Informational lesions: optical perturbation of spike timing
and neural synchrony via microbial opsin gene fusions
The MIT Faculty has made this article openly available. Please share
how this access benefits you. Your story matters.
Citation
Han X, Qian X, Stern P, Chuong AS and Boyden ES (2009).
Informational lesions: optical perturbation of spike timing and
neural synchrony via microbial opsin gene fusions. Front. Mol.
Neurosci. 2:12. doi: 10.3389/neuro.02.012.2009
As Published
http://dx.doi.org/10.3389/neuro.02.012.2009
Publisher
Frontiers Research Foundation
Version
Final published version
Accessed
Wed May 25 23:13:38 EDT 2016
Citable Link
http://hdl.handle.net/1721.1/58588
Terms of Use
Article is made available in accordance with the publisher's policy
and may be subject to US copyright law. Please refer to the
publisher's site for terms of use.
Detailed Terms
ORIGINAL RESEARCH ARTICLE
published: 27 August 2009
doi: 10.3389/neuro.02.012.2009
MOLECULAR NEUROSCIENCE
Informational lesions: optical perturbation of spike timing and
neural synchrony via microbial opsin gene fusions
Xue Han1,2,3, Xiaofeng Qian1,3, Patrick Stern 4, Amy S. Chuong1 and Edward S. Boyden1,2,3,5*
1
2
3
4
5
MIT Media Lab, Massachusetts Institute of Technology, Cambridge, MA, USA
Brain and Cognitive Sciences, Massachusetts Institute of Technology, Cambridge, MA, USA
McGovern Institute, Massachusetts Institute of Technology, Cambridge, MA, USA
Koch Center for Cancer Research, Massachusetts Institute of Technology, Cambridge, MA, USA
Biological Engineering, Massachusetts Institute of Technology, Cambridge, MA, USA
Edited by:
Jochen C. Meier, Max Delbrück Center
for Molecular Medicine, Germany
Reviewed by:
Miles A. Whittington,
Newcastle University, UK
Antoine Adamantidis, Stanford
University School of Medicine, USA
*Correspondence:
Edward S. Boyden, MIT Media Lab,
E15-430, 20 Ames St., Cambridge, MA
02139, USA.
e-mail: edboyden@mit.edu
Synchronous neural activity occurs throughout the brain in association with normal and
pathological brain functions. Despite theoretical work exploring how such neural coordination
might facilitate neural computation and be corrupted in disease states, it has proven difficult to
test experimentally the causal role of synchrony in such phenomena. Attempts to manipulate
neural synchrony often alter other features of neural activity such as firing rate. Here we evaluate
a single gene which encodes for the blue-light gated cation channel channelrhodopsin-2 and
the yellow-light driven chloride pump halorhodopsin from Natronobacterium pharaonis, linked
by a ‘self-cleaving’ 2A peptide. This fusion enables proportional expression of both opsins,
sensitizing neurons to being bi-directionally controlled with blue and yellow light, facilitating
proportional optical spike insertion and deletion upon delivery of trains of precisely-timed blue
and yellow light pulses. Such approaches may enable more detailed explorations of the causal
role of specific features of the neural code.
Keywords: optogenetics, channelrhodopsin-2, halorhodopsin, fusion protein, synchrony
INTRODUCTION
It has long been debated to what extent synchronous or preciselytimed neural activity contributes to neural computation and behavior. Synchronous neural activity within or between brain regions
has been observed during, or associated with, many brain functions including timing-dependent plasticity, global stimulus feature
processing, visuomotor integration, emotion, working memory,
motor planning, and attention (e.g., Gray et al., 1989; Roelfsema
et al., 1997; Brivanlou et al., 1998; Donoghue et al., 1998; Steinmetz
et al., 2000; Fries et al., 2001; Tallon-Baudry et al., 2001; Froemke
and Dan, 2002; Perez-Orive et al., 2002; Seidenbecher et al., 2003;
Courtemanche and Lamarre, 2004; Buschman and Miller, 2007),
as measured with multielectrode recording, electroencephalography (EEG), magnetoencephalography (MEG), and local field
potential (LFP) analysis. Furthermore, abnormal patterns of neural synchrony have been associated with a variety of neurological and psychiatric disorders such as Parkinson’s disease, epilepsy,
autism, and schizophrenia (e.g., Bragin et al., 2002; Uhlhaas and
Singer, 2006; Berendse and Stam, 2007; Brown, 2007; Huguenard
and McCormick, 2007; Orekhova et al., 2007; Gonzalez-Burgos and
Lewis, 2008; Roopun et al., 2009). Computationally, synchrony has
been implicated in multiple processes, including grouping neurons
into ‘cell assemblies’ that can more effectively represent information to downstream neural networks, acting as a clock for gating or multiplexing information, coordinating information flow
within small neural networks, selecting stimuli for attention, and
performing pattern recognition (e.g., Hopfield and Brody, 2001;
Friedrich et al., 2004; Tiesinga and Sejnowski, 2004; Borgers et al.,
2005, 2008; Sohal et al., 2009). However, determining the causal
Frontiers in Molecular Neuroscience
role of neural synchrony to neural computation and behavior has
remained elusive, in part because selective perturbation of spike
timing is difficult. In some specific systems, in which pharmacological or genetic strategies for selectively disrupting synchrony
happened to be compatible with local cellular and network properties, pioneering attempts have been made to perturb spike timing
without altering other aspects of neural coding such as spike rate
(MacLeod and Laurent, 1996; Bao et al., 2002; Robbe et al., 2006),
but no generalized method for doing so exists.
Recently we and others have developed strategies for optically
sensitizing neurons to being activated and silenced with different colors of light, by delivering the gene encoding for the blue
light-gated cation channel channelrhodopsin-2 (ChR2) or the gene
for the yellow-light driven chloride pump halorhodopsin from
N. pharaonis (Halo/NpHR) to neurons, and illuminating them
with pulses of light (Boyden et al., 2005; Han and Boyden, 2007;
Zhang et al., 2007). New neural activators and silencers continue
to be developed, and these molecules have already begun to be
applied to the study of neural dynamics, as investigators optically drive the activity of excitatory and inhibitory neurons and
electrophysiologically characterize the resultant patterns (e.g.,
Boyden et al., 2009; Cardin et al., 2009; Han et al., 2009; Sohal
et al., 2009; Talei Franzesi et al., 2009). However, none of these
experiments have attempted to isolate the distinct properties of
synchrony and spike rate, both of which are modulated when
neurons are activated or silenced by using either ChR2 or Halo
by itself. Previously, we presented a strategy for perturbing spike
timing without altering spike rate (Han and Boyden, 2007), taking
advantage of the fact that the spectral peaks for ChR2 activation
www.frontiersin.org
August 2009 | Volume 2 | Article 12 | 1
Han et al.
Molecules for optical information control
and Halo activation are separated by over 100 nm (Figure 1A),
making it possible to express both molecules in the same neuron
(Figure 1B), thus conferring bi-directional control of the voltage
of that neuron by blue and yellow light (Figures 1C,D) (Han and
Boyden, 2007). As a consequence of this two-color bidirectional
voltage control, precisely-timed blue and yellow light pulse trains,
delivered to a neuron expressing both ChR2 and Halo, can be used
to insert spikes into, and delete spikes from, the ongoing activity experienced by that neuron (Figure 1E), resulting in precise
perturbations of spike timing without changing overall spike rate
(Figures 1F,G). However, the delivery of two separate genes to
precisely the same cell population can be a daunting proposition.
Furthermore, it is important that ChR2 and Halo be expressed
in a predictable proportion to one another, so that the insertion
and deletion of spikes can be balanced; separate delivery of the
two genes, or independent expression of the two genes, would
not accomplish this. Recently we and others have presented gene
fusions between ChR2 and Halo that enable them to be expressed
in the same expression cassette, bridging ChR2 and Halo with an
optimized form of the ‘self-cleaving’ 2A peptide sequence from
foot-and-mouth disease virus or other picornaviruses (Han et al.,
2008; Tang et al., 2009). The 2A sequence encourages a ribosomal
skip between a glycine and proline within the 2A sequence, resulting in separate proteins being formed from the sequences on either
side (Ryan et al., 1991; Ryan and Drew, 1994). In the Tang et al.
paper, the first peer-reviewed presentation of opsin fusions using
a 2A peptide bridge, the authors showed functional expression of
both opsins in the same cell, in vivo, after delivery via AAV. We here
quantitate the proportional expression of ChR2 and Halo in the
same cell when they are expressed separated by a 2A bridge, and
discuss the consequences for the specific difficult experimental goal
of perturbing synchrony and precise spike timing. Such proteins
will also be useful for exploring a large set of systems neuroscience
experiments in which bi-directional control of the activity of a
given neuron population is desired.
MATERIALS AND METHODS
CELL CULTURE
All procedures involving animals were conducted in accordance
with the National Institutes of Health Guide for the care and use of
laboratory animals and approved by the Massachusetts Institute
of Technology Animal Care and Use Committee. Hippocampal
regions CA3-CA1 of postnatal day 0 Swiss Webster or C57 mice
from Taconic or Jackson Labs were isolated and treated with
trypsin (1 mg/ml) for ∼12 min. Digestion was stopped by Hanks
solution supplemented with 20% fetal bovine serum and trypsin
inhibitor (Sigma). Tissue was dissociated with Pasteur pipettes
and centrifuged at 1000 rpm at 4°C for 10 min. Dissociated neurons were plated on glass coverslips pre-coated with Matrigel
(BD Biosciences) at a rough density of approximately two to four
hippocampi per 20 coverslips. Neurons were transfected using
a commercially available calcium phosphate transfection kit
(Invitrogen), at 3–5 days in vitro. GFP fluorescence was used to
identify successfully-transfected neurons, indicating a net transfection efficiency of 1–10%. All images and electrophysiological
recordings were made on 9–15 day-in-vitro neurons (approximately 6–10 days after transfection).
Frontiers in Molecular Neuroscience
MOLECULAR BIOLOGY
The ChR2GFP-2A-HaloYFP-N1 plasmid (‘ChR2-2A-Halo’)
was constructed by first inserting the extended N-terminus 2A
sequence (DNA sequence AAGAAACAGAAAATTGTGGCACC
AGTGAAACAGACTTTGAATTTTGACCTTCTCAAGTTGGCG
GGAGACGTCGAGTCCAACCCTGGGCCC, translated peptide
sequence KKQKIVAPVKQTLNFDLLKLAGDVESNPGP) into the
BsrGI and NotI sites in the pEGFP-N1 vector, followed by inserting
ChR2-GFP without stop codon into the KpNI and BsrGI sites in
front of the 2A sequence, and then by inserting Halo-YFP without
start codon into the XbaI and EcoRI sites downstream of the 2A
sequence. The pEGFP-N1 vector drives gene expression from the
CMV promoter.
ELECTROPHYSIOLOGY
Whole cell patch clamp recording was made on 9–15 day-in-vitro
neurons using a Multiclamp 700B amplifier, connected to a Digidata
1440 digitizer (Molecular Devices) attached to a PC running pClamp
10. During recording, neurons were bathed in Tyrode’s solution
containing (in mM) 150 NaCl, 2.4 KCl, 2 CaCl, 2 MgCl, 10 HEPES,
10 Glucose, 10 µM NBQX, 10 µM gabazine and 50 µM D-APV.
Borosilicate glass (Warner) pipettes were filled with a solution
containing (in mM) 130 K-Gluconate, 7 KCl, 2 NaCl, 1 MgCl2, 0.4
EGTA, 10 HEPES, 2 ATP-Mg, 0.3 GTP-Tris and 20 sucrose. Pipette
resistance was ∼5 MΩ and the access resistance was 10–25 MΩ,
which was monitored throughout the voltage-clamp recording.
Light-induced membrane photocurrents were induced by brief
light pulses separated by periods in the dark, in neurons currentclamped or voltage-clamped, respectively. Light pulse trains were
either input directly into pClamp software (Molecular Devices) or
synthesized by custom scripts written in MATLAB (Mathworks),
then played back through a Sutter DG-4 light source via a Digidata
1440 (Molecular Devices). Light was reflected into the sample
off of a 700DCXRU (Chroma) dichroic in a Leica DMI6000B
inverted microscope. In the DG-4, a yellow filter (Chroma, bandpass 575 ± 25 nm) was used to deliver light to activate Halo, and a
GFP excitation filter (bandpass 470 ± 20 nm) was used to activate
ChR2. Powers out the 40× objective were approximately 10 mW/
mm2 in irradiance.
DATA ANALYSIS
Amplitude and timing data were analyzed using Clampfit 10
(Molecular Devices) and custom analysis scripts written in
MATLAB.
RESULTS
We recently presented a demonstration of how one could use coexpression of separate ChR2 and Halo genes to support optical
disruption of the timing of spikes, without significant alteration
of spike rate (Figure 1, adapted from Han and Boyden, 2007). In
review of this previously-published work (see Han and Boyden,
2007 for detailed results and methods): we cultured hippocampal
neurons and then caused them to fire precisely-timed spike trains
by patch clamping them in current-clamp mode, and repeatedly
delivering to each neuron the same filtered Gaussian white noise
current trace (see Figure 1Ei, top, for a fragment thereof). Such
noisy currents had been previously found to induce reliable spike
www.frontiersin.org
August 2009 | Volume 2 | Article 12 | 2
Han et al.
Molecules for optical information control
FIGURE 1 | Schema for how to alter neural spike timing, using two-color
illumination of neurons co-transfected with both ChR2 and Halo in a 1:1
ratio. Adapted from (Han and Boyden, 2007). (A) Action spectrum for ChR2
(blue, adapted from Nagel et al., 2003), overlaid with absorption spectrum for
Halo (orange, adapted from Duschl et al., 1990). Each spectrum is normalized
to its own peak, for ease of comparison. (B) Co-expression of Halo-GFP (left)
and ChR2-mCherry (middle) in a single neuron expressing both (right, overlay).
Scale bar, 20 µm. (C) Hyperpolarization and depolarization events elicited in a
single representative neuron, by two interleaved 2.5 Hz trains of yellow and
blue light pulses (50 ms duration each), denoted by bars of respective
coloration below the trace. (D) Hyperpolarization and depolarization events
induced in a representative neuron by a Poisson train (mean inter-pulse interval
λ = 100 ms) of alternating pulses of yellow and blue light (10 ms duration),
denoted by bars of respective coloration below the trace. (E) Optical disruption
of spike timing, without alteration of spike rate, for a representative currentclamped hippocampal neuron transfected simultaneously with ChR2 and Halo
in vitro. Vertical boxes (labeled at bottom 1, 2, 3) highlight features referred to
in the text of the Results. (i) Stimulus trace showing a subsegment of the
Frontiers in Molecular Neuroscience
somatically injected filtered Gaussian white noise current used in all these
experiments (top), as well as of the Poisson train (mean inter-pulse interval
λ = 100 ms) of alternating yellow and blue light pulses (bottom). (ii) 20-trace
overlays of voltage responses to the somatically injected white noise current,
either with no light (top, black traces) or with delivery of a Poisson train of
yellow and blue light pulses (bottom, green traces). (iii) Spike raster plots for
the traces shown in (Eii). (iv) Spike-timing histograms (bin size: 500 µs) for the
rasters shown in (Eiii). (F) Spike rates of current-clamped hippocampal
neurons transfected simultaneously with ChR2 and Halo in vitro (n = 7),
injected with filtered Gaussian white noise current, either with no light (left) or
with concurrent delivery of a Poisson train of yellow and blue light pulses
(right). Plotted is mean ± standard error. (G) Cross-correlation between spike
trains elicited by the same filtered Gaussian white noise current injection,
played twice, when either both current injections were performed in the dark
(black curve), or when one of the current injections was performed with
concurrent delivery of a Poisson train of yellow and blue light pulses (green
trace). Data is plotted as mean ± standard error (averaged across n = 7
neurons).
www.frontiersin.org
August 2009 | Volume 2 | Article 12 | 3
Han et al.
Molecules for optical information control
trains in current-clamped neurons in acute cortical brain slices
(Mainen and Sejnowski, 1995). On some trials, we also illuminated the neuron with the Poisson train of alternating yellow and
blue light pulses shown in Figure 1D (see Figure 1Ei, bottom).
We found that when delivered alone, the filtered Gaussian white
noise current trace indeed induced reliably-timed spike trains,
across repeated trials (see Figure 1Eii, top, for 20 overlaid traces,
and Figure 1Eiii, top, for corresponding spike rasters). When an
optically-sensitized neuron was additionally driven by the Poisson
train of yellow and blue light pulses, the neuron fired spikes with
different timings than occurred in darkness, but the resultant
spikes were nevertheless still similar across repeated trials of current injection + light illumination (see Figure 1Eii, bottom, and
Figure 1Eiii, bottom, for overlaid traces and spike rasters respectively, for 20 trials; Figure 1Eiv shows spike histograms). Inspection
of this data shows that relative to the spike train elicited by current
injection alone, the Poisson train of light pulses could sometimes
abolish spikes that were previously reliable (vertical box 1 spanning Figures 1Ei–iv), create new spikes which were not previously
present (vertical box 2 spanning Figures 1Ei–iv), or advance or
delay the timing of specific spikes relative to their original timing
in the dark (vertical box 3 spanning Figures 1Ei–iv). We compared
mean spike rates for neurons receiving the filtered Gaussian white
noise current injection alone vs. with the additional Poisson light
pulse train, and found no difference in spike rates for these two
conditions (p > 0.90, t-test; n = 7 neurons; Figure 1F), indicating that our optical intervention preserved spike rate. However,
precise spike timing was altered significantly: cross-correlations
of the spike trains elicited from the filtered Gaussian white noise
current injection alone vs. with the additional Poisson light pulse
train resulted in zero-lag cross-correlations that were on average 37% smaller than cross-correlations of pairs of spike trains
elicited from the filtered Gaussian white noise current injection
alone (p < 0.005, n = 7 neurons). This indicates that precise spike
timing was indeed disrupted by the activation of Halo and ChR2,
even while spike rate was preserved.
The strategy illustrated in Figure 1 centers around the idea of
using blue light to push the voltage of a cell over spike threshold,
and using yellow light to push the voltage of a cell under spike
threshold. Critical to this strategy is the proportional expression
of ChR2 and Halo in a predictable ratio to one another. Ideally,
for every spike inserted, another will be deleted. A neuron that
expresses high levels of both ChR2 and Halo will have a high probability of generating a spike in response to a blue light pulse, but
will also have a high probability of losing a spike in response to a
yellow light pulse. On the other hand, a neuron that expresses low
levels of both ChR2 and Halo will have a low probability of generating a spike in response to a blue light pulse, but will also have
a lower probability of losing a spike in response to a yellow light
pulse. Thus to a first approximation, the strategy in Figure 1 should
work to disrupt spike timing but not spike rate, independent of the
net expression levels of ChR2 and Halo, as long as their proportion
is kept constant. Of course, this approximation will break down
if the scenario approaches an extreme: for example, a high-firing
rate neuron may not be responsive to blue light pulses because of
a ceiling effect on firing rate, but may be greatly affected by yellow
pulses; on the other hand, a low-firing rate neuron may respond to
Frontiers in Molecular Neuroscience
blue light pulses with increased spiking, but may have few spikes to
lose when yellow light pulses arrive. Thus it will be important to
choose light pulse trains that deliver light pulses at appropriate rates
given the neural population under investigation; the light pulse rate
should scale with the firing rate of the neural population (and in
principle, could even be adapted in real time during a physiology
or behavior experiment). Two further comments should be made:
given that ChR2 and Halo generate intrinsically different scales of
currents (ChR2’s peak currents are an order of magnitude greater
than Halo’s), the ratio of blue to yellow light powers may need to
be adjusted to balance the current magnitudes against one another.
Finally, in the intact brain in vivo, light powers will fall off with
distance from the light source; however, the difference between
blue and yellow light power attenuation in brain tissue is not very
large over the short distances (∼1 mm) utilized for in vivo optical
control scenarios, which are significantly less than the absorption
length constant of visible light in tissue (Bernstein et al., 2008b).
Tiling the brain with arrays of LED- or laser-coupled optical fibers may allow for more even light distribution in the brain, than
possible with just one inserted fiber (Bernstein et al., 2008a; Zorzos
et al., 2009).
To express both ChR2 and Halo in a stoichiometric ratio, we evaluated a number of candidate strategies. Using two viruses to deliver
the two genes could lead to significant variation of the ChR2/Halo
ratio across cells. Placing an internal ribosome entry site (IRES) – a
long sequence of several hundred base pairs, large compared to the
space accorded in many kinds of viral vector – in between two genes
often results in much lower expression of the second gene (levels
0–20% those of the first gene) (Mizuguchi et al., 2000; Hennecke
et al., 2001; Yu et al., 2003; Osti et al., 2006). We decided upon a
methodology using the ‘self-cleaving’ 2A sequence (Figure 2A)
from foot-and-mouth disease virus (Ryan et al., 1991; Ryan and
Drew, 1994). When an mRNA encoding for ChR2-2A-Halo is being
translated, a specific Gly-Pro bond in the 2A sequence would not
be enduringly formed by the ribosome (a ‘ribosomal skip’), resulting in the separate translation of ChR2 and Halo into separate
proteins. We utilized a variant of 2A with additional amino acids
appended to the N-terminus which enhances cleavage from 90%
to 96–99% (as assessed by an in vitro translation assay) (Donnelly
et al., 2001a,b) (Figure 2A, blue and green colored residues). The
use of a different 2A peptide to co-express channelrhodopsin-2
and halorhodopsin within a single gene was recently published,
including proof-of-principle electrophysiological data resulting
from in vivo infection of neurons with the resulting virus (Tang
et al., 2009). Here, expression of the ChR2-2A-Halo gene by transfection in cultured hippocampal neurons resulted in excitatory
and inhibitory photocurrents in response to blue and yellow light
respectively. The photocurrents were smaller than would result
from expression of either gene alone (Figure 2C), in part because
of overlap in the two molecules’ action spectra (Figure 1A). Bluelight elicited photocurrents, measured in voltage clamp mode, were
157 ± 63 pA (n = 22 neurons; mean ± standard deviation), ∼30%
of the value previously reported for raw ChR2 expression in cultured hippocampal neurons (Boyden et al., 2005), and yellow-light
elicited photocurrents were 40 ± 24 pA, ∼45% of the value previously reported for raw Halo expression in cultured hippocampal
neurons (Han and Boyden, 2007). These currents, nevertheless,
www.frontiersin.org
August 2009 | Volume 2 | Article 12 | 4
Han et al.
Molecules for optical information control
FIGURE 2 | Gene fusion enabling proportional co-expression of ChR2 and
Halo under a single promoter. (A) Schematic of the gene fusion ChR2-2A-Halo,
highlighting the sequence of the 2A peptide here used. Red letters indicate
consensus sequence for 2A-like ribosomal skip sequence (Donnelly et al., 2001a;
de Felipe et al., 2006); blue letters indicate amino acids from the 1D peptide
sequence that, when appended to the N-terminus of the 2A sequence, increase
in vitro-translated protein cleavage from 90% to 96%, and green letters are part
of a sequence from the 1D peptide sequence that boosts in vitro-translated
protein cleavage to 99–100% levels (Donnelly et al., 2001a,b). (B)
are sufficient to cause a neuron near the threshold of spiking to
fire an action potential or to be momentarily silent, and routinely
resulted, in current-clamped neurons, in effective perturbations
of membrane voltage by 5–10 mV (Figure 2B). Plotting, for each
recorded neuron, the blue-light elicited photocurrents vs. the yellow-light elicited photocurrents yielded a significant linear relationship with correlation coefficient r = 0.51 (R2 = 0.26, p < 0.02;
Figure 2D). Thus, the 2A expression vector here utilized was able
to mediate proportional, functional expression of ChR2 and Halo
in the same cell.
What kinds of experiment are enabled by the use of linked
microbial opsins for bi-directional control of the voltage of individual neurons? Many ‘obvious’ but much-desired experiments
Frontiers in Molecular Neuroscience
Hyperpolarization and depolarization events induced in a representative currentclamped hippocampal neuron in vitro, transfected with ChR2-2A-Halo, by a
Poisson train (mean inter-pulse interval λ = 100 ms) of alternating pulses of
yellow and blue light (10 ms duration), denoted by bars of respective coloration
below the trace. (C) Peak photocurrents measured in voltage clamped ChR2-2AHalo-expressing cultured hippocampal neurons under 1-s blue (left) or yellow
(right) exposure (n = 22 neurons; bars represent mean ± standard deviation).
(D) Plot of magnitude of blue light-elicited photocurrents vs. magnitude of yellow
light-elicited photocurrents. Line shows linear regression fit to the plotted data.
may be facilitated with use of this reagent. For example, by
appending to ChR2 a myosin-binding domain (MBD) that preferentially targets it to cell bodies and dendrites (Lewis et al., 2009),
the resultant ChR2-MBD-2A-Halo could enable activation of a
population of neurons when their cell bodies are illuminated with
blue light, as well as silencing of specific projections when their
axonal terminals are illuminated with yellow light. The ability to
guarantee that a single population of neurons can be both activated and silenced is itself valuable, enabling testing of necessity
and sufficiency of the same population of neurons, to a specific
neural computation or behavior. However, it is useful to explore
conceptually how this technology might be useful for probing
complex questions concerning synchrony. We have, in Figure 3,
www.frontiersin.org
August 2009 | Volume 2 | Article 12 | 5
Han et al.
Molecules for optical information control
FIGURE 3 | Synchrony- and spike timing-perturbation protocols, enabled
by use of ChR2-2A-Halo. Each of the four panels (A–D) displays a schematic
experimental protocol (i) along with the anticipated effect of the protocol on
neural circuit dynamics (ii). An example is given for each of four kinds of
experiment – (A) open-loop/one site, (B) closed-loop/one site, (C) open-loop/two
sites, (D) closed-loop/two sites. Detailed descriptions of each panel follow.
(A) Shows the use of Poisson train light pulse delivery to a site in which
rhythmically-firing neurons express ChR2-2A-Halo. This protocol results in the
interspike interval (ISI) becoming more variable than in the unilluminated state.
(i) From top to bottom: spike train trace (for one example neuron) in dark;
timeline of when yellow or blue light is delivered; spike train trace (for the
example neuron) in light (e.g., the result of combining the original case, shown
at top, with the delivery of light, shown in the middle). (ii) From top to bottom:
ISI histogram in dark; ISI histogram in light. (B) Shows the use of optical
perturbation in a closed-loop fashion, triggering blue-yellow pairs of light pulses
off of particular recorded spikes in order to make the spike train more bursty.
(i) From top to bottom: spike train trace in dark; timeline of when yellow or blue
light is delivered (in this case, each blue-yellow pair is triggered by a spike; each
trigger is indicated by an arrow); spike train trace under the closed-loop protocol.
(ii) From top to bottom: ISI histogram in dark; ISI histogram under the closedloop protocol. (C) Shows the use of optical perturbation in the style of (Ai), with
light delivered to one site to disrupt the timing of activity at that site, relative to
Frontiers in Molecular Neuroscience
another site, which is left unilluminated. (i) From top to bottom: spike train traces
recorded at two sites in the dark; timeline of when yellow or blue light is
delivered to one of the sites while the other is kept in the dark; spike train traces
in light. (ii) From top to bottom: spike-spike coherence (see Fries et al., 2008 for
experimental examples of this measure) across the two areas plotted vs. spike
frequency, measured in dark; spike-spike coherence across the two areas
plotted vs. spike frequency, measured when one site is illuminated. (D) Shows
the use of optical perturbation in a closed-loop fashion, triggering yellow-blue
pairs of light pulses at one site, off of a feature of the local field potential (LFP)
recorded at another site, which is left unilluminated. In this case, the trough of
the LFP (bandpass filtered to yield a defined set of frequencies) at the second
site serves as the trigger for delaying spikes at the first site. (i) From top to
bottom: spike train trace and local field potential trace recorded at two separate
sites; timeline of when yellow or blue light is delivered to the site from which
spikes are recorded (in this case, each yellow-blue pair is triggered by the trough
of the LFP at the second site; each trigger is indicated by an arrow); spike train
trace and local field potential trace under the closed-loop protocol. (ii) From top
to bottom: phase relationship between spikes recorded at the first site and local
field potential troughs recorded at the second site, in the dark (e.g., see Pesaran
et al., 2002; Gregoriou et al., 2009) for examples of this kind of data); phase
relationship between spikes recorded at the first site and local field potential
troughs recorded at the second site, under the closed-loop protocol.
www.frontiersin.org
August 2009 | Volume 2 | Article 12 | 6
Han et al.
Molecules for optical information control
outlined in schematic form four protocols enabling perturbation
of spike timing or synchrony, in order to study their contribution
to circuit output. In all four cases, appropriately-timed blue and
yellow light pulses are used to disrupt the timing of spikes in a
region containing neurons sensitized to light with a 2A construct,
thus altering the spike statistics. Because light will be delivered to
all the neurons within a defined region, one caveat may apply:
the optically-sensitized neurons in the region will be exposed
to the same temporal pattern of blue and yellow light, and this
common input may alter (e.g., increase) the synchrony between
optically-sensitized neurons within the illuminated region; this
may potentially complicate experiments where altered synchrony
within a region is undesired, although again the use of multiple
light sources to deliver multiple light patterns to a single region
may ameliorate this issue.
One protocol is a direct generalization of the strategy outlined in Figure 1, the delivery of a light pulse train to a brain
region to increase interspike interval (ISI) variability, turning
rhythmic neurons into irregularly-firing ones (Figure 3A). This
‘informational lesion’ might enable the deletion of the information encoded by the precision of spiking of those cells, without
eliminating all activity generated by those cells, and thereby causing a gross disruption of connected circuits (as might occur with
a conventional lesion of the cells of interest). A slightly more complex version of this idea is illustrated in Figure 3B, in which light
pulses are precisely triggered, in a closed-loop fashion, upon the
occurrence of particular recorded spikes, so that the neuronal firing rate becomes more bursty (but, once again, without changing
overall spike rates). The ability to test the role of bursting in spike
signaling may help resolve how the temporal integration properties of neural circuit elements contribute to neural computations.
The 2A strategy can also be used to disrupt correlations between
multiple regions that exhibit synchrony (Figure 3C), making spike
timing more variable in one region so that its activity correlation with activity in a second region decreases, or making spike
timing more variable in one region to see if such activity causally influences the activity within the second region. In this way
it might be possible to understand how regions communicate
and process information together in a coordinated fashion. As a
final example, the multi-site experiment can also be performed
in a closed-loop fashion (Figure 3D), triggering the delivery of a
specific light pulse train to one region, upon a particular phase
of the local field potential (LFP) recorded in a second region, and
thus phase shifting spike times in the first region with respect to
the LFP of the second. Many other possible protocols exist; the
key advance enabled by the 2A construct in such protocols is the
ability to lesion information or alter information in the brain,
without grossly disrupting the spike rate, as happens with traditional lesions, some forms of pharmacology, or normal activation
or silencing of neurons.
DISCUSSION
We here discuss the implications of gene fusions of ChR2 and
Halo, linked by the ‘self-cleaving’ 2A peptide, capable of supporting cellular synthesis of both opsins in proportion to one another,
towards enabling a set of neurons to be simultaneously sensitized
Frontiers in Molecular Neuroscience
to blue light activation and yellow-light silencing. As an example
of computational neuroscience-driven molecular engineering, such
reagents may enable novel kinds of perturbation, such as the disruption of spike timing in the absence of altering spike rate. The
construct presented here is freely available from the nonprofit service Addgene (reagent ‘ChR2-2A-Halo’ at http://www.addgene.org/
Edward_Boyden) and is ready for use for transfection, gene gunning
(Zhang et al., 2008), transgenic implementation (Wang et al., 2007),
or electroporation (Petreanu et al., 2007; Lagali et al., 2008). The
current construct, ChR2-2A-Halo yielded, when transfected into
neurons, blue- and yellow-light elicited currents that were 30–40%
of those obtained when ChR2 or Halo were expressed alone, respectively. Another paper that recently also disclosed the use of a 2A
bridge to co-express ChR2 and Halo also showed currents that were
smaller than those resulting from expression of individual opsins
alone (Tang et al., 2009). These are still useful currents, especially
if the goal is to dither the activity of a neuron above and below
spike threshold in order to add and subtract spikes (as opposed to
strongly driving or inhibiting neurons); however, a question for
any technology is whether the efficacy can be improved further.
One solution would be to use stronger opsins to begin with, such
as novel molecules like ChIEF (Lin et al., 2009) and Arch (Chow
et al., 2009a,b), which can mediate functionally higher currents
than ChR2 and Halo, respectively. Other methods for expressing
two genes also exist: for example, bi-directional promoters can
lead to higher expression levels than can 2A, but at the expense
of significantly more variability in the ratio of the protein levels
resulting from each gene (e.g., see Fig. 3A in Amendola et al., 2005),
due to the greater chance for noise to creep in downstream of the
stoichiometry-determining event.
The prospects for using optical control technologies for ultraprecise neuromodulation therapies in clinical settings are exciting,
since precise activation and silencing of specific cell types may
increase efficacy and reduce side effects of treatments relative to
purely electrical methods. However, it is important to consider not
just straightforward optical activation and silencing, but also complex perturbations such as desynchronization as here described,
which could enable correction of neural dynamics abnormalities
such as those found in neurological and psychiatric disorders like
Parkinson’s and epilepsy. As pre-clinical studies of the safety and
efficacy of optical control technology begin (Han et al., 2009), it
will be increasingly important to derive principles of neural control, prototyping novel therapies that take full advantage of the
computational power of these new technologies.
ACKNOWLEDGMENTS
ESB acknowledges funding by the NIH Director’s New Innovator
Award (DP2 OD002002-01), as well as by the NSF (0835878
and 0848804), the McGovern Institute Neurotechnology Award
Program, the Department of Defense, NARSAD, the Alfred P.
Sloan Foundation, the Jerry Burnett Foundation, the SFN Research
Award for Innovation in Neuroscience, the MIT Media Lab, the
Benesse Foundation, and the Wallace H. Coulter Foundation.
XH acknowledges the Helen Hay Whitney Foundation and NIH
1K99MH085944. Thanks to Jennifer Raymond and Bob Desimone
for discussions.
www.frontiersin.org
August 2009 | Volume 2 | Article 12 | 7
Han et al.
REFERENCES
Amendola, M., Venneri, M. A., Biffi, A.,
Vigna, E., and Naldini, L. (2005).
Coordinate dual-gene transgenesis
by lentiviral vectors carrying synthetic bidirectional promoters. Nat.
Biotechnol. 23, 108–116.
Bao, S., Chen, L., Kim, J. J., and
Thompson, R. F. (2002). Cerebellar
cortical inhibition and classical eyeblink conditioning. Proc. Natl. Acad.
Sci. U.S.A. 99, 1592–1597.
Berendse, H. W., and Stam, C. J. (2007).
Stage-dependent patterns of disturbed
neural synchrony in Parkinson’s disease. Parkinsonism Relat. Disord.
13(Suppl. 3), S440–S445.
Bernstein, J., Ko, E., Strelzoff, A.,
Chan, S. C. Y., Gidwane y, V.,
Stickgold, E., Tentori, A. M.,
(Henninger, M. A., listed as first author
since sponsor of poster), McConnell, J.,
Rodriguez, A., Monahan, P. A., Talei
Franzesi, G., Han, X., Qian, X., and
Boyden, E. S. (2008a). A scalable
toolbox for systematic, cell-specific
optical control of entire 3-D neural
circuits in the intact mammalian
brain. Soc. Neurosci. 493.4, UU25.
Bernstein, J. G., Han, X., Henninger, M. A.,
Ko, E. Y., Qian, X., Franzesi, G. T.,
McConnell, J. P., Stern, P., Desimone, R.,
and Boyden, E. S. (2008b). Prosthetic
systems for therapeutic optical activation and silencing of geneticallytargeted neurons. Proc. Soc. Photo Opt.
Instrum. Eng. 6854, 68540H.
Borgers, C., Epstein, S., and Kopell, N. J.
(2005). Background gamma rhythmicity and attention in cortical
local circuits: a computational study.
Proc. Natl. Acad. Sci. U.S.A. 102,
7002–7007.
Borgers, C., Epstein, S., and Kopell, N. J.
(2008). Gamma oscillations mediate stimulus competition and attentional selection in a cortical network
model. Proc. Natl. Acad. Sci. U.S.A.
105, 18023–18028.
Boyden, E., Franzesi, G. T., Qian, X., Li, M.,
Han, X., Borgers, C., Kopell, N. J., Le
Beau, F., and Whittington, M. A.
(2009). Probing mechanisms of
gamma rhythmogenesis with cell
type-specific optical neural control.
Front. Syst. Neurosci. Conference
Abstract: Computational and Systems
Neuroscience. doi: 10.3389/conf.
neuro.3310.2009.3303.3299.
Boyden, E. S., Zhang, F., Bamberg, E.,
Nagel, G., and Deisseroth, K. (2005).
Millisecond-timescale, genetically targeted optical control of neural activity.
Nat. Neurosci. 8, 1263–1268.
Bragin, A., Wilson, C. L., Staba, R. J.,
Reddick, M., Fried, I., and Engel, J., Jr.
(2002). Interictal high-frequency
oscillations (80–500 Hz) in the human
Frontiers in Molecular Neuroscience
Molecules for optical information control
epileptic brain: entorhinal cortex. Ann.
Neurol. 52, 407–415.
Brivanlou, I. H., Warland, D. K., and
Meister, M. (1998). Mechanisms of
concerted firing among retinal ganglion cells. Neuron 20, 527.
Brown, P. (2007). Abnormal oscillatory
synchronisation in the motor system
leads to impaired movement. Curr.
Opin. Neurobiol. 17, 656–664.
Buschman, T. J., and Miller, E. K. (2007).
Top-down versus bottom-up control
of attention in the prefrontal and
posterior parietal cortices. Science
315, 1860–1862.
Cardin, J. A., Carlen, M., Meletis, K.,
Knoblich, U., Zhang, F., Deisseroth, K.,
Tsai, L. H., and Moore, C. I. (2009).
Driving fast-spiking cells induces
gamma rhythm and controls sensory
responses. Nature, 459, 663–667.
Chow, B., Han, X., Qian, X., and
Boyden, E. S. (2009a). Hig hp e r f o r m a n ce h a l o r h o d o p s i n
variants for improved geneticallytargetable optical neural silencing.
Front. Syst. Neurosci. Conference
Abstract: Computational and Systems
Neuroscience. doi: 10.3389/conf.
neuro.10.2009.03.347.
Chow, B., Han, X., Qian, X., Li, M.,
Chuong, A. S., Monahan, P. E.,
Dobry, A. S., and Boyden, E. S.
(2009b). High-efficacy, temporallyprecise, in vivo neural silencing via
light-driven proton pumping. Soc.
Neurosci. 338.2, GG97.
Courtemanche, R., and Lamarre, Y.
(2004). Local field potential oscillations in primate cerebellar cortex:
synchronization with cerebral cortex
during active and passive expectancy.
J. Neurophysiol. 93, 2039–2052.
de Felipe, P., Luke, G. A., Hughes, L. E.,
Gani, D., Halpin, C., and Ryan, M. D.
(2006). E unum pluribus: multiple proteins from a self-processing
polyprotein. Trends Biotechnol. 24,
68–75.
Donnelly, M. L., Hughes, L. E., Luke, G.,
Mendoza, H., ten Dam, E., Gani, D.,
and Ryan, M. D. (2001a). The ‘cleavage’
activities of foot-and-mouth disease
virus 2A site-directed mutants and
naturally occurring ‘2A-like’ sequences.
J. Gen. Virol. 82, 1027–1041.
Donnelly, M. L., Luke, G., Mehrotra, A.,
Li, X., Hughes, L. E., Gani, D., and
Ryan, M. D. (2001b). Analysis of
the aphthovirus 2A/2B polyprotein
‘cleavage’ mechanism indicates not a
proteolytic reaction, but a novel translational effect: a putative ribosomal
‘skip’. J. Gen. Virol. 82, 1013–1025.
Donoghue, J. P., Sanes, J. N.,
Hatsopoulos, N. G., and Gaal, G.
(1998). Neural discharge and local
field potential oscillations in primate
motor cortex during voluntary movements. J. Neurophysiol. 79, 159–173.
Duschl, A., Lanyi, J. K., and Zimanyi, L.
(1990). Properties and photochemistry
of a halorhodopsin from the
haloalkalophile, Natronobacterium
pharaonis. J. Biol. Chem. 265,
1261–1267.
Friedrich, R. W., Habermann, C. J., and
Laurent, G. (2004). Multiplexing using
synchrony in the zebrafish olfactory
bulb. Nat. Neurosci. 7, 862–871.
Fries, P., Reynolds, J. H., Rorie, A. E., and
Desimone, R. (2001). Modulation of
oscillatory neuronal synchronization
by selective visual attention. Science
291, 1560–1563.
Fries, P., Womelsdorf, T., Oostenveld, R.,
and Desimone, R. (2008). The effects
of visual stimulation and selective
visual attention on rhythmic neuronal
synchronization in macaque area V4.
J. Neurosci. 28, 4823–4835.
Froemke, R. C., and Dan, Y. (2002).
Spike-timing-dependent synaptic
modification induced by natural spike
trains. Nature 416, 433–438.
Gonzalez-Burgos, G., and Lewis, D. A.
(2008). GABA neurons and the
mechanisms of network oscillations:
implications for understanding cortical dysfunction in schizophrenia.
Schizophr. Bull. 34, 944–961.
Gray, C. M., Konig, P., Engel, A. K.,
and Singer, W. (1989). Oscillatory
responses in cat visual cortex exhibit
inter-columnar synchronization
which reflects global stimulus properties. Nature 338, 334–337.
Gregoriou, G. G., Gotts, S. J., Zhou, H.,
and Desimone, R. (2009). Highfrequency, long-range coupling
between prefrontal and visual cortex during attention. Science 324,
1207–1210.
Han, X., and Boyden, E. S. (2007).
Multiple-color optical activation,
silencing, and desynchronization of
neural activity, with single-spike temporal resolution. PLoS ONE 2, e299.
doi: 10.1371/journal.pone.0000299.
Han, X., Qian, X., Bernstein, J. G.,
Zhou, H. H., Franzesi, G. T., Stern, P.,
Bronson, R. T., Graybiel, A. M.,
Desimone, R., and Boyden, E. S. (2009).
Millisecond-timescale optical control
of neural dynamics in the nonhuman
primate brain. Neuron 62, 191–198.
Han, X., Qian, X., Talei Franzesi, G.,
Stern, P., and Boyden, E. (2008).
Molecular toolboxes for quantitatively precise, genetically-targeted
optical control of normal and pathological neural network dynamics. Soc.
Neurosci. 493.9, UU30.
Hennecke, M., Kwissa, M., Metzger, K.,
O u m a r d , A . , K r o g e r, A . ,
Schirmbeck, R., Reimann, J., and
www.frontiersin.org
Hauser, H. (2001). Composition
and arrangement of genes define the
strength of IRES-driven translation in
bicistronic mRNAs. Nucleic Acids Res.
29, 3327–3334.
Hopfield, J. J., and Brody, C. D. (2001).
What is a moment? Transient synchrony as a collective mechanism for
spatiotemporal integration. Proc. Natl.
Acad. Sci. U.S.A. 98, 1282–1287.
Huguenard, J. R., and McCormick, D. A.
(2007). Thalamic synchrony and
dynamic regulation of global forebrain oscillations. Trends Neurosci.
30, 350–356.
Lagali, P. S., Balya, D., Awatramani, G. B.,
Munch, T. A., Kim, D. S., Busskamp, V.,
Cepko, C. L., and Roska, B. (2008).
Light-activated channels targeted to
ON bipolar cells restore visual function in retinal degeneration. Nat.
Neurosci. 11, 667–675.
Lewis, T. L., Jr., Mao, T., Svoboda, K.,
and Arnold, D. B. (2009). Myosindependent targeting of transmembrane proteins to neuronal dendrites.
Nat. Neurosci. 12, 568–576.
Lin, J. Y., Lin, M. Z., Steinbach, P., and
Tsien, R. Y. (2009). Characterization of
engineered channelrhodopsin variants
with improved properties and kinetics.
Biophys. J. 96, 1803–1814.
MacLeod, K., and Laurent, G. (1996).
Distinct mechanisms for synchronization and temporal patterning of
odor-encoding neural assemblies.
Science 274, 976–979.
Mainen, Z. F., and Sejnowski, T. J. (1995).
Reliability of spike timing in neocortical neurons. Science 268, 1503–1506.
Mizuguchi, H., Xu, Z., Ishii-Watabe, A.,
Uchida, E., and Hayakawa, T. (2000).
IRES-dependent second gene expression is significantly lower than capdependent first gene expression in
a bicistronic vector. Mol. Ther. 1,
376–382.
Nagel, G., Szellas, T., Huhn, W., Kateriya, S.,
Adeishvili, N., Berthold, P., Ollig, D.,
Hegemann, P., and Bamberg, E.
(2003). Channelrhodopsin-2, a
directly light-gated cation-selective
membrane channel. Proc. Natl. Acad.
Sci. U.S.A. 100, 13940–13945.
Orekhova, E. V., Stroganova, T. A.,
Nyg ren, G., Tsetlin, M. M.,
Posikera, I. N., Gillberg, C., and
Elam, M. (2007). Excess of high frequency electroencephalogram oscillations in boys with autism. Biol.
Psychiatry 62, 1022–1029.
Osti, D., Marras, E., Ceriani, I., Grassini, G.,
Rubino, T., Vigano, D., Parolaro, D.,
and Perletti, G. (2006). Comparative
analysis of molecular strategies
attenuating positional effects in lentiviral vectors carrying multiple genes.
J. Virol. Methods 136, 93–101.
August 2009 | Volume 2 | Article 12 | 8
Han et al.
Perez-Orive, J., Mazor, O., Turner, G. C.,
Cassenaer, S., Wilson, R. I., and
Laurent, G. (2002). Oscillations and
sparsening of odor representations
in the mushroom body. Science 297,
359–365.
Pesaran, B., Pezaris, J. S., Sahani, M.,
Mitra, P. P., and Andersen, R. A.
(2002). Temporal structure in neuronal activity during working memory
in macaque parietal cortex. Nat.
Neurosci. 5, 805–811.
Petreanu, L., Huber, D., Sobczyk, A.,
and Svoboda, K. (2007).
Channelrhodopsin-2-assisted circuit
mapping of long-range callosal projections. Nat. Neurosci. 10, 663–668.
Robbe, D., Montgomery, S. M.,
Thome, A., Rueda-Orozco, P. E.,
McNaughton, B. L., and Buzsaki, G.
(2006). Cannabinoids reveal importance of spike timing coordination in hippocampal function. Nat.
Neurosci. 9, 1526–1533.
Roelfsema, P. R., Engel, A. K., Konig, P.,
and Singer, W. (1997). Visuomotor
integration is associated with zero
time-lag synchronization among cortical areas. Nature 385, 157–161.
Roopun, A. K., Traub, R. D., Baldeweg, T.,
Cunningham, M. O., Whittaker, R. G.,
Trevelyan, A., Duncan, R., Russell, A. J.,
and Whittington, M. A. (2009).
Detecting seizure origin using basic,
multiscale population dynamic measures: preliminary findings. Epilepsy
Behav. 14(Suppl. 1), 39–46.
Ryan, M. D., and Drew, J. (1994). Footand-mouth disease virus 2A oligopep-
Frontiers in Molecular Neuroscience
Molecules for optical information control
tide mediated cleavage of an artificial
polyprotein. EMBO J. 13, 928–933.
Ryan, M. D., King, A. M., and Thomas, G. P.
(1991). Cleavage of foot-and-mouth
disease virus polyprotein is mediated
by residues located within a 19 amino
acid sequence. J. Gen. Virol. 72(Pt 11),
2727–2732.
Seidenbecher, T., Laxmi, T. R., Stork, O.,
and Pape, H. C. (2003). Amygdalar and
hippocampal theta rhythm synchronization during fear memory retrieval.
Science 301, 846–850.
Sohal, V. S., Zhang, F., Yizhar, O., and
Deisseroth, K. (2009). Parvalbumin
neurons and gamma rhythms enhance
cortical circuit performance. Nature
459, 698–702.
Steinmetz, P. N., Roy, A., Fitzgerald, P. J.,
Hsiao, S. S., Johnson, K. O., and
Niebur, E. (2000). Attention modulates synchronized neuronal firing in
primate somatosensory cortex. Nature
404, 187–190.
Talei Franzesi, G., Borgers, C., Qian, X.,
Li, M., Han, X., Kopell, N., LeBeau, F.,
Whittington, M., and Boyden, E. S.
(2009). Dynamical properties of
gamma-frequency cell assemblies in
the hippocampus probed with optical neural control and computational
modeling. Soc. Neurosci. 321.13, D1.
Tallon-Baudry, C., Bertrand, O., and
Fischer, C. (2001). Oscillatory synchrony between human extrastriate
areas during visual short-term memory
maintenance. J. Neurosci. 21, RC177.
Tang, W., Ehrlich, I., Wolff, S. B.,
Michalski, A.M.,Wolfl,S.,Hasan, M. T.,
Luthi, A., and Sprengel, R. (2009).
Faithful expression of multiple proteins via 2A-peptide self-processing:
a versatile and reliable method
for manipulating brain circuits.
J. Neurosci. 29, 8621–8629.
Tiesinga, P. H., and Sejnowski, T. J. (2004).
Rapid temporal modulation of synchrony by competition in cortical
interneuron networks. Neural Comput.
16, 251–275.
Uhlhaas, P. J., and Singer, W. (2006). Neural
synchrony in brain disorders: relevance
for cognitive dysfunctions and pathophysiology. Neuron 52, 155–168.
Wang, H., Peca, J., Matsuzaki, M.,
Matsuzaki, K., Noguchi, J., Qiu, L.,
Wang, D., Zhang, F., Boyden, E.,
Deisseroth, K., Kasai, H., Hall, W. C.,
Feng, G., Augustine, G. J. (2007).
High-speed mapping of synaptic
connectivity using photostimulation
in Channelrhodopsin-2 transgenic
mice. Proc. Natl. Acad. Sci. U.S.A. 104,
8143–8148.
Yu, X., Zhan, X., D’Costa, J., Tanavde, V. M.,
Ye, Z., Peng, T., Malehorn, M. T.,
Yang, X., Civin, C. I., and Cheng, L.
(2003). Lentiviral vectors with two
independent internal promoters transfer high-level expression of multiple
transgenes to human hematopoietic
stem-progenitor cells. Mol. Ther. 7,
827–838.
Zhang, F., Wang, L. P., Brauner, M.,
Liewald, J. F., Kay, K., Watzke, N.,
Wood, P. G., Bamberg, E., Nagel, G.,
Gottschalk, A., and Deisseroth, K.
(2007). Multimodal fast optical
www.frontiersin.org
interrogation of neural circuitry.
Nature 446, 633–639.
Zhang, Y. P., Holbro, N., and Oertner, T. G.
(2008). Optical induction of plasticity
at single synapses reveals input-specific
accumulation of alphaCaMKII.
Proc. Natl. Acad. Sci. U.S.A. 105,
12039–12044.
Zorzos, A. N., Bernstein, J. G., Boyden, E S.,
and Fonstad, C. G. (2009). Integrated
microstructure lightguides for
ultradense optical neural control of
3-dimensional neural circuits. Soc.
Neurosci. 388.1, GG96.
Conflict of Interest Statement: The
authors declare that the research was
conducted in the absence of any commercial or financial relationships that
could be construed as a potential conflict
of interest.
Received: 07 July 2009; paper pending published: 21 July 2009; accepted: 10 August
2009; published online: 27 August 2009.
Citation: Han X, Qian X, Stern P, Chuong
AS and Boyden ES (2009) Informational
lesions: optical perturbation of spike timing
and neural synchrony via microbial opsin
gene fusions. Front. Mol. Neurosci. 2:12. doi:
10.3389/neuro.02.012.2009
Copyright © 2009 Han, Qian, Stern,
Chuong and Boyden. This is an open-access
article subject to an exclusive license agreement between the authors and the Frontiers
Research Foundation, which permits unrestricted use, distribution, and reproduction in any medium, provided the original
authors and source are credited.
August 2009 | Volume 2 | Article 12 | 9