / 10.8 Ib :LGWK/HQJWKPP´+HLJKWPP´ IP 66 Y'F 6A (Resistive), 6A (Inductive) Y$F 11A (Resistive), 6A (Inductive) On-Off Output (NC/NO) $FFHSWVXSWRPP2 incorporating rising clamp protectors [0RU0 )RU´RU´137UHTXLUHPHQWVPDOHIHPDOHDGDSWHU glands are available. Contact sales dept for further part codes. $FFHVVRULHV 0((;6WDLQOHVV6WHHO*ODQG 0XOWL$UPRXU&RQH$WH[&DW (([GH,,&*' &DEOH,'PP 2'PP *ODQGIRU0XOWL$UPRXUHG&DEOH 0$(;6WDLQOHVV6WHHO*ODQG $WH[&DW(([GH,,&*' &DEOH2'PP *ODQGIRU8QDUPRXUHG&DEOH 0((;466WDLQOHVV6WHHO*ODQG ([G,,&([H,,&([Q5,,&([WE,,,& &DEOH2'PP %DUULHU*ODQGIRU6WHHODQG $OXPLQLXP$UPRXUHG&DEOH 0$(;4XLFN6WRS Stainless Steel Gland ([G,,&([Q5,,&([WE,,& &DEOH2'PP %DUULHU*ODQGIRU8QDUPRXUHG&DEOH 06WDLQOHVV6WHHO6WRSSLQJ3OXJ $WH[(([GH,,,& 6WDQGDUG0%ODQNLQJ3OXJ (SR[\0LQXWH$GKHVLYHPOWXEH 2QHWXEHVXIÀFLHQWIRUÀYHEDUULHUJODQGV PP7KUHDGOHQJWKIRU6WDLQOHVV6WHHOSURGXFWV Note: 0RSWLRQVDYDLODEOHIRUWKHDERYH 78 Enclosure - Explosion Proof STAINLESS STEEL -81&7,21%2; Explosion Proof Junction Box > Stainless Steel -%6HULHV )HDWXUHV&HUWLÀFDWLRQV Product overview t Approved by ATEX, IECEx 7KH-%MXQFWLRQER[UDQJHKDV been approved for use in potentially explosive atmospheres and harsh environmental conditions. The enclosures are machined from marine grade 316 stainless steel and are supplied with four pre-drilled conduit entries. t CQST (Available on request only) t ATEX: II 2G ([G,,&77 LQFRUSRUDWLQJ,,$,,% t =RQHV Typical applications are Oil and Gas, On-shore and Offshore, Chemical, 3HWURFKHPLFDO5H¿QHULHV 0DULQHORFDWLRQVHWF They have been designed to offer maximum space for cable termination with a choice of either an 8 or 10 way WHUPLQDOEORFN t Conforms to EN (IEC) 60079-0 EN (IEC) 60079-1 and EN54 t 'XVWSURRI:HDWKHUSURRI -%6HULHV! Ordering Information Terminal %ORFN -% Follow the chart (right) to generate your part code. + 08 = +ROHV Cable Entry Finish Colour RD = Red A 0 YW = Yellow BU = Blue 10 = +ROHV B 0 BL %ODFN OR = Other MODEL CONFIGURATOR (%\XVLQJWKHWDEOHDERYHFRPSOHWHWKLVER[VHTXHQFHWRVHOHFW\RXUUHTXLUHGMXQFWLRQER[ -% Terminal Cable %ORFN Entry Finish Colour 1RWH$OOFXVWRPHUVRUGHUVZLOOEHFRQ¿UPHGLQZULWLQJ&DUHVKRXOGEHWDNHQWKDWWKHFRUUHFWFRGHKDVEHHQRUGHUHG DVEHVSRNHPDQXIDFWXUHGSURGXFWVFDQQRWEHUHWXUQHGIRUH[FKDQJHRUFUHGLWODWHU Kg 3.5 APPROVALS and &21)250,7,(6 C -40+70 R IP 66 INDUSTRIAL MARINE FIRE STAINLESS STEEL 125mm 79 Ø125mm XENO Explosion Proof Junction Box> Stainless Steel -%6HULHV General Information EX CODE: CERTIFICATION: TYPE: Exd IIC T4 - T6 $7(;1HPNR;,(&([1(0; CQST (Available on request only) Junction Box 0HFKDQLFDO6SHFLÀFDWLRQV 0$7(5,$/ ENCLOSURE COLOUR: $0%,(177(03(5$785( +80,',7< :(,*+7 ',0(16,216 INGRESS PROTECTION: Enclosure: Stainless Steel 316 Red (RAL3001), Yellow (RAL1003) %OXH5$/%ODFN5$/ -40 to +70 5+ 3.5 Kg / 7.7 Ib :LGWK/HQJWKPP´+HLJKWPP´ IP 66 (OHFWULFDO6SHFLÀFDWLRQV 7(50,1$7,21 $FFHSWVXSWRPP2 incorporating rising clamp protectors CABLE ENTRY: [0RU0 )RU´RU´137UHTXLUHPHQWVPDOHIHPDOHDGDSWHU glands are available. Contact sales dept for further part codes. 90mm 44mm 80mm 125mm $FFHVVRULHV 0((;6WDLQOHVV6WHHO*ODQG 0XOWL$UPRXU&RQH$WH[&DW (([GH,,&*' &DEOH,'PP 2'PP *ODQGIRU0XOWL$UPRXUHG&DEOH 0$(;6WDLQOHVV6WHHO*ODQG $WH[&DW(([GH,,&*' &DEOH2'PP *ODQGIRU8QDUPRXUHG&DEOH 0((;466WDLQOHVV6WHHO*ODQG ([G,,&([H,,&([Q5,,&([WE,,,& &DEOH2'PP %DUULHU*ODQGIRU6WHHODQG $OXPLQLXP$UPRXUHG&DEOH 0$(;4XLFN6WRS Stainless Steel Gland ([G,,&([Q5,,&([WE,,& &DEOH2'PP %DUULHU*ODQGIRU8QDUPRXUHG&DEOH 06WDLQOHVV6WHHO6WRSSLQJ3OXJ $WH[(([GH,,,& 6WDQGDUG0%ODQNLQJ3OXJ (SR[\0LQXWH$GKHVLYHPOWXEH 2QHWXEHVXIÀFLHQWIRUÀYHEDUULHUJODQGV PP7KUHDGOHQJWKIRU6WDLQOHVV6WHHOSURGXFWV Note: 0RSWLRQVDYDLODEOHIRUWKHDERYH 80 0DQXDO$FWLYDWLRQ&RQWURO STAINLESS STEEL PUSH BUTTON Explosion Proof Push Button > Stainless Steel PB125 Series It is compatible for use with a PLC, DCS and ESD systems via 4-20mA RXWSXW,WLVLGHDOO\VXLWHGIRUXVHLQ¿UH alarm systems and an addressable RSWLRQZLWKGLRGH¿WWHGLVDYDLODEOH Product overview The PB125 push button range has been approved for use in potentially explosive atmospheres and harsh environmental conditions. )HDWXUHV&HUWLÀFDWLRQV t Approved by ATEX, IECEx t CQST (Available on request only) 7KHXQLWKDVWKHRSWLRQIRUHLWKHUDNH\ reset or self reset. The range also offers an additional visual LED indication option; red, green (or both) FDQEH¿WWHG:KHQIDXOWRUDODUP status arises the green LED will be overridden by the red LED. The design allows for termination inside the unit. Typical applications are Oil and Gas, On-shore and Offshore, Chemical, 3HWURFKHPLFDO5H¿QHULHV0DULQH locations etc. t ATEX: II 2G ([G,,&77 LQFRUSRUDWLQJ,,$,,% t =RQHV t Conforms to EN (IEC) 60079-0 EN (IEC) 60079-1 and EN54 t 'XVWSURRI:HDWKHUSURRI PB125 Series > Ordering Information Switch PB125 Follow the chart (right) to generate your part code. + Duty Tag Reset Label Label S = Single Switch D = Double Switch Y = Yes N = No Y = Yes N = No S = Self Reset K = Key Reset LED Indicator Features L = Red *UHHQ F= Lift Flap R = Red R= Resistor (specify) G = Green D = Diode (specify) N = No LED Cable Entry Finish Colour RD = Red A 0 YW = Yellow BU = Blue B 0 N = No Features BL %ODFN OR = Other MODEL CONFIGURATOR (By using the table above, complete this box sequence to select your required push button). PB125 Switch Duty Label Tag Label Reset LED Features Cable Indicator Entry Finish Colour 1RWH$OOFXVWRPHUVRUGHUVZLOOEHFRQ¿UPHGLQZULWLQJ&DUHVKRXOGEHWDNHQWKDWWKHFRUUHFWFRGHKDVEHHQRUGHUHG DVEHVSRNHPDQXIDFWXUHGSURGXFWVFDQQRWEHUHWXUQHGIRUH[FKDQJHRUFUHGLWODWHU Kg 4.9 APPROVALS and &21)250,7,(6 C -40+70 R IP 66 INDUSTRIAL MARINE FIRE STAINLESS STEEL 81 XENO Explosion Proof Push Button > Stainless Steel PB125 Series General Information EX CODE: CERTIFICATION: TYPE: 0HFKDQLFDO6SHFLÀFDWLRQV 0$7(5,$/ ENCLOSURE COLOUR: $0%,(177(03(5$785( +80,',7< :(,*+7 ',0(16,216 INGRESS PROTECTION: (OHFWULFDO6SHFLÀFDWLRQV 6:,7&+5$7,1* OUTPUT: 7(50,1$7,21 CABLE ENTRY: Exd IIC T4 - T6 $7(;1HPNR;,(&([1(0; CQST (Available on request only) Push Button Enclosure: Stainless Steel 316 Red (RAL3001), Yellow (RAL1003) %OXH5$/%ODFN5$/ -40 to +70 5+ 4.9 Kg / 10.8 Ib :LGWK/HQJWKPP´+HLJKWPP´ IP 66 Y'F 6A (Resistive), 6A (Inductive) Y$F 11A (Resistive), 6A (Inductive) On-Off Output (NC/NO) $FFHSWVXSWRPP2 incorporating rising clamp protectors [0RU0 )RU´RU´137UHTXLUHPHQWVPDOHIHPDOHDGDSWHU glands are available. Contact sales dept for further part codes. $FFHVVRULHV 0((;6WDLQOHVV6WHHO*ODQG 0XOWL$UPRXU&RQH$WH[&DW (([GH,,&*' &DEOH,'PP 2'PP *ODQGIRU0XOWL$UPRXUHG&DEOH 0$(;6WDLQOHVV6WHHO*ODQG $WH[&DW(([GH,,&*' &DEOH2'PP *ODQGIRU8QDUPRXUHG&DEOH 0((;466WDLQOHVV6WHHO*ODQG ([G,,&([H,,&([Q5,,&([WE,,,& &DEOH2'PP %DUULHU*ODQGIRU6WHHODQG $OXPLQLXP$UPRXUHG&DEOH 0$(;4XLFN6WRS Stainless Steel Gland ([G,,&([Q5,,&([WE,,& &DEOH2'PP %DUULHU*ODQGIRU8QDUPRXUHG&DEOH 06WDLQOHVV6WHHO6WRSSLQJ3OXJ $WH[(([GH,,,& 6WDQGDUG0%ODQNLQJ3OXJ (SR[\0LQXWH$GKHVLYHPOWXEH 2QHWXEHVXIÀFLHQWIRUÀYHEDUULHUJODQGV PP7KUHDGOHQJWKIRU6WDLQOHVV6WHHOSURGXFWV Note: 0RSWLRQVDYDLODEOHIRUWKHDERYH 82 Visual Signals - Explosion Proof BATTERY OPERATED BEACONS 200mm Explosion Proof > HZ610 LED Portable Beacon It is of robust construction and can be set for either a Flashing or Static (Steady On) light mode by twisting the lens to the left or to the right. Product overview The HZ610 series portable LED beacon has been designed for use in Zone 2, Potentially Explosive Atmospheres. The beacon comes with a wide range of accessories making the product extremely versatile in a wide range of applications. The beacon requires two ‘D’ cell Alkaline batteries for operation (not supplied). The beacon is ideally suited for marking/warning of temporary hazards in an explosion proof environment. 60mm Features t LED long life t Zone 2 HZ610 Series > Ordering Information II 3G EX 11C T4 Gc t Low battery indicator Code No: Voltage: Light Source: Amber LED-P-HZ610-01 3v Dc --- 8 LEDs t Shock resistent t Ultra quick installation t Versatile accessory options t 40 hours life Red LED-P-HZ610-02 3v Dc --- 8 LEDs t 360o light output around the vertical axis Accessories t Dustproof & Waterproof Material 50170 Standard Base 50171 Magnetic Clip Kg 0.35 APPROVALS and CONFORMITIES 50174 Magnetic Base o C -20+50 50176 Suction Cup 50177 Daylight Hood IP 66 50178 Carry Bag FPM 160 UV Stable Polycarbonate Lens UV Stable ABS Body MARINE EXPLOSION PROOF INDUSTRIAL 83 ACOUSTIC 84 Acoustic Signals - Industrial PIEZO BUZZERS Connections for 115v & 230v Tone Terminals Pulsed A + B Continuous A + C Connections for 12v to 48v Tone Terminals Pulsed B + A Continuous B + C Acoustic Signals Piezo Buzzers > AE20M Series Product overview locking ring allows for easy installation for all panel mount installations. The AE20M piezo miniature buzzer range is a compact, low cost audible signalling solution for local indication where very low current consumption may be a requirement. A threaded Locking Ring The unit offers a single stage alarm, either a fast pulsed or continuous tone selectable by a three pin connection combination. AE20M Series > Ordering Information Front View Features t Continuously rated Code No: Voltage: Frequency: Current: dB: AE20M-12 10-20v Dc --- 2900 Hz 25 mA 90 AE20M-24 10-28v Dc --- 2900 Hz 25 mA 85 AE20M-48 6-48v Dc --- 2900 Hz 35 mA 82 t Economical t Suitable for panel mounting only t Two tone sound option t Wide operating voltage t Compact design t Locking ring allows for AE20M-115 60-120v Ac ~ 2900 Hz 25 mA 90 AE20M-230 130-240v Ac ~ 2900 Hz 25 mA 90 Frequency +/- 500 Kg 0.08 APPROVALS and CONFORMITIES easy installation Material dB at prime voltage +/- 3dB 50/60 Hz ABS Plastic o C -20+60 IP 55 dB 80/90 PULSED OR CONTINUOUS INDUSTRIAL 85 Acoustic Signals - Industrial MINATURE BUZZERS Trumpet Top 35.0 40.0 6.5 1.45 36.5 0.8 Flat Top FLAT TOP The AE30M Flat top & Trumpet top miniature buzzers are suitable for automotive, security and light industrial applications where local indication is required. The buzzers offer a single stage alarm and produce a rich, high quality and low frequency signal The slightly lower dB is more than compensated by lower frequency of sound output produced. The VLQJOHSRLQW¿[DQGFRPSDFWGHVLJQ allows for installation in most locations. The units are colour coded, Black = 12vDc & Red = 24vDc. These products were IRUPHUO\VXSSOLHGE\.OD[RQ 51.0 6.0 R5.5 25.0 when compared to other piezo type alarms. TRUMPET TOP Product overview 22.4 Acoustic Signals Industrial Buzzers > AE30M Series 35.2 16.0 16.0 32.0 TERMINATIONS 250 SERIES BLADES (6.35 X 0.81 TAB) (FEMALE -VE TERMINAL) Features t Continuously rated t Economical AE30M Series > Ordering Information t Suitable for panel or surface mounting Code No: Voltage: Frequency: Current: t Termination by male & female Flat Top AE30M-FT-01 AE30M-FT-02 6-14v Dc --10-28v Dc --- 450Hz 450Hz 30 mA z 25 mA zz Trumpet Top AE30M-TT-01 AE30M-TT-02 6-14v Dc --10-28v Dc --- 450Hz 450Hz 30 mA 25 mA zz z at 12v Dc --- Frequency +/- 20 Hz Kg 0.28 APPROVALS and CONFORMITIES t Produces a high quality sound spade terminals t Wide operating voltage t Compact design z Material at 24v Dc --- zz ABS Plastic dB at prime voltage +/- 3dB o C -20+60 IP 34 dB 80/90 INDUSTRIAL AUTOMOTIVE 86 Acoustic Signals - Industrial PIEZO BUZZERS AE35M AE35M 46.00 49.00 60.35 CRS 5.00 AE35M LEAD LENGTH _ 10.00 150,00 + AE36M The AE35M (P40) and AE36M (P60) are piezo buzzers designed for use in security, process control and a wide range of industrial applications where a compact but more powerful acoustic signal is required. 83.0 63.0 83.0 The units offer a single stage alarm and can either be pulsed or continuous, selection made by a third wire. The AE35M is installed XVLQJWKHH[WHUQDOPRXQWLQJOXJV The AE36M uses a separate mounting plate where the main EX]]HUFDQEHVQDS¿WWHGLQWRSODFH allowing for termination inside the enclosure. These products were IRUPHUO\VXSSOLHGE\.OD[RQ Product overview 80 .0 C R S 14.0 Acoustic Signals Industrial Buzzers > AE35M & AE36M Series 51.0 CRS AE36M Features t Continuously rated t Higher sound output AE35M & AE36M Series > Ordering Information Code No: Voltage: Frequency: t Economical Current: t AE35M: Suitable for panel or surface mounting AE35M-02 AE36M-02 6-28v Dc --6-28v Dc --- 3200Hz 3200Hz 50 mA z 57 mA z t AE36M: Suitable for panel, FRQGXLWER[RUVXUIDFHPRXQWLQJ t Wide voltage range z Material At 24v Dc --- Frequency +/- 500 dB at prime voltage +/- 3dB ABS Plastic Kg 0.06 0.10 AE35M AE36M APPROVALS and CONFORMITIES o C -20+60 IP 30 dB 98 AE35M 105 AE36M INDUSTRIAL 87 Acoustic Signals - Industrial ELECTRICAL/MECHANICAL BUZZERS 85.0mm 52.0mm 18.0mm E N Ø96.0mm L ABHF8 26.0mm Acoustic Signals Industrial Buzzers > AE95 & ABHF8 Series 112.0mm 137.0mm 75.0mm AE95 They can also be pulsed via a remote source (ie control panel/plc etc) to give an intermittent signal if required. 103.2mm ABHF8 10.3Ø Hole 254.0mm 79.4mm The units offer a single stage alarm, once energised an electromagnet causes the diaphragm to vibrate creating a unique acoustic tone. The AE95 can also be used in automotive applications (reversing alarm/forklift trucks etc) and has an RSWLRQDOEDFNER[WKDWZLOOEHUHTXLUHG for weatherproof applications which allows for termination inside the protected enclosure. 169.0mm Product overview The AE95 and ABHF8 series are electrical/mechanical buzzers suitable for a wide range industrial signalling applications where a low frequency and penetrating audible signal is required. 51.0mm The ABHF8 is a weatherproof unit also suitable for light marine applications (small boats/barges etc) and is encased in a brass enclosure making it suitable for corrosive environments. Design allows for termination inside the enclosure. 90.5mm 330.0mm Features t Rugged construction t Wide voltage range t These units are rated PLQV2QPD[PLQ2IIPLQLPXP AE95 & ABHF8 Series > Ordering Information Code No: Voltage: Frequency: Current: AE95 Series (AE) AE95-05 AE95-06 24/48v Ac/Dc --~ 115/230v Ac/Dc --~ 420 Hz 420 Hz 0.8 A 0.4/0.2 A AE95-07 z 24/48v Ac/Dc --~ z AE95-08 115/230v Ac/Dc --~ z )LWWHGZLWKD:HDWKHUSURRIEDFNER[ 420 Hz 420 Hz 0.8 A 0.4/0.2 A ABHF8 Series (AB) ABHF8-1437 ABHF8-1436 Kg 0.70 (AE) 2.10 (AB) APPROVALS and CONFORMITIES t AE95M: Suitable for 2 point DXWRPRWLYH¿[ t Loud low frequency sound t $%+)6XLWDEOHIRUVLQJOHSRLQW¿[ t Dustproof and Weatherproof Material AE95 Powder Coated Mild Steel 24/48v Ac/Dc --~ 115/230v Ac/Dc --~ 50/60 Hz 420 Hz 420 Hz o C -30+60 Ø105.0mm AE95 When fitted with AE95-BB 0.80 A 0.4/0.2 A IP 65 ABHF8 Powder Coated Mild Steel in a Brass outer enclosure AE95-07/08 ABHF8 IP 53 AE95-05/06 dB 111 ON 15 MINS OFF 1 MINS INDUSTRIAL 88 Acoustic Signals - Industrial ELECTRONIC SOUNDERS Acoustic Signals Electronic Sounders > AE40M Series tones, selectable in the unit via a dip switch. Product overview The AE40M range of electronic sounders are suitable for a wide UDQJHRI¿UHDQG,QGXVWULDO signalling applications where a low FRVWHQHUJ\HI¿FLHQWDQGÀH[LEOH signalling solution is required. The DC unit offers a two stage alarm with a choice of eight separate The shallow base design allows for termination inside the enclosure through the rear of the base only. The deep base design allows for termination via two M20 knockouts on the side & two 10mm entries in the rear. The AC unit offers a single stage alarm with a choice of eight separate tones. 50mm 60mm Fixing Options Features t Continuously rated AE40M Series > Ordering Information t Higher sound output Code No: Voltage: Frequency: Current: AE40M-24R-SB 10-30v Dc --- 800-2580 Hz 32 mA AE40M-24R zz 10-30v Dc --- 800-2580 Hz 32 mA AE40M-230R zz 98-260v Ac ~ 800-2580 Hz 50 mA t Economical t 6XLWDEOHIRUSDQHOFRQGXLWER[ z Current at 24v Dc --- zzDeep Base Note: Decibels are subject to prime voltage and tone selectedd Weatherproof to IP65 or surface mounting t Deep base version - Dustproof and Weatherproof Material z Kg 0.35 DC 0.40 AC APPROVALS and CONFORMITIES 50/60 Hz o C -40+70 IP 54/65 zz ABS Plastic dB 95-112 INDUSTRIAL FIRE 89 Acoustic Signals - Industrial ELECTRONIC SOUNDER Acoustic Signals Electronic Sounder > AE100M Series All tones can be pre-set during installation. Product overview The AE100M series is suitable for Industrial & marine signalling applications where an audible signal is required to operate in very harsh enviromental conditions. The units also have the ability to be ¿WWHGZLWKDWHOHSKRQHLQLWLDWLRQIXQFWLRQ and can be used as the second ring output indicator for telephones when installed in very noisy environments. The design allows for termination The unit incorporates a three stage alarm inside the enclosure. RSWLRQZLWKVL[W\WKUHHWRQHVWRFKRRVH from which includes four tones that can be The sounder is supplied with a recorded or customised by the installer. mounting bracket as standard. Features t Continuously rated t Very high sound output AE100M Series > Ordering Information t 5-20 W power consumption t Termination up to 2.5 mm2 Code No: Voltage: Frequency: Current: AE100M-02 12-48v Dc --- 300 - 2900 Hz 0.91 / 0.96 / 0.50 A AE100M-04 100-240v Ac ~ 300 - 2900 Hz 100 mA z z t [0FDEOHHQWU\RSWLRQV t Deep base version - Dustproof & Weatherproof Material at 230v Ac ~ Enclosure: UV Stable, Flame retardent polycarbonate Bracket: Stainless 316 Kg 1.5 APPROVALS and CONFORMITIES 50/60 Hz C -40+70 o IP 66 dB 123 INDUSTRIAL MARINE 90 6RQRVDQG1H[XV3XOVH$OHUW7HFKQRORJ\! conforming to EN54 Pt:23 Introduction to EN54 Pt:23 7KH2SHQFODVVL¿FDWLRQDOORZVWKHPDQXIDFWXUHUWR specify the coverage volume and coverage shape, and does not restrict mounting height. Pulse Alert 7HFKQRORJ\LVQRWVSHFL¿HGLQWKLVZD\DVLWKDVEHHQ GHVLJQHGWRH[FHHGWKHUHTXLUHPHQWVRIWKHPRUH VSHFL¿FGHYLFHFODVVL¿FDWLRQV 7KHQHZ(XURSHDQ¿UHVWDQGDUGVSHFL¿HVWKHPLQLPXP performance requirements for Visual Alarm Devices (VADs), removing any ambiguity regarding the light output requirements or system design parameters involved with using light to evacuate buildings. 6RQRV3XOVHDUHDYDLODEOHDV¿UHEHDFRQVRUFRPELQHG VRXQGHUEHDFRQVIRUZDOORUFHLOLQJPRXQW1H[XV3XOVH are combined sounder/beacons for wall mount only. 7KHFKRLFHRID5HGRU:KLWHÀDVKZLOOGLFWDWHWKH¿QDO coverage volume. 7KHVWDQGDUGVSHFL¿HVWKUHHGLIIHUHQWFODVVL¿FDWLRQV for VADs: Wall, Ceiling & Open. Wall & Ceiling mount FDWHJRULHVDUHVSHFL¿HGDWGHVLJQDWHGPRXQWLQJKHLJKWV and particular coverage patterns areas. Ceiling Mount Ceiling Mount EN54-23 Coverage 7KHFRYHUDJHYROXPHLVFODVVL¿HGDVD code in the form of C – X – Y where C GHVLJQDWHV&HLOLQJFODVVL¿FDWLRQ;LV WKHPD[LPXPPRXQWLQJKHLJKW<LV the diameter of the coverage area. All distances are measured in meters. 3m 3m 8.9m 15m Sonos Red Flash Sonos White Flash Wall Mount Wall Mount EN54-23 Coverage 7KHFRYHUDJHYROXPHLVFODVVL¿HGDVD code in the form of W – X – Y where W GHVLJQDWHV:DOOFODVVL¿FDWLRQ;LVWKH PD[LPXPPRXQWLQJKHLJKW<LVWKH width & length of the coverage area. All distances are measured in meters. 2.4m 3.1m 7.5m 11.3m 7.5m 11.3m Sonos White Flash Sonos Red Flash Wall Mount EN54-23 Coverage 2.4m 7.5m 3.1m 11.3m 7.5m 1H[XV5HG)ODVK 11.3m 1H[XV:KLWH)ODVK 91 Audible & Visual Signals - EN54 Pt:23 ELECTRONIC SOUNDERS Shallow Base Audible & Visual Electronic Sounders > Sonos Pulse Ceiling Series Product overview 7KHZKLWHÀDVKXQLWJLYLQJWKH optimum coverage area. Sonos Pulse Ceiling mounted visual DODUPGHYLFHVDUHDYDLODEOHDV¿UH beacons or combined sounder beacons. The choice of a white or DUHGÀDVKXQLWZLOOGHWHUPLQHWKH amount of area that can be covered. 7KHÀDVKUDWHLVVHOHFWDEOHRQWKH unit and will dictate the current consumed. Shallow or Deep base selection dictate ingress protection (IP) levels of the enclosure. Deep Base Sonos Pulse Ceiling: Red or White Flash > Ordering Information Code No: Voltage: Base Type: Description: Flash rate at @0.5Hz @ 1Hz Current: Beacon ESB-5005 ESB-5006 ESB-5007 ESB-5008 17-60v Dc--17-60v Dc--17-60v Dc--17-60v Dc--- Deep Base Shallow Base Deep Base Shallow Base White Flash and White Body White Flash and White Body White Flash and Red Body White Flash and Red Body 20mA 20mA 20mA 20mA 40mA 40mA 40mA 40mA ESD-5005 ESD-5006 ESD-5007 ESD-5008 17-60v Dc--17-60v Dc--17-60v Dc--17-60v Dc--- Deep Base Shallow Base Deep Base Shallow Base Red Flash and White Body Red Flash and White Body Red Flash and Red Body Red Flash and Red Body 20mA 20mA 20mA 20mA 40mA 40mA 40mA 40mA Features t EN54 Pt:23 Approved t VDS Approved Sounder/Beacon * ESC-5005 17-60v Dc--ESC-5006 17-60v Dc--ESC-5007 17-60v Dc--ESC-5008 17-60v Dc--- Deep Base Shallow Base Deep Base Shallow Base White Flash and White Body White Flash and White Body White Flash and Red Body White Flash and Red Body 25mA 25mA 25mA 25mA 45mA 45mA 45mA 45mA ESF-5005 ESF-5006 ESF-5007 ESF-5008 Deep Base Shallow Base Deep Base Shallow Base Red Flash and White Body Red Flash and White Body Red Flash and Red Body Red Flash and Red Body 25mA 25mA 25mA 25mA 45mA 45mA 45mA 45mA t Up to 15m Coverage Volumes t Synchronised Flash t No Surge Current t Wire to base Technology Kg 17-60v Dc--17-60v Dc--17-60v Dc--17-60v Dc--- 0.24 SB 0.29 DB APPROVALS and CONFORMITIES o C -25+70 IP 21 SB 65 DB dB 97 * t 8SWR[PPFDEOHHQWULHV t ABS FR construction t Dustproof and Weatherproof FPM 30/60 FIRE 92 Audible & Visual Signals - EN54 Pt:23 ELECTRONIC SOUNDERS Shallow Base Audible & Visual Electronic Sounders > Sonos Pulse Wall Series Product overview 7KHZKLWHÀDVKXQLWJLYLQJWKH optimum coverage area. Sonos Pulse Wall mounted visual DODUPGHYLFHVDUHDYDLODEOHDV¿UH beacons or combined sounder beacons. The choice of a white or DUHGÀDVKXQLWZLOOGHWHUPLQHWKH amount of area that can be covered. 7KHÀDVKUDWHLVVHOHFWDEOHRQWKH unit and will dictate the current consumed. Shallow or Deep base selection dictate ingress protection (IP) levels of the enclosure. Deep Base Sonos Pulse Wall: Red or White Flash > Ordering Information Code No: Voltage: Base Type: Description: Flash rate at @0.5Hz @ 1Hz Current: Beacon ESB-5001 ESB-5002 ESB-5003 ESB-5004 17-60v Dc--17-60v Dc--17-60v Dc--17-60v Dc--- Deep Base Shallow Base Deep Base Shallow Base White Flash and White Body White Flash and White Body White Flash and Red Body White Flash and Red Body 20mA 20mA 20mA 20mA 40mA 40mA 40mA 40mA ESD-5001 ESD-5002 ESD-5003 ESD-5004 17-60v Dc--17-60v Dc--17-60v Dc--17-60v Dc--- Deep Base Shallow Base Deep Base Shallow Base White Body and Red Flash White Body and Red Flash Red Body and Red Flash Red Body and Red Flash 20mA 20mA 20mA 20mA 40mA 40mA 40mA 40mA Features t EN54 Pt:23 Approved t VDS Approved Sounder/Beacon * ESC-5001 17-60v Dc--ESC-5002 17-60v Dc--ESC-5003 17-60v Dc--ESC-5004 17-60v Dc--- Deep Base Shallow Base Deep Base Shallow Base White Flash and White Body White Flash and White Body White Flash and Red Body White Flash and Red Body 25mA 25mA 25mA 25mA 45mA 45mA 45mA 45mA ESF-5001 ESF-5002 ESF-5003 ESF-5004 Deep Base Shallow Base Deep Base Shallow Base White Body and Red Flash White Body and Red Flash Red Body and Red Flash Red Body and Red Flash 25mA 25mA 25mA 25mA 45mA 45mA 45mA 45mA t Up to 15m Coverage Volumes t Synchronised Flash t No Surge Current t Wire to base Technology Kg 17-60v Dc--17-60v Dc--17-60v Dc--17-60v Dc--- 0.24 SB 0.29 DB APPROVALS and CONFORMITIES o C -25+70 IP 21 SB 65 DB dB 97 * t 8SWR[PPFDEOHHQWULHV t ABS FR construction t Dustproof and Weatherproof FPM 30/60 FIRE 93 Audible & Visual Signals - EN54 Pt:23 ELECTRONIC SOUNDERS 1H[XV 1H[XV 1H[XV 1H[XV Audible & Visual Electronic Sounders > Nexus Pulse Wall Series Product overview 7KH1H[XV3XOVH:DOOPRXQWHG9LVXDO Alarm devices are combined sounder EHDFRQVGHVLJQHGIRU¿UHDODUPXVH These units have been designed to offer much higher dB outputs to provide audible cover in larger installations. The enclosures have been designed to offer higher levels of ingress protection (IP) up to marine use. The choice of DZKLWHRUUHGÀDVKXQLWZLOOGHWHUPLQH the amount of area that can be FRYHUHG7KHZKLWHÀDVKXQLWJLYLQJWKH RSWLPXPFRYHUDJHDUHD7KHÀDVKUDWH is selectable on the unit and will dictate the current consumed. Features 1H[XV3XOVH:DOO5HGRU:KLWH)ODVK! Ordering Information Code No: Voltage: Description: Flash rate at: @0.5Hz @ 1Hz Current: Decibel: @1meter White Flash and Red Body Red Flash and Red Body 50mA 50mA 70mA 70mA 105 105 ENC-6002 17-60v Dc--END-6002 17-60v Dc--- White Flash and Red Body Red Flash and Red Body 65mA 65mA 85mA 85mA 110 110 0.8 105 1.2 110 APPROVALS and CONFORMITIES t Up to 11.3m Coverage Volumes t Synchronised Flash t No Surge Current Sounder / Beacon ENC-6001 17-60v Dc--END-6001 17-60v Dc--- Kg t EN54 Pt:23 Approved o C -25+70 IP 66 FPM 30/60 t Wire to base Technology t 8SWR[PPFDEOHHQWULHV t ABS FR construction t Dustproof and Weatherproof FIRE 94 Acoustic Signals - Industrial ELECTRONIC SOUNDERS A A Electronic Sounders > Klaxon AE105, AE110 & AE120 B C Dimensions (mm) Product overview The AE105, 110 & 120 ‘NEXUS’ range of electronic sounders are VXLWDEOHIRUDZLGHUDQJHRI¿UHDQG Industrial signalling applications where a high degree of signalling versatility is required in the environment. The units offer a three stage alarm ZLWKVL[W\IRXUVHSDUDWHWRQH options that are automatically synchronised on multi unit installations, selectable inside the XQLWYLDDVL[ZD\GLSVZLWFK7KH range has been designed to allow a µ¿UVW¿[¶ZLULQJVROXWLRQ&RQQHFWLRQV are made in the base during initial wiring phase which results in faster and more reliable installation. D 105 110&120 A B C D E F 136.2 124.5 35.0 118.0 76.5 5.0 166.3 149.5 38.6 99.5 145.0 6.0 1RWH)L[LQJGHWDLOLVVKRZQ 7KHµVRXQGHUKHDG¶LVWKHQ¿[HGLQWR position using four captive, quarter turn fasteners, giving accurate seal FRPSUHVVLRQIRUZHDWKHUSURR¿QJ 7KHUHDUH¿YHFDEOHHQWU\RSWLRQV allowing for termination inside the enclosure. REF E Dia F 6mm Fixing Holes Features t Continuously rated AE105, AE110 & AE120 Series > Ordering Information Suitable for surface, FRQGXLWER[RUZDOOPRXQWLQJ Code No: Voltage: Current: dB at 1m: Wide operating voltage AE105-02MF AE105-04MF 10-60v Dc --115/230v Ac ~ 8-40 mA 40 mA 100-113 100-113 AE110-02MF AE110-03MF AE110-04MF 10-60v Dc --24-48v Ac ~ 115/230v Ac ~ 10-50 mA 10-50 mA 40 mA 104-116 104-116 104-116 AE120-02MF $(0) 10-60v Dc --Y$Fa 120-550 mA P$PD[ 110-120 Volume control adjustment (-20dB) Note: Decibels and current are subject to voltage and tone selectedd Kg 0.8, 1.2, 2.0 APPROVALS and CONFORMITIES 50/60 Hz o Ac C -25+55 -25+70 Dc Conforms to EN54-3 Type B for Fire Alarm use (Dc Only) Vds & NF approved versions available upon special request only Dustproof and Weatherproof Material Flame Retardent ABS IP 66 MARINE INDUSTRIAL FIRE 95 Visual & Acoustic Signals - Industrial ELECTRONIC SOUNDER & BEACON COMBINED A Electronic Sounder & Beacon Combined Klaxon > AE L/X 105, 110, 120 Product overview The AE L/X 105, 110 & 120 ‘NEXUS’ range of electronic sounder/beacons DUHVXLWDEOHIRUDZLGHUDQJHRI¿UHDQG Industrial signalling applications where a high degree of signalling versatility is required in the environment. The units offer a three stage alarm with VL[W\IRXUVHSDUDWHWRQHRSWLRQVWKDWDUH automatically synchronised on multi unit installations, selectable inside the unit YLDDVL[ZD\GLSVZLWFK The range has been designed to allow Dµ¿UVW¿[¶ZLULQJVROXWLRQ&RQQHFWLRQV are made in the base during initial wiring phase which results in faster and more reliable installation. The ‘sounder head’ LVWKHQ¿[HGLQWRSRVLWLRQXVLQJIRXU captive, quarter turn fasteners, giving accurate seal compression for ZHDWKHUSURR¿QJ7KHUHDUH¿YHFDEOH entry options allowing for termination inside the enclosure. G B C Dimensions (mm) D 105 110&120 136.2 124.5 35.0 118.0 76.5 5.0 173.0 166.3 149.5 38.6 99.5 145.0 6.0 213.5 E This range offers a choice of either LED or Xenon visual warning. LED being the PRUHSRZHUHI¿FLHQWRSWLRQ;HQRQ giving a more industrial warning signal. AE L/X 105, 110, 120 Series > Ordering Information REF A B C D E F G FDia 6mm Fixing Holes 1RWH)L[LQJGHWDLOLVVKRZQ Features Code No: Voltage: Light Source: Current: dB at 1m: AEL105-02MF AEX105-02MF AEX105-04MF 10-60v Dc --10-60v Dc --115/230v Ac ~ LED Xenon Xenon 26-58 mA z 358-390 mA z 110 mA 100-113 100-113 100-113 Suitable for surface, FRQGXLWER[RUZDOOPRXQWLQJ AEL110-02MF AEX110-02MF AEX110-04MF 10-60v Dc --10-60v Dc --115/230v Ac ~ LED Xenon Xenon 28-68 mA z 360-400 mA z 110 mA 104-116 104-116 104-116 Audible & visual warning signal AEL120-02MF AEX120-02MF AEX120-04MF 10-60v Dc --10-60v Dc --115/230v Ac ~ LED Xenon Xenon 138-568 mA z 470-900 mA z 110 mA 110-120 110-120 110-120 Vds & NF approved versions available upon special request only z 6XEMHFWWRYROWDJHWRQHVHOHFWLRQDQG/('EHDFRQVHWWRÀDVKPRGH ADD THE FOLLOWING LENS CODES TO THE PRODUCT WHEN ORDERING Kg 0.8, 1.2, 2.0 APPROVALS and CONFORMITIES 50/60 Hz o Wide operating voltage Conforms to EN54-3 Type B for Fire Alarm use (Dc Only) Dustproof and Weatherproof Material 01 02 03 04 05 Ac C -25+55 -25+70 Dc t Continuously rated IP 66 Flame Retardent ABS FPM 60 INDUSTRIAL MARINE FIRE 96 Acoustic Signals - Industrial POWERFUL SIRENS AS200 AS100 106.00mm 198.0mm A AS200 CABLE ENTRY M20 X 1.5 2 HOLES 71.0mm 7.0mm DIA A 50.0mm 96.0mm 38.0mm 98.50m SECTION A-Am 38.0mm 38.0mm 56.0mm Acoustic Signals Industrial Sirens > AS100 & AS200 Series AS100 180.0mm 95.0mm The sirens incorporate a fractional horse power motor that drives an internal impellor at high RPM forcing air through the slotted front cover creating its unique penetrating sound. The units are of robust construction and suitable for use in harsh environmental conditions. Design allows for termination inside the HQFORVXUHYLD[0FRQGXLWHQWU\ Voltage: Frequency: 64.0mm 32.0mm 76.0mm 2 x 7.0mm 95.0mm 82.0mm Features t Continuously rated AS100 & AS200 Sirens > Ordering Information Code No: 60.0mm 20.0mm x 1.5mm pitch The AS100 & AS200 sirens were designed for a wide range of industrial signalling applications where a powerful high output signal is required. The units offer a single stage alarm when energised but may be pulsed or modulated by simply turning the power on/off to produce the classic ‘wailing’ siren sound. 83.0mm Product overview 40.0mm Suitable for wall or pole mounting Current: Omni-directional 3600 coverage Very high sound output AS100 (Klaxon Mono 72) AS100-04MF AS100-05MF 115v Ac/Dc --~ 230v Ac/Dc --~ 1800 Hz 1800 Hz 1A 0.5 A AS200 (Klaxon Duplo) AS200-04MF AS200-05MF 115v Ac/Dc --~ 230v Ac/Dc --~ 1600 Hz 1600 Hz 2.7 A 1.2 A Dustproof and Weatherproof (when mounted with impellor below black ABS casing) Material Cast Aluminium Body ABS Rotor, Stator and Cover Kg 1.7 AS100 2.0 AS200 APPROVALS and CONFORMITIES 50/60 Hz C -30+45 o IP 65 120dB AS100 dB 127dB AS200 INDUSTRIAL 97 Acoustic Signals - Industrial POWERFUL SIRENS 113.0mm 170.0mm AS300 AS300 140.0mm AS400 Product overview The AS300 & AS400 range of sirens were designed for a wide range of industrial signalling applications where a very powerful high output signal is required. The sirens incorporate a fractional horse power motor that drives an internal impellor at high RPM forcing air through the slotted front cover creating its unique penetrating sound. The units offer a single stage alarm when energised but may be pulsed or modulated by simply turning the power on/off to produce the classic ‘wailing’ siren sound. The units are of robust construction and suitable for use in harsh environmental conditions. The AS400 siren produces a low frequency sound that is ideally suited for signalling over medium size areas. For PD[LPXPFRYHUDJHLWLVDGYLVHGWKDWWKH unit be raised above the surrounding buildings. Design allows for termination inside the enclosure. The AS300 is VXSSOLHGZLWKDPÀ\LQJOHDG Voltage: AS300 (SuperM) AS300-04MF AS300-05MF 115v Ac/Dc --~ 230v Ac/Dc --~ AS350 (Masterblaster) AS350-05MF-12 230v Ac/Dc --~ with 12v Trigger Relay AS400-05MF Kg z 1.8 AS300 4.5 AS400 APPROVALS and CONFORMITIES 230v Ac/Dc --~ 50/60 Hz Frequency: 1680 Hz 1680 Hz Cable entry 20.0mm 6.0mm Type 3 Posns AS400 ø176.00mm 3 Holes ø7.10 Equi-spaced on a PC ø195.20 Features t Continuously rated Suitable for wall or pole mounting AS300 & AS400 Sirens > Ordering Information Code No: 250.0mm Acoustic Signals Industrial Sirens > AS300 & AS400 Series 95.0mm Omni-directional 3600 coverage Current: Very high sound output Dustproof and Weatherproof (when mounted as per instructions) 2.7A 1.0A Material AS300 1680 Hz 1.0A ABS Construction AS400 900 Hz C -30+45 o Cast Aluminium Body & Noryl Rotor 1.4A IP 55/65 z 127dB AS300 dB 125dB AS400 INDUSTRIAL 98 Acoustic Signals - Industrial MANUAL OR MOTOR DRIVEN HOOTERS A1 Hooter ES Manual Hooter Acoustic Signals Industrial Hooters > ES Manual & A1 Series A1 Hooter ES Manual Hooter The A1 is a powerful motor driven KRRWHUJLYLQJWKHXQLTXHµNOD[RQ¶VRXQG Product overview The ES is a manually operated hooter SURGXFLQJWKHXQLTXHµ.OD[RQ¶VRXQG for applications where a power supply is unavailable. The high output, low frequency resonating sound gives a powerful warning tone. Typical applications include small boats, canal barges, mine trucks and fork lift trucks. With a sound output of 120dB, it can cut through background noise in almost any environment and is ideal for use as a time signalling alarm or process alarm in the noisiest factory. The ES gives a powerful sound which, with its low frequency tone, makes its an effective warning device. In addition, the A1 can be used on barges, work boats and dock sides and for other similar marine applications. Features A1 Hooter t Powerful, high output t 120 dB t Robust construction t Weatherproof to IP65 ES Manual Hooter t Manual operation - no power supply required t Lightweight and compact ES Manual & A1 Series > Ordering Information t Robust and reliable Code No: Voltage: Frequency: Current: A1 Hooter (A1) AHA1-2000 AHA1-2001 AHA1-2002 AHA1-2004 AHA1-2003 AHA1-2006 12v Dc --24v Dc --48v Dc --115v Ac ~ 230v Dc --230v Ac ~ 420 Hz 420 Hz 420 Hz 420 Hz 420 Hz 420 Hz 5.0 A 2.30 A 1.30 A 0.84 A 0.80 A 0.76 A 2.0 (A1) 1.20 (ES) APPROVALS and CONFORMITIES Material A1 Hooter Die cast aluminium & Zinc Mild Steel ABS Plastic ES Manual Hooter ES Manual Hooter (ES) AHES-1290 n/a Kg t IP54 150-350 Hz 50/60 Hz (A1) o C -20+66 Mild steel n/a (A1) IP 65 54 (A1) (ES) (A1) ON 2 MIN OFF 5 MIN MARINE dB 120 (A1) 103 (ES) INDUSTRIAL 99 Acoustic Signals - Industrial HIGH SOUND / LOW FREQUENCY AIR HORNS AP Series A AP Series SK Series Dimensions (mm) B 2 x ø8.3mm Fixing Holes @ 135mm centres Acoustic Signals Industrial Air Horns > AP and SK Series Product overview A The SK range of air horns are suitable for marine and very harsh environments where a very high sound and very low frequency outputs are required for signalling over medium to larger size areas. Operated from a compressed air supply, being non electrical, the units produce the classic ‘fog horn’ sound. AP198M 127 198 100 AP360M 127 360 100 C SK Series Dimensions (mm) B length The AP range of air horns are suitable for industrial environments where very high sound and very low frequency outputs are required for signalling over medium to larger size areas. REF A B C REF A B (EM) B (GM) C SK2 127 435 358 111 SK6 162 437 341 111 1/4 inch BSP C 111mm dia Operated from a compressed air supply, being non electrical, the units produce the classic ‘fog horn’ sound. The SK also offers a mini compressor for locations without a compressed air supply, suitable for SK2 version only. Features t Continuously rated AP and SK Series > Ordering Information t Robust construction Code No: Air Pressure: Air Consumption: Frequency: dB: AP198M AP360M AP450M 55-140 psi 55-140 psi 55-140 psi 50-133 L/min 50-133 L/min 50-133 L/min 660 Hz 387 Hz 307 Hz 125 125 125 APSK6-GM z APSK2-GM z APSK2-EM z APSK6-EM z 50-100 psi 10-30 psi 10-30 psi 50-100 psi 50-100 L/min 50-100 L/min 50-100 L/min 50-100 L/min 370 Hz 370 Hz 315 Hz 315 Hz 132 120 134 124 APPROVALS and CONFORMITIES C -30+70 (AP) o IP 66 t Very low frequency tone t Wide operating air pressure t Suitable for wall or pole mounting t Dustproof and Weatherproof Material AP Series Aluminium, Brass & Phosphur Bronze Code No: Air Pressure: Voltage: Current: z APSK-Compressor 14 psi 24v Dc--36 A (49mm o/d, 116mm L, 0.41 kg) To obtain optimum dB performance the DLUKRUQPD\UHTXLUH¿QHWXQLQJZKHQXVHGZLWKDFRPSUHVVRU (AP) Average Kg 0.85 1.95 (SK) Average t Very high sound output SK Series Brass/Phosphur bronze MARINE INDUSTRIAL AP450M 127 450 100 100 Audible Signals - Industrial & Marine IP66 BELLS 77.0mm 49.5mm 115.0mm 38.5mm 5.5mm 29.0mm 58.0mm Acoustic Signals > Industrial & Marine-IP66 Series The new range of 6” & 8” Solenoid driven bells have been designed and manufactured to withstand harsh environmental conditions, ideally suited for heavy duty industrial & marine applications where rugged construction and a high weatherproof FODVVL¿FDWLRQLVUHTXLUHG The design allows for up to 4 x M20 cabling entry knockouts, two from above & one on either side to allow for ORRSLQORRSRXWFDEOLQJDSSOLFDWLRQV Termination is inside the enclosure DQGFDWHUVIRU[PP2FDEOHV 0('0DULQHDSSURYDOSHQGLQJ 84.0mm The bells produce a rich and clear ‘traditional’ alarm bell sound free from PHFKDQLFDOFODWWHU 168.0mm 25.5mm 219.0mm Product overview 93.0mm 7.0mm 1RWH0RÀDVK%HOOPXVWEHPRXQWHGLQWKLVSRVLWLRQ ZLWKWKHVROHQRLGVWULNHULQWKHXSULJKWSRVWLRQ (see top diagram above) Industrial & Marine-IP66 Series > Ordering Information Features Code No: t 3 SRLQW¿[ZLWKDGMXVWPHQWVORWV Colour: Voltage: Current: t Anti Tamper gong bolt A6BM-12DC A6BM-24DC A6BM-24DCR $%0$& $%0$& A6BM-230AC Grey Grey Red *UH\ *UH\ Grey 12v Dc --24v Dc --24v Dc --Y$Fa Y$Fa 230v Ac ~ 400 mA 210 mA 210 mA P$ P$ 60 mA t I(& A8BM-24DC A8BM-24DCR $%0$& A8BM-230AC Grey Red *UH\ Grey 24v Dc --24v Dc --Y$Fa 230v Ac ~ 210 mA 210 mA P$ 60 mA Material Kg A6 Bell A8 Bell APPROVALS and CONFORMITIES Hz IP 66 dB Compliant for installation on ships t E1 Compliant for Alarm systems t Dustproof and Weatherproof UV Stable Polypropelene Back Box Zinc Powder Coated Steel Gong 106 A6 Bell 108 A8 Bell ON 10 MIN OFF 30 MIN INDUSTRIAL MARINE 101 Acoustic Signals - Industrial ECONOMY BELLS Ø150.0mm 110.0mm 64.0mm 150.0mm Acoustic Signals > AB6 Solenoid Series 30.0mm 5.5mm FLYING LEAD EXIT Ø121.5mm Product overview They are suitable for light commercial/industrial use where intermittent audible signalling is required in a localised area. These traditional type bells produce their distinctive sound by means of a hardened striker powered by a solenoid, repeatedly striking the inside edge of metal gong, producing a loud & clear ringing tone. The bells can be mounted on any ÀDWVXUIDFHXWLOLVLQJHLWKHUWKHIRXU mounting holes that are incorporated into the body of the casting or the universal mounting plate and gasket (supplied as standard) that offers PXOWLSOH¿[LQJORFDWLRQRSWLRQV 8.7mm FIXING DETAIL Features t Economy signal t Distinctive sound AB6 Solenoid Series > Ordering Information Code No: Voltage: Gong Size: t Die-Cast construction Current: t Universal mounting plate t SXSSOLHGZLWKPPÀ\LQJOHDGV AB6-24DC 24v Dc --- 152mm / 6” 80 mA t Powder coated gong AB6-115AC 115v Ac ~ 152mm / 6” 60 mA t IP44 AB6-230AC 230v Ac ~ 152mm / 6” 30 mA Material Steel Gong Aluminium Body Kg 1.2 APPROVALS and CONFORMITIES 50/60 Hz IP 44 dB 100 +/- 3 o C -20+45 ON 15 MINS OFF 20 MINS Manufacturers of Visual & Audible Signalling Devices 0RÁDVK6LJQDOOLQJ/WG8.+HDGTXDUWHUV 11 Upper Conybere Street Highgate Birmingham B12 0EB General Enquiries: +44 (0) 121 440 5894 )RU6DOHV(QTXLULHV Sales Tel: +44 (0) 121 446 5322 Sales Fax: +44 (0) 121 446 4344 0RÁDVK6LJQDOOLQJ/WG*HUPDQ\ Zum Ueltgesforthof 14 47441 Moers Germany 0RÁDVK6LJQDOOLQJ/WG$VLD3DFLÀF 3HQMXUX/DQH Singapore 6091890 )RU6DOHV(QTXLULHV Tel: +49 (0) 2841-8860560 Fax: +49 (0) 2841-8860519 )RU6DOHV(QTXLULHV Tel: +65 (0) 916 3836 Mobile: +44 (0) 7510 888 025 (International) (PDLO EVLQDL#VDOHVJHUPDQ\FRP (PDLO DVKOH\#PRÀDVKDVLDFRP (PDLOXNVDOHV#PRÀDVKFRXN (PDLOH[SRUWVDOHV#PRÀDVKFRXN ZZZPRÁDVKFRP ,VVXH &DWDORJXH 0RÀDVK 6LJQDOOLQJ /LPLWHG UHVHUYHV WKHULJKWWRPRGLI\SURGXFWVSHFL¿FDWLRQVZLWKRXWSULRUQRWLFHZLWKLQ RXUSROLF\RIFRQWLQXDOSURGXFWGHYHORSPHQW