A short introduction to biology Life • Two categories: – Prokaryotes (e.g. bacteria) • Unicellular • No nucleus – Eukaryotes (e.g. fungi, plant, animal) • Unicellular or multicellular • Has nucleus Prokaryote vs Eukaryote • Eukaryote has many membrane-bounded compartment inside the cell – Different biological processes occur at different cellular location Organism, Organ, Cell Organism Chemical contents of cell • Water • Macromolecules (polymers) - “strings” made by linking monomers from a specified set (alphabet) –Protein –DNA –RNA –… • Small molecules –Sugar –Ions (Na+, Ka+, Ca2+, Cl- ,…) –Hormone –… DNA • DNA: forms the genetic material of all living organisms – Can be replicated and passed to descendents – Contains information to produce proteins • To computer scientists, DNA is a string made from alphabet {A, C, G, T} – e.g. ACAGAACGTAGTGCCGTGAGCG • Each letter is a nucleotide • Length varies from hundreds to billions RNA • Historically thought to be information carrier only – DNA => RNA => Protein – New roles have been found for them • To computer scientists, RNA is a string made from alphabet {A, C, G, U} – e.g. ACAGAACGUAGUGCCGUGAGCG • Each letter is a nucleotide • Length varies from tens to thousands Protein • Protein: the actual “worker” for almost all processes in the cell – – – – – Enzymes: speed up reactions Signaling: information transduction Structural support Production of other macromolecules Transport • To computer scientists, protein is a string made from 20 kinds of characters – E.g. MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGP • Each letter is called an amino acid • Length varies from tens to thousands DNA/RNA zoom-in • • • • Commonly referred to as Nucleic Acid DNA: Deoxyribonucleic acid RNA: Ribonucleic acid Found mainly in the nucleus of a cell (hence “nucleic”) • Contain phosphoric acid as a component (hence “acid”) • They are made up of a string of nucleotides Nucleotides • A nucleotide has 3 components – Sugar ring (ribose in RNA, deoxyribose in DNA) – Phosphoric acid – Nitrogen base • • • • Adenine (A) Guanine (G) Cytosine (C) Thymine (T) in DNA and Uracil (U) in RNA Free phosphate 5’ A 5 prime 3 prime 5’-AGCGACTG-3’ G C AGCGACTG G DNA A Often recorded from 5’ to 3’, which is the direction of many biological processes. e.g. DNA replication, transcription, etc. C T G 3’ 5 Phosphate 4 Base 1 Sugar 3 2 Free phosphate 5’ A 5 prime 3 prime 5’-AGUGACUG-3’ G U AGUGACUG G RNA A Often recorded from 5’ to 3’, which is the direction of many biological processes. e.g. translation. C U G 3’ 5 Phosphate 4 Base 1 Sugar 3 2 5’ A 3’ Base-pair: A=T G=C G Forward (+) strand 5’-AGCGACTG-3’ 3’-TCGCTGAC-5’ C G A AGCGACTG TCGCTGAC C Backward (-) strand One strand is said to be reversecomplementary to the other T G 3’ 5’ DNA usually exists in pairs. DNA double helix G-C pair is stronger than A-T pair RNA • RNAs are normally singlestranded • Form complex structure by selfbase-pairing • A=U, C=G • Can also form RNA-DNA and RNA-RNA double strands. – A=T/U, C=G Protein zoom-in • Protein is the actual “worker” for almost all processes in the cell • A string built from 20 kinds of chars – E.g. MGDVEKGKKIFIMKCSQCHTVEKGGKH • Each letter is called an amino acid Side chain R | H2N--C--COOH | Carboxyl group Amino group H Generic chemical form of amino acid Units of Protein: Amino acid • 20 amino acids, only differ at side chains – Each can be expressed by three letters – Or a single letter: A-Y, except B, J, O, U, X, Z – Alanine = Ala = A – Histidine = His = H Amino acids => peptide R | H2N--C--COOH | H R | H2N--C--COOH | H R R | | H2N--C--CO--NH--C--COOH | | H H Peptide bond Protein R H2N R R R R R … N-terminal • • • • COOH C-terminal Has orientations Usually recorded from N-terminal to C-terminal Peptide vs protein: basically the same thing Conventions – Peptide is shorter (< 50aa), while protein is longer – Peptide refers to the sequence, while protein has 2D/3D structure Genome and chromosome • Genome: the complete DNA sequences in the cell of an organism – May contain one (in most prokaryotes) or more (in eukaryotes) chromosomes • Chromosome: a single large DNA molecule in the cell – May be circular or linear – Contain genes as well as “junk DNAs” – Highly packed! Formation of chromosome Formation of chromosome 50,000 times shorter than extended DNA The total length of DNA present in one adult human is the equivalent of nearly 70 round trips from the earth to the sun Gene • Gene: unit of heredity in living organisms – A segment of DNA with information to make a protein or a functional RNA Some statistics Chromosomes Bases Genes Human 46 3 billion 20k-25k Dog 78 2.4 billion ~20k Corn 20 2.5 billion 50-60k Yeast 16 20 million ~7k E. coli 1 4 million Marbled lungfish ? 130 billion ? ~4k Human genome • 46 chromosomes: 22 pairs + X + Y 1 from mother, 1 from father • Female: X + X • Male: X + Y Central dogma of molecular biology DNA Replication • The process of copying a double-stranded DNA molecule – Semi-conservative 5’-ACATGATAA-3’ 3’-TGTACTATT-5’ 5’-ACATGATAA-3’ 5’-ACATGATAA-3’ 3’-TGTACTATT-5’ 3’-TGTACTATT-5’ p p p Nucleotide triphosphate (dNTP) • Mutation: changes in DNA base-pairs • Proofreading and error-correcting mechanisms exist to ensure extremely high fidelity Central dogma of molecular biology Transcription • The process that a DNA sequence is copied to produce a complementary RNA – Called message RNA (mRNA) if the RNA carries instruction on how to make a protein – Called non-coding RNA if the RNA does not carry instruction on how to make a protein – Only consider mRNA for now • Similar to replication, but – Only one strand is copied Transcription (where genetic information is stored) DNA-RNA pair: A=U, C=G T=A, G=C (for making mRNA) Coding strand: 5’-ACGTAGACGTATAGAGCCTAG-3’ Template strand: 3’-TGCATCTGCATATCTCGGATC-5’ mRNA: 5’-ACGUAGACGUAUAGAGCCUAG-3’ Coding strand and mRNA have the same sequence, except that T’s in DNA are replaced by U’s in mRNA. Translation • The process of making proteins from mRNA • A gene uniquely encodes a protein • There are four bases in DNA (A, C, G, T), and four in RNA (A, C, G, U), but 20 amino acids in protein • How many nucleotides are required to encode an amino acid in order to ensure correct translation? – 4^1 = 4 – 4^2 = 16 – 4^3 = 64 • The actual genetic code used by the cell is a triplet. – Each triplet is called a codon The Genetic Code Third letter Translation • The sequence of codons is translated to a sequence of amino acids • Gene: -GCT TGT TTA CGA ATT• mRNA: -GCU UGU UUA CGA AUU • Peptide: - Ala - Cys - Leu - Arg - Ile – • Start codon: AUG – Also code Met – Stop codon: UGA, UAA, UAG Translation • Transfer RNA (tRNA) – a different type of RNA. – Freely float in the cell. – Every amino acid has its own type of tRNA that binds to it alone. • Anti-codon – codon binding crucial. tRNA-Pro Anti-codon Nascent peptide tRNA-Leu mRNA Transcriptional regulation Transcription factor RNA Polymerase Transcription starting site promoter • • • gene Will talk more in later lectures RNA polymerase binds to certain location on promoter to initiate transcription Transcription factor binds to specific sequences on the promoter to regulate the transcription – Recruit RNA polymerase: induce – Block RNA polymerase: repress – Multiple transcription factors may coordinate Splicing promoter Transcription starting site gene transcription Pre-mRNA • Pre-mRNA needs to be “edited” to form mature mRNA • Will talk more in later lectures. intron intron Pre-mRNA 5’ UTR exon exon 3’ UTR exon Splicing Mature mRNA (mRNA) Open reading frame (ORF) Start codon Stop codon Summary • DNA: a string made from {A, C, G, T} – Forms the basis of genes – Has 5’ and 3’ – Normally forms double-strand by reverse complement • RNA: a string made from {A, C, G, U} – – – – – • Protein: made from 20 kinds of amino acids – – – – • mRNA: messenger RNA tRNA: transfer RNA Other types of RNA: rRNA, miRNA, etc. Has 5’ and 3’ Normally single-stranded. But can form secondary structure Actual worker in the cell Has N-terminal and C-terminal Sequence uniquely determined by its gene via the use of codons Sequence determines structure, structure determines function Central dogma: DNA transcribes to RNA, RNA translates to Protein – Both steps are regulated