Science and Technology Journal, Vol. 3 Issue: 1 ISSN: 2321-3388 DifferentialEffectsofCeO2andZnONanoparticles onChlorophyllandSecondaryMetabolitesin Alfalfa(Medicagosativa) SusmitaBandyopadhyay1,3,ArnabMukherjee1,3,CyrenM.Rico2,3,JoseR.PeraltaVidea1,2,3,andJorgeL.Gardea-Torresdey1,2,3,* 1 500WestUniversityAve.,ElPaso,TX79968USA 500WestUniversityAve.,ElPaso,TX79968USA UniversityofCaliforniaCenterforEnvironmentalImplicationsofNanotechnology(UCCEIN), E-mail:*jgardea@utep.edu Abstract—Littleisknownabouttheeffectsofengineerednanoparticles(ENPs)onplantmetabolites.Inthisstudy, alfalfa(Medicagosativa ENPs(n andn -1 . Atharvest,total leafchlorophyll, chlorophylla&b, carotenoids,and 750mgkg-1,n andn aby60%and40%,respectively,comparedtocontrol.Inaddition, -1 ,andby chlorophyllbwasreducedby64%,48%,and60%,respectively,withn -1 40%withn n at -1 -1 , n 500mgkg-1,butreducedby49%withn n n onsecondarymetabolites andchlorophyllproductioninalfalfaplant. Keyword: INTRODUCTION Alfalfa (Medicago sativa L.) is widely used as forage crop and nutritional supplement in human diet owing to its high protein content [1]. In addition to protein, it also containscarbohydrates,vitamins,nutrients,andnumerous carotenoids[4],whichareofattentioninhumannutrition.It lavonoidsproducedbyrootsofalfalfa are signaling molecules for nodulation process, acting as chemoattractants [5–7]. Flavonoid and phenolics also inducenodgeneforthesymbioticRhizobiumassociationin contentswilldirectlyimpactalfalfa’snutritionalvalue,and willbedistressed. The widespread use of engineered nanoparticles (ENPs) is of great concern due to the possibility of their environmentalreleaseandeffectsonecosystemcomponents. of food crops, like alfalfa. Interactions of ENPs with food cropsarewidelystudied[8-16]intermsofbioaccumulation – at lesser scale, trophic transfer [17] thatn andn –14], ButtheunderstandingofENP-plant interactionstowardscellularmetabolicprocesses,interms of secondary metabolites still in its rudimentary stage. The interaction of phenolic grainsize.Theoriginalsoiltypewasfoundtobesandyloam few studies have reported the interaction of ENPs with – et al radish(Raphanussativus n .Krishnarajetal. -1 of the medicinal plant Bacopa monnieri (Linn.) Wettest preparedwithsoilamendedwithdesiredamountofn and n 750mgkg-1 treatedwithn (50seedsperpot).Threereplicateswerepreparedforeach treatment. . have beenreported on the interaction of n andn n metabolites. These metabolites play very important role by maintaining physiological functions that protect plants n e The above and below ground plant parts were carefully followed by washing with CaCl , andn metabolitecontents.Plantstreatedwithn forfurtheranalysis.Later,rootsandshootswereseparated and digested by microwave-assisted acid digestion with andn a,b,andtotal) microwaveaccelerationreactionsystem(CEM,Mathews,NC) accumulatedinrootandshoottissues.Leafchlorophylland (spinachleavesandpeachleavesNIST1547and1570)were MATERIALSANDMETHODS eO2 n n and n wereobtainedfromtheUniversityofCalifornia Center for EnvironmentalImplicationsofNanotechnology(UC-CEIN). TheseNPswerepreviouslycharacterizedandpublishedby Bandyopadhyayetal etal amountsofENPsweresuspendedinMilliporewater(MPW) -1 ofsoil. n andn aandbwereestimated etal. followingPorraetal. withsoil. Elevationof1144above sealevel,top10cm). Theplants total phenolic content was estimated as per Dewanto et al. etal. (Scotts,premiumpottingsoiltoenhance soilfertility)and 8 DifferentialEffectsofCeO2andZnONanoparticlesonChlorophyll hevarianceoftriplicatetreatments wascalculated with forthepairwisecomparisonofmeans,usingSPSSstatistical based ona probabilityofp chlorophyll and carotenoids. Four replicates were used to RESULTSANDDISCUSSION Zn e Figure1Ashowstheconcentrationofzincindryalfalfaroot 500,and750mgkg-1 n respectively.Incaseofn treatments,Celevelsincreased and 9 times more Ce than control, respectively (Fig. 1B). In green pea (Pisum sativum -1 of n -1 Fig.1:CeriumConcentration(Top)andZnConcentration (Bottom)inRootsandShootsofAlfalfaPlantsExposed to Either nCeO2 or nZnO at 0 (control) to 750 mg kg-1. Data are means ± Standard Error of Four Replicates and Bars with Different Symbol/ Letters Show p Respectively accumulation from n also accumulated higher Ce in roots compared to other plants[8,11].Translocationfactors(TF),calculatedthrough -1 -1 750 mg kg almost the same at all n -1 , respectively). The shows the chlorophyll content in leaves of alfalfa n andn withthephysiologicalfunctionsofbothelementsinplants. kg-1 functions, while there is no known function for Ce. Thus, chlorophyllawasreducedby40%and60%at750mgkg-1 of n with previously reported literature, where the majority of kg-1 n n n b , respectively, but remained the same in n theCespeciesaccumulatedinroots,comparedtostemand -1 that showed a 40% Raphanussativus to n andn at concentrations < than 500 mg kg-1, there was higherconcentrationofCeinleaves,comparedtoroots[19]. -1 9 n b n 750 mg kg-1 treatments, respectively. The effects of n andn -1 of n , n the photosyntheticapparatus andlight harvestingprocess n n didnotappeartoimpactchlorophyllthroughtheireffectson n substituted the central magnesium atom of chlorophyll decay and ultimately, interrupting the photosynthetic . followed by n to interrupt chlorophyll production are notwellunderstood.Wehypothesizethatsmallamountsof n might reduce the photosynthetic pigments Fig.2:(A)Chlorophylla,(B)Chlorophyllb,and(C)Total Chlorophyll Content in Leaves of Alfafa Plants Grown for 30 Days in Soil Amended with Either nCeO2 nZnO at 0 (control), 250, 500, and 750 mg/kg. Error Bars StandforStandardErrors(n=3)andBarswithDifferent p nZnO and nCeO2 Treatments are MutuallyIndependent Table 1: Total Leaf Carotenoids Represented as mg g-1 of Fresh Alfalfa Leaves from Plants Grown for 30DaysinSoilAmendedwithEithernCeO2ornZnOat0 (Control),250,500,and750mgkg-1.Dataaremeans± StandardErrorofThreeReplicates Treatments pigments. Control 250 mg kg-1 4.98a 1.45a 500 mg kg-1 750 mg kg-1 n n 4.98a nCeO2 6.81a nZn Phenolic an effectofn andn n -1 at500mgkg At500mgkg-1,n by86%,whileat750mgkg-1 mg kg-1 n by 77%, while at 750 mg kg-1 49%,comparedwithcontrol.Krishnarajetal. an increase in leaves, phenol content of Bacopa monnieri 10 DifferentialEffectsofCeO2andZnONanoparticlesonChlorophyll Oryza sativa)treatedwith500mgn kg-1sho high n n protectiveroleinmetalchelationandscavengingofreactive NPs might correlate to the increased enzymatic activities, suggesting ‘de novo’ ofalfalfawithincreasingdoseofn a negative effect in the nutritional value of alfalfa shoots. Additionally, it is hypothesized that there is a probability of increasing plant stress due to accumulation of reactive contentsuggeststhatalfalfaplantsareaffectedfromsevere stressconditionsimposedbyn andn Fig. 4: Changes in Flavonoid Content Expressed as µg catechin/g of Freeze Dried (A) Root and (B) Shoot of Alfalfa Plants Grown for 30 Days in Soil Amended with Either nCeO2 or nZnO at 0 (Control), 250, 500, and 750 mg/kg. Error Bars Stand for Standard Errors and Bars with Different TreatmentsareMutually Independent 2 CONCLUSION Thisstudyhasshownthatalfalfaabsorbsandtranslocates n and n a butn also affected chlorophyll b and total chlorophyll production. n n areaffected bysevere stressconditions imposedby n andn ACKNOWLEDGEMENT This material is based upon work supported by the National Science Foundation and the Environmental Protection Agency under Cooperative Agreement Number Fig.3:TotalPhenolicContent(RepresentedasµgGAE/g) in(A)Rootsand(B)ShootsofFreezeDriedAlfalfaPlant Grownfor30DaysinSoilAmendedwithEithernCeO2or nZnOat0(Control),250,500,and750mg/kg.ErrorBars Stand for Standard Errors and Bars with no Symbols GAE=GallicAcidEquivalent,n=3 11 of the National Science Foundation or the Environmental ProtectionAgency. ThisworkhasnotbeensubjectedtoEPA Coriandrum J.Agric.FoodChem. sativum laboratoryforspectroscopicmeasurements. 14. REFERENCES J. Agriculture”,Ind.Biotechnol, 15. 1. Solanum lycopersicum L.) and its Implications for Food Safety”, Metallomics, Medicago sativa L.) Parts”,J.Agric.FoodChem, 16. ”, J. Agric. Food Environ. Sci. Pollut. Res., Chem, 17. Alfalfa by Stop-and-go Counter-Current Chromatography Nanomaterials in Terrestrial Environments”, Environ. Sci. Technol J.ChromatogrA 18. Protein (Pro-Xan) and Dehydrated Meals”, J. Agric. Food Chem 19. 4. Stress”,Pol.J.Environ.Stud., . 5. but do not Impact Tuber Ionome in Raphanus sativus (L)”, PlantPhysiol.Biochem the Sinorhizobium–Medicago Model”, Nat. Rev. Microbiol, 6. of Rhizobium meliloti Appl. Environ. Microbiol, 7. Synthesized Silver Nanoparticles on Bacopa monnieri (Linn.) Wettst. Plant Metabolism”, Process Biochem pp.651–658. Nodulation”,NewPhytol, 8. Nanoparticles in Cucumber Plants”, Environ. Sci. Technol, Oryzasativa J.Agric.FoodChem. 9. 10. SusceptibilitytoManufacturedNanomaterials:Evidencefor P.Natl.Acad.Sci. USA, In Situ Nanoparticles towards Sinorhizobium meliloti, a Symbiotic Alfalfa Associated Bacterium: Useof Advanced Microscopic J. Hazard. Mater, Media”,Environ.Sci.Technol., (Glycinemax)”,ACSNano, 11. J.Sediment.Res., andToleranceofZeamays Nanoparticles:CrossTalk ACS inDifferentSolvents”,Biochem.Soc.T., Nano, Metallomics, 12 Determination of Chlorophylls a and b. Photosynth”, Res., DifferentialEffectsofCeO2andZnONanoparticlesonChlorophyll J.Agric.FoodChem., J. Agric. Food Chem., synthesizing glutamate 1-semialdehyde aminotransferase metabolisminalfalfa(MedicagosativaL.).PlantPhysiol.106: relevanceofheavymetalsubstitutedchlorophyllsusingthe BIOGRAPHY Dr. Jorge Gardea-Torresdey Gardea-Torresdey is the Dudley Professor of Chemistry and Environmental Science and phytoremediation, novel methods for the bioproduction of nanoparticles and study of the fate of 13