Product datasheet Recombinant Human CrkRS protein ab204102 1 Image Overview Product name Recombinant Human CrkRS protein Protein length Protein fragment Description Nature Recombinant Source Baculovirus infected sf9 cells Amino Acid Sequence Accession Q9NYV4 Species Human Sequence KEQRTRHLLTDLPLPPELPGGDLSPPDSPEPKAITPPQQPYKKRPKICCP RYGERRQTESDWGKRCVDKFDIIGIIGEGTYGQVYKAKDKDTGELVALKK VRLDNEKEGFPITAIREIKILRQLIHRSVVNMKEIVTDKQDALDFKKDKG AFYLVFEYMDHDLMGLLESGLVHFSEDHIKSFMKQLMEGLEYCHKKNFLH RDIKCSNILLNNSGQIKLADFGLARLYNSEESRPYTNKVITLWYRPPELL LGEERYTPAIDVWSCGCILGELFTKKPIFQANLELAQLELISRLCGSPCP AVWPDVIKLPYFNTMKPKKQYRRRLREEFSFIPSAALDLLDHMLTLDPSK RCTAEQTLQSDFLKDVELSKMAPPDLPHWQDCHELWSKKRRRQRQSGVVV EEPPPSKTSRKETTSGTSTEPVKNSSPAPPQPAPGKVESGAGDAIGLADI TQQLNQSELAVLLNLLQSQTDLSIPQMAQLLNIHSNPEMQQQLEALNQSI SALTEATSQQQDSETMAPEESLKEAPSAPVILPSAEQTTLEASSTPADMQ NILAVLLSQLMKTQEPAGSLEENNSDKNSGPQGPRRTPTMPQEEAAACPP HILPPEKRPPEPPGPPPPPPPPPLVEGDLSSAPQELNPAVTAALLQLLSQ PEAEPPGHLPHEHQALRPMEYSTRPRPNRTYGNTDGPETGFSAIDTDERN SGPALTESLVQTLVKNRTFSGSLSHLGESSSYQGTGSVQFPGDQDLRFAR VPLALHPVVGQPFLKAEGSSNSVVHAETKLQNYGELGPGTTGASSSGAGL HWGGPTQSSAYGKLYRGPTRVPPRGGRGRGVPY Molecular weight 135 kDa including tags Amino acids 658 to 1490 Tags GST tag N-Terminus Additional sequence information NM_016507. Specifications Our Abpromise guarantee covers the use of ab204102 in the following tested applications. 1 The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user. Applications SDS-PAGE Western blot Purity > 70 % Densitometry. Form Liquid Preparation and Storage Stability and Storage Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle. pH: 7.5 Constituents: 0.79% Tris HCl, 0.87% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.004% DTT, 0.002% PMSF, 25% Glycerol General Info Function Cyclin-dependent kinase that phosphorylates the C-terminal domain (CTD) of the large subunit of RNA polymerase II (POLR2A), thereby acting as a key regulator of transcription elongation. Regulates the expression of genes involved in DNA repair and is required for the maintenance of genomic stability. Preferentially phosphorylates 'Ser-5' in CTD repeats that are already phosphorylated at 'Ser-7', but can also phosphorylate 'Ser-2'. Required for RNA splicing, possibly by phosphorylating SRSF1/SF2. Involved in regulation of MAP kinase activity, possibly leading to affect the response to estrogen inhibitors. Tissue specificity Ubiquitously expressed. Involvement in disease Chromosomal aberrations involving CDK12 may be a cause gastric cancer. Deletions within 17q12 region producing fusion transcripts with ERBB2, leading to CDK12-ERBB2 fusion leading to trunctated CDK12 protein not in-frame with ERBB2. Sequence similarities Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily. Contains 1 protein kinase domain. Post-translational modifications Phosphorylation at Thr-893 increases kinase activity. Cellular localization Nucleus. Nucleus speckle. Colocalized with nuclear speckles throughout interphase. Recombinant Human CrkRS protein images 2 SDS-PAGE analysis of ab204102. SDS-PAGE - Human CrkRS protein fragment (ab204102) Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE" Our Abpromise to you: Quality guaranteed and expert technical support Replacement or refund for products not performing as stated on the datasheet Valid for 12 months from date of delivery Response to your inquiry within 24 hours We provide support in Chinese, English, French, German, Japanese and Spanish Extensive multi-media technical resources to help you We investigate all quality concerns to ensure our products perform to the highest standards If the product does not perform as described on this datasheet, we will offer a refund or replacement. For full details of the Abpromise, please visit http://www.abcam.com/abpromise or contact our technical team. Terms and conditions Guarantee only valid for products bought direct from Abcam or one of our authorized distributors 3