Product datasheet Recombinant Human NSD3 protein ab196390 1 Image Overview Product name Recombinant Human NSD3 protein Protein length Protein fragment Description Nature Recombinant Source E. coli Amino Acid Sequence Accession Q9BZ95 Species Human Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYI DGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGA VLDIRYGVSRIAYSKDFETLK VDFLSKLPEMLKMFEDRLCHKTYLNGD HVTHPDFMLYDALDVVLYMDPMCLDAFPKLV CFKKRIEAIPQIDKYLK SSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSEGDKS FAEGQT SINKTFKKALEEAAKRFQELKAQRESKEALEIEKNSRKPPPYKHIKANKV IG KVQIQVADLSEIPRCNCKPADENPCGLESECLNRMLQYECHPQVCP AGDRCQNQCF TKRLYPDAEIIKTERRGWGLRTKRSIKKGEFVNEYVGE LIDEEECRLRIKRAHENSVTN FYMLTVTKDRIIDAGPKGNYSRFMNHS CNPNCETQKWTVNGDVRVGLFALCDIPAGM ELTFNYNLDCLGNGRTEC HCGADNCSGFLGVRPKSACASTNEEKAKNAKLKQKRRK IKTEPKQMHE D Molecular weight 61 kDa including tags Amino acids 1021 to 1322 Tags GST tag N-Terminus Specifications 1 Our Abpromise guarantee covers the use of ab196390 in the following tested applications. The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user. Applications SDS-PAGE Purity >= 55 % by SDS-PAGE. Form Liquid Preparation and Storage Stability and Storage Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle. pH: 8.00 Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 20% Glycerol, 0.05% DTT, 0.49% Glutathione General Info Function Histone methyltransferase. Preferentially methylates 'Lys-4' and 'Lys-27' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation, while 'Lys-27' is a mark for transcriptional repression. Tissue specificity Highly expressed in brain, heart and skeletal muscle. Expressed at lower level in liver and lung. Involvement in disease Defects in WHSC1L1 may be involved in non small cell lung carcinomas (NSCLC). Amplified or overexpressed in NSCLC. A chromosomal aberration involving WHSC1L1 is found in childhood acute myeloid leukemia. Translocation t(8;11)(p11.2;p15) with NUP98. Sequence similarities Belongs to the class V-like SAM-binding methyltransferase superfamily. Histone-lysine methyltransferase family. SET2 subfamily. Contains 1 AWS domain. Contains 4 PHD-type zinc fingers. Contains 1 post-SET domain. Contains 2 PWWP domains. Contains 1 SET domain. Cellular localization Nucleus. Chromosome. Recombinant Human NSD3 protein images 4-20% SDS PAGE with Coomassie staining: 5.6 µg ab196390. SDS-PAGE - Human NSD3 protein fragment (ab196390) 2 Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE" Our Abpromise to you: Quality guaranteed and expert technical support Replacement or refund for products not performing as stated on the datasheet Valid for 12 months from date of delivery Response to your inquiry within 24 hours We provide support in Chinese, English, French, German, Japanese and Spanish Extensive multi-media technical resources to help you We investigate all quality concerns to ensure our products perform to the highest standards If the product does not perform as described on this datasheet, we will offer a refund or replacement. For full details of the Abpromise, please visit http://www.abcam.com/abpromise or contact our technical team. Terms and conditions Guarantee only valid for products bought direct from Abcam or one of our authorized distributors 3