Product datasheet Anti-PCDH1 antibody - N-terminal ab185340 1 Image Overview Product name Anti-PCDH1 antibody - N-terminal Description Rabbit polyclonal to PCDH1 - N-terminal Tested applications IHC-P Species reactivity Reacts with: Human Predicted to work with: Mouse, Rat Immunogen Recombinant fragment corresponding to Human PCDH1 aa 58-146 (N terminal). Sequence: TRVVYKVPEEQPPNTLIGSLAADYGFPDVGHLYKLEVGAPYLRVDGKTGD IFTTETSIDREGLRECQNQLPGDPCILEFEVSITDLVQN Database link: Q08174 Run BLAST with Positive control Run BLAST with Human stomach (lower) tissue Properties Form Liquid Storage instructions Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Storage buffer pH: 7.2 Preservative: 0.02% Sodium azide Constituents: 40% Glycerol, 59% PBS Purity Immunogen affinity purified Clonality Polyclonal Isotype IgG Applications Our Abpromise guarantee covers the use of ab185340 in the following tested applications. The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user. Application Abreviews Notes 1 Application Abreviews IHC-P Notes 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. Target Function May be involved in cell-cell interaction processes and in cell adhesion. Tissue specificity Highly expressed in the brain and neuro-glial cells. Sequence similarities Contains 7 cadherin domains. Developmental stage Highest expression in adults. Cellular localization Cell junction. Cell membrane. Found at cell-cell boundaries and probably at cell-matrix boundaries. Anti-PCDH1 antibody - N-terminal images Immunohistochemical analysis of paraffin embedded Human stomach (lower) tissue labeling PCDH1 with ab185340 at a 1/20 dilution. Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PCDH1 antibody (ab185340) Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE" Our Abpromise to you: Quality guaranteed and expert technical support Replacement or refund for products not performing as stated on the datasheet Valid for 12 months from date of delivery Response to your inquiry within 24 hours We provide support in Chinese, English, French, German, Japanese and Spanish Extensive multi-media technical resources to help you We investigate all quality concerns to ensure our products perform to the highest standards If the product does not perform as described on this datasheet, we will offer a refund or replacement. For full details of the Abpromise, please visit http://www.abcam.com/abpromise or contact our technical team. 2 Terms and conditions Guarantee only valid for products bought direct from Abcam or one of our authorized distributors 3