Disease, and Other Clinical Natural Kinds Barry Smith Gradualist Approaches to Health and Disease Berlin, March 23, 2012 1 Natural Kind Synonyms: universal, type = entities of the sorts which are referred to by general terms of natural science Instances, particulars, individuals = entities of the sorts which can be observed in experiments of natural science 2/ Old biology data 3/ New biology data MKVSDRRKFEKANFDEFESALNNKNDLVHCPSITLFESIPTEVRSF YEDEKSGLIKVVKFRTGAMDRKRSFEKVVISVMVGKNVKKFLTFV EDEPDFQGGPISKYLIPKKINLMVYTLFQVHTLKFNRKDYDTLSLF YLNRGYYNELSFRVLERCHEIASARPNDSSTMRTFTDFVSGAPIV RSLQKSTIRKYGYNLAPYMFLLLHVDELSIFSAYQASLPGEKKVDT ERLKRDLCPRKPIEIKYFSQICNDMMNKKDRLGDILHIILRACALNF GAGPRGGAGDEEDRSITNEEPIIPSVDEHGLKVCKLRSPNTPRRL RKTLDAVKALLVSSCACTARDLDIFDDNNGVAMWKWIKILYHEVA QETTLKDSYRITLVPSSDGISLLAFAGPQRNVYVDDTTRRIQLYTD YNKNGSSEPRLKTLDGLTSDYVFYFVTVLRQMQICALGNSYDAFN HDPWMDVVGFEDPNQVTNRDISRIVLYSYMFLNTAKGCLVEYAT FRQYMRELPKNAPQKLNFREMRQGLIALGRHCVGSRFETDLYES ATSELMANHSVQTGRNIYGVDFSLTSVSGTTATLLQERASERWIQ WLGLESDYHCSFSSTRNAEDVDISRIVLYSYMFLNTAKGCLVEYA TFRQYMRELPKNAPQKLNFREMRQGLIALGRHCVGSRFETDLYE 4 SATSELMANHSVQTGRNIYGVDFSLTSVSGTTATLLQERASERWI How to do biology across the genome? MKVSDRRKFEKANFDEFESALNNKNDLVHCPSITLFESIPTEVRSFYEDEKSGLIKVVKFRTGAMDRKRSFEKVVIS VMVGKNVKKFLTFVEDEPDFQGGPISKYLIPKKINLMVYTLFQVHTLKFNRKDYDTLSLFYLNRGYYNELSFRVLER CHEIASARPNDSSTMRTFTDFVSGAPIVRSLQKSTIRKYGYNLAPYMFLLLHVDELSIFSAYQASLPGEKKVDTERL KRDLCPRKPIEIKYFSQICNDMMNKKDRLGDILHIILRACALNFGAGPRGGAGDEEDRSITNEEPIIPSVDEHGLKVC KLRSPNTPRRLRKTLDAVKALLVSSCACTARDLDIFDDNNGVAMWKWIKILYHEVAQETTLKDSYRITLVPSSDGIS LLAFAGPQRNVYVDDTTRRIQLYTDYNKNGSSEPRLKTLDGLTSDYVFYFVTVLRQMQICALGNSYDAFNHDPWM DVVGFEDPNQVTNRDISRIVLYSYMFLNTAKGCLVEYATFRQYMRELPKNAPQKLNFREMRQGLIALGRHCVGSR FETDLYESATSELMANHSVQTGRNIYGVDFSLTSVSGTTATLLQERASERWIQWLGLESDYHCSFSSTRNAEDVM KVSDRRKFEKANFDEFESALNNKNDLVHCPSITLFESIPTEVRSFYEDEKSGLIKVVKFRTGAMDRKRSFEKVVISV MVGKNVKKFLTFVEDEPDFQGGPISKYLIPKKINLMVYTLFQVHTLKFNRKDYDTLSLFYLNRGYYNELSFRVLERC HEIASARPNDSSTMRTFTDFVSGAPIVRSLQKSTIRKYGYNLAPYMFLLLHVDELSIFSAYQASLPGEKKVDTERLK RDLCPRKPIEIKYFSQICNDMMNKKDRLGDILHIILRACALNFGAGPRGGAGDEEDRSITNEEPIIPSVDEHGLKVCK LRSPNTPRRLRKTLDAVKALLVSSCACTARDLDIFDDNNGVAMWKWIKILYHEVAQETTLKDSYRITLVPSSDGISLL AFAGPQRNVYVDDTTRRIQLYTDYNKNGSSEPRLKTLDGLTSDYVFYFVTVLRQMQICALGNSYDAFNHDPWMD VVGFEDPNQVTNRDISRIVLYSYMFLNTAKGCLVEYATFRQYMRELPKNAPQKLNFREMRQGLIALGRHCVGSRF ETDLYESATSELMANHSVQTGRNIYGVDFSLTSVSGTTATLLQERASERWIQWLGLESDYHCSFSSTRNAEDVMK VSDRRKFEKANFDEFESALNNKNDLVHCPSITLFESIPTEVRSFYEDEKSGLIKVVKFRTGAMDRKRSFEKVVISVM VGKNVKKFLTFVEDEPDFQGGPISKYLIPKKINLMVYTLFQVHTLKFNRKDYDTLSLFYLNRGYYNELSFRVLERCH EIASARPNDSSTMRTFTDFVSGAPIVRSLQKSTIRKYGYNLAPYMFLLLHVDELSIFSAYQASLPGEKKVDTERLKR DLCPRKPIEIKYFSQICNDMMNKKDRLGDILHIILRACALNFGAGPRGGAGDEEDRSITNEEPIIPSVDEHGLKVCKL RSPNTPRRLRKTLDAVKALLVSSCACTARDLDIFDDNNGVAMWKWIKILYHEVAQETTLKDSYRITLVPSSDGISLL AFAGPQRNVYVDDTTRRIQLYTDYNKNGSSEPRLKTLDGLTSDYVFYFVTVLRQMQICALGNSYDAFNHDPWMD VVGFEDPNQVTNRDISRIVLYSYMFLNTAKGCLVEYATFRQYMRELPKNAPQKLNFREMRQGLIALGRHCVGSRF ETDLYESATSELMANHSVQTGRNIYGVDFSLTSVSGTTATLLQERASERWIQWLGLESDYHCSFSSTRNAEDVMK VSDRRKFEKANFDEFESALNNKNDLVHCPSITLFESIPTEVRSFYEDEKSGLIKVVKFRTGAMDRKRSFEKVVISVM VGKNVKKFLTFVEDEPDFQGGPISKYLIPKKINLMVYTLFQVHTLKFNRKDYDTLSLFYLNRGYYNELSFRVLERCH5 EIASARPNDSSTMRTFTDFVSGAPIVRSLQKSTIRKYGYNLAPYMFLLLHVDELSIFSAYQASLPGEKKVDTERLKR how to link the kinds of phenomena represented here 6/ or here 7 or here 8 MKVSDRRKFEKANFDEFESALNNKNDLVHCPSITLFESIPTEVRSFYEDEKSGLIKVVKFRTGAMDRK RSFEKVVISVMVGKNVKKFLTFVEDEPDFQGGPIPSKYLIPKKINLMVYTLFQVHTLKFNRKDYDTLSL FYLNRGYYNELSFRVLERCHEIASARPNDSSTMRTFTDFVSGAPIVRSLQKSTIRKYGYNLAPYMFLLL HVDELSIFSAYQASLPGEKKVDTERLKRDLCPRKPIEIKYFSQICNDMMNKKDRLGDILHIILRACALNF GAGPRGGAGDEEDRSITNEEPIIPSVDEHGLKVCKLRSPNTPRRLRKTLDAVKALLVSSCACTARDLD IFDDNNGVAMWKWIKILYHEVAQETTLKDSYRITLVPSSDGISLLAFAGPQRNVYVDDTTRRIQLYTDY NKNGSSEPRLKTLDGLTSDYVFYFVTVLRQMQICALGNSYDAFNHDPWMDVVGFEDPNQVTNRDIS RIVLYSYMFLNTAKGCLVEYATFRQYMRELPKNAPQKLNFREMRQGLIALGRHCVGSRFETDLYESA TSELMANHSVQTGRNIYGVDSFSLTSVSGTTATLLQERASERWIQWLGLESDYHCSFSSTRNAEDVV AGEAASSNHHQKISRVTRKRPREPKSTNDILVAGQKLFGSSFEFRDLHQLRLCYEIYMADTPSVAVQA PPGYGKTELFHLPLIALASKGDVEYVSFLFVPYTVLLANCMIRLGRRGCLNVAPVRNFIEEGYDGVTDL YVGIYDDLASTNFTDRIAAWENIVECTFRTNNVKLGYLIVDEFHNFETEVYRQSQFGGITNLDFDAFEK AIFLSGTAPEAVADAALQRIGLTGLAKKSMDINELKRSEDLSRGLSSYPTRMFNLIKEKSEVPLGHVHKI RKKVESQPEEALKLLLALFESEPESKAIVVASTTNEVEELACSWRKYFRVVWIHGKLGAAEKVSRTKE FVTDGSMQVLIGTKLVTEGIDIKQLMMVIMLDNRLNIIELIQGVGRLRDGGLCYLLSRKNSWAARNRKG ELPPKEGCITEQVREFYGLESKKGKKGQHVGCCGSRTDLSADTVELIERMDRLAEKQATASMSIVAL PSSFQESNSSDRYRKYCSSDEDSNTCIHGSANASTNASTNAITTASTNVRTNATTNASTNATTNASTN ASTNATTNASTNATTNSSTNATTTASTNVRTSATTTASINVRTSATTTESTNSSTNATTTESTNSSTNA TTTESTNSNTSATTTASINVRTSATTTESTNSSTSATTTASINVRTSATTTKSINSSTNATTTESTNSNT NATTTESTNSSTNATTTESTNSSTNATTTESTNSNTSAATTESTNSNTSATTTESTNASAKEDANKDG NAEDNRFHPVTDINKESYKRKGSQMVLLERKKLKAQFPNTSENMNVLQFLGFRSDEIKHLFLYGIDIYF CPEGVFTQYGLCKGCQKMFELCVCWAGQKVSYRRIAWEALAVERMLRNDEEYKEYLEDIEPYHGDP VGYLKYFSVKRREIYSQIQRNYAWYLAITRRRETISVLDSTRGKQGSQVFRMSGRQIKELYFKVWSNL RESKTEVLQYFLNWDEKKCQEEWEAKDDTVVVEALEKGGVFQRLRSMTSAGLQGPQYVKLQFSRH HRQLRSRYELSLGMHLRDQIALGVTPSKVPHWTAFLSMLIGLFYNKTFRQKLEYLLEQISEVWLLPHW LDLANVEVLAADDTRVPLYMLMVAVHKELDSDDVPDGRFDILLCRDSSREVGELIGLFYNKTFRQKLE 9 YLLEQISEVWLLPHWLDLANVEVLAADDTRVPLYMLMVAVHKELDSDDVPDGRFDILLCRDSSREVG ELIGLFYNKTFRQKLEYLLEQISEVWLLPHWLDLANVEVLAADDTRVPLYMLMVAVHKELDSDDVPDG to this? or this? 10 answer: through annotation of data with terms from a controlled vocabulary or ‘ontology’ sphingolipid transporter activity Holliday junction helicase complex 11 this allows integration of databases GlyProt MouseEcotope Holliday junction helicase complex DiabetInGene GluChem 13 and supports logical reasoning over data 15 ‘Ontology’ in PubMed 16/24 GO, in particular, is tremendously successful 17 $100 million invested in literature and data curation using GO over 11 million annotations relating gene products described in the UniProt, Ensembl and other databases to GO terms experimental results reported in 52,000 scientific journal articles manually annoted by expert biologists using GO 18 Benefits of the GO 1. rooted in basic experimental biology 2. links people to data and to literature 3. links data to data • across species (human, mouse, yeast, fly ...) • across granularities (molecule, cell, organ, organism, population) 4. links medicine to biological science 5. promotes cumulation of scientific knowledge in algorithmically tractable form 19 National Center for Biomedical Ontology (NIH Roadmap Center) − Stanford Biomedical Informatics Research − The Mayo Clinic − University at Buffalo Department of Philosophy http://bioportal.bioontology.org 24 25 26 GO supports only three types of annotation what cellular component? what molecular function? what biological process? no diseases in GO 27 28 RELATION TO TIME CONTINUANT INDEPENDENT OCCURRENT DEPENDENT GRANULARITY ORGAN AND ORGANISM Organism (NCBI Taxonomy) CELL AND CELLULAR COMPONENT Cell (CL) MOLECULE Anatomical Organ Entity Function (FMA, (FMP, CPRO) Phenotypic CARO) Quality (PaTO) Cellular Cellular Component Function (FMA, GO) (GO) Molecule (ChEBI, SO, RnaO, PrO) Molecular Function (GO) Biological Process (GO) Molecular Process (GO) OBO Foundry (first version, 2006) Yellow = Gene Ontology 29 http://obofoundry.org 30 Current OBO Foundry Ontologies • • • • • • • • Biological process (GO) Cellular component (GO) Chemical entities of biological interest Molecular function (GO) Phenotypic quality PRotein Ontology (PRO) Xenopus Anatomy and Development Zebrafish Anatomy and Development 31 Foundry ontologies under review Cell Ontology (CL) Foundational Model of Anatomy (FMA) Infectious Disease Ontology (IDO) Staph. aureus Ontology (IDO Sa) Malaria Ontology (IDO MAL) Influenza Ontology (IDO Flu) HIV Ontology (IDO HIV) Ontology for Biomedical Investigations (OBI) Ontology for General Medical Sciences (OGMS) Plant Ontology (PO) 32 Ontologies under construction Allergy Ontology Environment Ontology (EnvO) Immunology Ontology (IDO) Mental Functioning Ontology (MFO) Emotion Ontology (MFO-EM) Pain Ontology Mental Disease Ontology (MDO) Neurological Disease Ontology (ND) Vaccine Ontology (VO) 33 Foundational Model of Anatomy Ontology FMA has 83281 types and 3 million relations representing canonical adult human anatomy = the anatomy generated by the coordinated expression of the organism’s own structural genes. 32 teeth two arms two legs one nose two nostrils two kidneys, … Canonical ≠ statistically normal 34 Anatomical Structure Anatomical Space Organ Cavity Subdivision Organ Cavity Organ Serous Sac Cavity Subdivision Serous Sac Cavity Serous Sac Organ Component Organ Subdivision Pleural Sac Pleural Cavity Parietal Pleura Interlobar recess Organ Part Mediastinal Pleura Tissue Pleura(Wall of Sac) Visceral Pleura Mesothelium of Pleura 35 Foundational Model of Anatomy (FMA) An ontology is a controlled structured vocabulary that includes a backbone taxonomy (nodes connected by the is_a [subtype] relation) together with further logically defined relations such as part_of, regulated_by 36 Basic Formal Ontology (BFO) A simple top-level ontology to support information integration in scientific research Serves as starting point for OBO Foundry ontologies Domain ontologies built by downward population 38 Basic Formal Ontology Continuant Occurrent Life Independent Continuant Dependent Continuant Organism Temperature http://www.ifomis.org/bfo/ 39 Example: The Cell Ontology Continuant Independent Continuant Non-realizable Dependent Continuant (quality) Dependent Continuant TYPES Realizable Dependent Continuant (function, role, disposition) ..... ..... INSTANCES depends_on Continuant Independent Continuant Dependent Continuant thing quality .... ..... TYPES example: temperature depends on bearer INSTANCES Dependent Continuant Quality Disposition of banana, to ripen Realizable Dependent Continuant Function of heart, to pump blood Role of employee, to work for pay 46 process of realization depends_on realizable Continuant Independent Continuant bearer Realizable Dependent Continuant disposition Occurrent Process of realization .... ..... ....... 47 Four distinct classificatory tasks 1. 2. 3. 4. of people (patients, carriers, …) of diseases (cases, instances, problems, …) of courses of disease (symptoms, treatments…) of representations (records, observations, data, diagnoses…) ICD confuses 1. & 2. Most standard terminologies confuse 2. and 4 51 Four distinct BFO categories 1. person (patient, carrier, …) – independent continuant 2. disease (case, instance, problem, …) – specifically dependent continuant 3. course of disease (symptom, treatment…) – occurrent 4. representation (record, datum, diagnosis…) – generically dependent continuant 52 Four distinct BFO categories 1. people (patients, carriers, …) – independent continuants 2. disease (case, instance, problem, condition …) – disposition 3. course of disease (symptom, episode, outbreak …) – realization of dispositions 4. representations (records, data, diagnoses…) – generically dependent continuants 53 Big Picture (Ontology for General Medical Science) 55 Elucidation of Primitive Terms ‘extended organism’ = the organism and all the material entities located within it ‘bodily feature’ = either a physical part of the extended organism, a bodily quality, or a bodily process. 56 Elucidation of Primitive Terms clinically abnormal - some bodily feature that (1) is not part of the life plan for an organism of the relevant type (unlike loss of milk teeth, aging or pregnancy), (2) is causally linked to an elevated risk either of pain or other feelings of illness, or of death or dysfunction, and (3) is such that the elevated risk exceeds a certain threshold level.* *Compare: baldness 57 Disorder A material entity (fiat object part) which is clinically abnormal and part of an extended organism Compare: Downtown Santa Barbara Mount Everest Peter Hucklenbroich’s pate 58 Definitions - Foundational Terms Pathological Process =def. – A bodily process that is clinically abnormal. Disease =def. – A disposition (i) to undergo pathological processes that (ii) exists in an organism because of one or more disorders in that organism. 60 http://code.google.com/p/ogms/ 61 Big Picture (Ontology for General Medical Science) 62 http://code.google.com/p/ogms/ 63 Disease Course =Def. The sum of processes through which a given disease instance is realized. 65 organism John occurrent disposition process disease course of disease John’s disease course of John’s disease TYPES dependent continuant INSTANCES independent continuant coronary heart disease in nature, no sharp boundaries here CHD in phase of early lesions and small fibrous plaques instantiates at t1 CHD in phase of asymptomatic (‘silent’) infarction instantiates at t2 CHD in phase of surface disruption of plaque instantiates at t3 unstable angina instantiates at t4 stable angina instantiates at t5 John’s coronary heart disease 67 human in nature, no sharp boundaries here embryo instantiates at t1 fetus instantiates at t2 neonate instantiates at t3 infant instantiates at t4 child instantiates at t5 adult instantiates at t6 John 68 A disease is a disposition produces etiological process bears disorder realized_in disposition pathological process produces diagnosis interpretive process produces signs & symptoms used_in abnormal bodily features recognized_as 71 Cirrhosis - environmental exposure Etiological process - phenobarbitolinduced hepatic cell death produces Disorder - necrotic liver bears Disposition (disease) - cirrhosis realized_in Pathological process - abnormal tissue repair with cell proliferation and fibrosis that exceed a certain threshold; hypoxia-induced cell death produces Abnormal bodily features recognized_as Symptoms - fatigue, anorexia Signs - jaundice, splenomegaly Symptoms & Signs used_in Interpretive process produces Hypothesis - rule out cirrhosis suggests Laboratory tests produces Test results - elevated liver enzymes in serum used_in Interpretive process produces Result - diagnosis that patient X has a disorder that bears the disease cirrhosis 72 Influenza - infectious Etiological process - infection of airway epithelial cells with influenza virus produces Disorder - viable cells with influenza virus bears Disposition (disease) - flu realized_in Pathological process - acute inflammation produces Abnormal bodily features recognized_as Symptoms - weakness, dizziness Signs - fever Symptoms & Signs used_in Interpretive process produces Hypothesis - rule out influenza suggests Laboratory tests produces Test results - elevated serum antibody titers used_in Interpretive process produces Result - diagnosis that patient X has a disorder that bears the disease flu 73 Huntington’s Disease - genetic Etiological process - inheritance of >39 CAG repeats in the HTT gene produces Disorder - chromosome 4 with abnormal mHTT bears Disposition (disease) - Huntington’s disease realized_in Pathological process - accumulation of mHTT protein fragments, abnormal transcription regulation, neuronal cell death in striatum produces Abnormal bodily features recognized_as Symptoms - anxiety, depression Signs - difficulties in speaking and swallowing Symptoms & Signs used_in Interpretive process produces Hypothesis - rule out Huntington’s suggests Laboratory tests produces Test results - molecular detection of the HTT gene with >39CAG repeats used_in Interpretive process produces Result - diagnosis that patient X has a disorder that bears the disease Huntington’s disease 74 Dispositions and Predispositions Some dispositions are predispositions to other dispositions. 75 HNPCC - genetic pre-disposition Etiological process - inheritance of a mutant mismatch repair gene produces Disorder - chromosome 3 with abnormal hMLH1 bears Disposition (disease) - Lynch syndrome realized_in Pathological process - abnormal repair of DNA mismatches produces Disorder - mutations in proto-oncogenes and tumor suppressor genes with microsatellite repeats (e.g. TGF-beta R2) bears Disposition (disease) - non-polyposis colon cancer realized in Symptoms (including pain) 76 Arterial Aneurysm Disposition – atherosclerosis realized in Pathological process – fatty material collects within the walls of arteries produces Disorder – artery with weakened wall bears Disposition – of artery to become distended realized_in Pathological process – process of distending produces Disorder – arterial aneurysm bears Disposition – of artery to rupture realized in Pathological process – (catastrophic event) of rupturing produces Disorder – ruptured artery, arterial system with dangerously low blood pressure bears Disposition – circulatory failure realized in Pathological process – exsanguination, failure of homeostasis produces Death 77 Systemic arterial hypertension Etiological process – abnormal reabsorption of NaCl by the kidney produces Disorder – abnormally large scattered molecular aggregate of salt in the blood bears Disposition (disease) - hypertension realized_in Pathological process – exertion of abnormal pressure against arterial wall produces Abnormal bodily features recognized_as Symptoms Signs – elevated blood pressure Symptoms & Signs used_in Interpretive process produces Hypothesis - rule out hypertension suggests Laboratory tests produces Test results used_in Interpretive process produces Result - diagnosis that patient X has a disorder that bears the disease hypertension 82 Type 2 Diabetes Mellitus Etiological process – produces Disorder – abnormal pancreatic beta cells and abnormal muscle/fat cells bears Disposition (disease) – diabetes mellitus realized_in Pathological processes – diminished insulin production , diminished muscle/fat uptake of glucose produces Abnormal bodily features recognized_as Symptoms – polydipsia, polyuria, polyphagia, blurred vision Signs – elevated blood glucose and hemoglobin A1c Symptoms & Signs used_in Interpretive process produces Hypothesis - rule out diabetes mellitus suggests Laboratory tests – fasting serum blood glucose, oral glucose challenge test, and/or blood hemoglobin A1c produces Test results used_in Interpretive process produces Result - diagnosis that patient X has a disorder that bears the disease type 2 diabetes mellitus 83 Type 1 hypersensitivity to penicillin Etiological process – sensitizing of mast cells and basophils during exposure to penicillin-class substance produces Disorder – mast cells and basophils with epitope-specific IgE bound to Fc epsilon receptor I bears Disposition (disease) – type I hypersensitivity realized_in Pathological process – type I hypersensitivity reaction produces Abnormal bodily features recognized_as Symptoms – pruritis, shortness of breath Signs – rash, urticaria, anaphylaxis Symptoms & Signs used_in Interpretive process produces Hypothesis suggests Laboratory tests – produces Test results – occasionally, skin testing used_in Interpretive process produces Result - diagnosis that patient X has a disorder that bears the disease type 1 hypersensitivity to penicillin 84 Early Onset Alzheimer’s Disease Disorder – mutations in APP, PSEN1 and PSEN2 bears Disposition – impaired APP processing realized in Pathological process – accumulation of intra- and extracellular protein in the brain produces Disorder – amyloid plaque and neurofibrillary tangles bears Disposition – of neurons to die realized in Pathological process – neuronal loss produces Disorder – cognitive brain regions damaged and reduced in size bears Disposition (disease) – Alzheimer’s dementia realized in Symptoms – episodic memory loss and other cognitive domain impairment 85 Arterial Aneurysm • • Disposition – atherosclerosis – realized in Pathological process – fatty material collects within the walls of arteries – • • • • • • • • • Disorder – artery with weakened wall – bears Disposition – of artery to become distended – realized_in Pathological process – process of distending – produces Disorder – arterial aneurysm – bears Disposition – of artery to rupture – realized in Pathological process – (catastrophic event) of rupturing – produces Disorder – ruptured artery, arterial system with dangerously low blood pressure – bears Disposition – circulatory failure – realized in Pathological process – exsanguination, failure of homeostasis – • produces produces Death 86 Hemorrhagic stroke • • • • • • • • • Disorder – cerebral arterial aneurysm – bears Disposition – of weakened artery to rupture – realized in Pathological process – rupturing of weakened blood vessel – produces Disorder – Intraparenchymal cerebral hemorrhage – bears Disposition (disease) – to increased intra-cranial pressure – realized in Pathological process – increasing intra-cranial pressure, compression of brain structures – produces Disorder – Cerebral ischemia, Cerebral neuronal death – bears Disposition (disease) – stroke – realized in Symptoms – weakness/paralysis, loss of sensation, etc 87 Advantages of the Disposition Theory Only something like the disposition theory enables us to explain why a fracture is not a disease PETER HUCKLENBROICH − Radius fracture loco classico “ is a disease” 88 PETER HUCKLENBROICH A disease entity is a set of possible alternative courses x has disease entity D ≡ (x has course D1) or (x has course D2) or … or (x has course Dn) Only something like the disposition theory can allow us to determine what does and what does not belong to this list. 89 Think of all the different temporal extents of the disease courses association with any given disease • for those who die in an accident 5 seconds after catching the disease • for those who have no treatment • for those who have truly excellent treatment • … 90 Think of all the different combination cases: of diseases with other diseases of diseases with complications of diseases at different stages of life of diseases with different environments in igloos in Ost-Thüringen in sub-Saharan Africa in space-ships … 91 Think of all the different types of patient: smoker non-smoker banana-leaf-smoker Am-Sonntag-bei-Mutti-Esser Aspirin-vor-dem-Schlafen-Gehen-Nehmer Auf-dem-Schiessplatz-Ohrstöpsel-Träger Auf-Weihnachtsmarkt-Lebkuchenherz-Käufer Auto-in-Waschstrasse-Abschliesser 92 93 human in nature, no sharp boundaries here embryo instantiates at t1 fetus instantiates at t2 neonate instantiates at t3 infant instantiates at t4 child instantiates at t5 adult instantiates at t6 John 94 portion of water portion of ice instantiates at t1 portion of liquid water instantiates at t2 Phrase transitions portion of gas instantiates at t3 this portion of H20 95 temperature in nature, no sharp boundaries here 37ºC instantiates at t1 37.1ºC instantiates at t2 37.2ºC instantiates at t3 37.3ºC instantiates at t4 37.4ºC instantiates at t5 37.5ºC instantiates at t6 John’s temperature 96