Control Sheet
Issue date
05.31.2013
Revision number
01
01.31.2014
02
Reason
New release (FM6150)
All pages
Corrections (FM8222)
11, 43, 49-64, 72-83
CR-IR 359 Service Manual
Troubleshooting (MT)
014-247-02E
01.31.2014 FM8222
CR-IR 359 Service Manual
Pages affected
MT-1
1.
Overview of Troubleshooting
1.1
Flow of Troubleshooting
Trouble occurred
„ (UURU&ODVVL¿FDWLRQV
58HUURUVFDQEHURXJKO\FODVVL¿HGLQWRWKHIROORZLQJ¿YHFDWHJRULHV
1. Errors causing the Console screen to display an error code
Mechanical, electrical, scanner, or software errors that cause the Console screen to display
an error code upon error detection
2. Errors with inability of the RU to communicate with the Console
Console-to-RU communication errors that inhibit the RU from becoming ready
Checking the Error Log
{MT:1.2.1_Checking the Error Log}
1. Errors causing the Console screen to display an error code
{MT:1.2_Troubleshooting from Error Log}
{MT:2._Error Code Table}
2. Errors with inability of the RU to communicate with the Console
3. Errors causing image abnormalities
Errors that result in image abnormalities due to a scratched IP, laser light blockage caused
by dust, or electrical/scanner system component abnormalities
4. Errors interrupting the progress of a process and causing the inability to
detect an error code
Errors that occur due to a CPU board, interrupt the progress of a process, and cause the
inability to detect an error code
5. Errors causing the inability to upgrade the software or save data
Errors that cause a problem between the FTP server and CPU board due to an improper
FTP server setting, IP address setting, or RU name setting
3. Errors causing image abnormalities
4. Analysis of errors causing the inability to display an error code
and the inability of the machine to boot
5. Errors causing the inability to update the software or save data
014-247-01E
05.31.2013 FM6150
CR-IR 359 Service Manual
MT-1
MT-2
1.2
Troubleshooting from Error Log
1.2.1
Checking the Error Log
Using the RU PC-TOOL ERROR DB, view the error log and check the occurrence of error
codes.
START
„ Purpose of Making a Backup of the Error Log
$QHUURUORJLVDGGHGWRWKH¿OHZKHQHYHUDQHUURURFFXUVGXULQJWKHRSHUDWLRQRIWKH
PDFKLQHDQGZKHQWKH¿OHEHFRPHVIXOOLWVHQWULHVDUHRYHUZULWWHQRQD¿UVWLQ¿UVWRXW
basis.
Before troubleshooting, back up the error log, which contains the information about errors
encountered during the user’s use of the machine.
If the error log is not backed up beforehand, the information about errors encountered during
troubleshooting may overwrite the previously logged error information. Therefore, you may
lose the information about errors that occurred during the user’s use of the machine.
„ Purpose of Viewing the Error Log
Start the RU PC-TOOL.
{MU:4.23_Starting and Exiting RU PC-TOOL}
When an error occurs, it may incur two or more additional errors. The error code displayed
on the Console represents the last-encountered error.
You must therefore view the error log to locate the error code related to the encountered
trouble before proceeding to perform troubleshooting.
Back up the ERROR LOG and CONFIGURAION.
{MU:4.15_BACKUP}
Start the ERROR DB to view the error log.
{MU:4.18_ERROR DB}
END
014-247-01E
05.31.2013 FM6150
CR-IR 359 Service Manual
MT-2
MT-3
1.2.2
Determining the Error Code of the Encountered Trouble
When errors occur at RU startup, their occurrence time indications vary with the error
occurrence timing.
(1)
Group the errors that occurred.
(2)
Locate the error that is responsible for the encountered trouble (the error that
RFFXUUHG¿UVW (Example)
- Error occurrence groups A and B are judged as separate error occurrence groups,
because the difference between their error occurrence times is 14 minutes.
7KH¿UVWHUURULQ*URXS$LV
„ When an Error Occurred after "Time Data" Was Acquired from the Console
Error codes displayed on the Console screen
A
B
Error code that occurred last
Error code that
occurred second
Code of the error
that occurred first.
Perform
troubleshooting
with this error
code.
FRRB201001.ai
„ When an Error Occurred before "Time Data" Was Acquired from the
Console
B
z When errors occurred after "time data" was acquired from the Console
'HWHUPLQHWKHRUGHURIHUURURFFXUUHQFHVLQDFFRUGDQFHZLWKWKHRFFXUUHQFHWLPH
indications.
Error
code
Occurrence
date
12256 xxxx.xx.xx xx:xx:xx 00257D tiphscan____
3D0004 ScnCmFnc.c 2817
12255 xxxx.xx.xx xx:xx:xx 00258D tiphscan____
3D0004 400000,00 00 00 609C 6098
Error code that occurred second
Code of the error that occurred first.
Perform troubleshooting with this error
code.
FRRB201003.ai
z When errors occurred before "time data" was acquired from the Console
7KHUHVXOWLQJRFFXUUHQFHGDWHWLPHLQGLFDWLRQVORRNOLNH
1RWHKRZHYHUWKDWWKHWLPHHODSVHGDIWHUSRZHU21LVLQGLFDWHGLQWKHVHFRQGVSRVLWLRQ
XQGHUOLQHG RIWKHRFFXUUHQFHWLPH¿HOG
7KHHUURUKDYLQJWKHVPDOOHVWVHFRQGVYDOXHRFFXUUHG¿UVW
Error Occurrence Occurrence
time
code
date
10300 0000.00.00 00:00:19 00257D tiphscan____
3D0004 ScnCmFnc.c 2817
10302 0000.00.00 00:00:10 00258D tiphscan____
3D0004 400000,00 00 00 609C 6098
Error code that occurred second
Code of the error that occurred first.
Perform troubleshooting with this error
code.
FRRB201004.ai
Error codes displayed on the Console screen
A
„ Error Occurrence Time Recording in Error Log
Error code that occurred last
Error code that
occurred second
Code of the error
that occurred first.
Perform
troubleshooting
with this error
code.
„ Purpose of Grouping Errors and Identifying Error that Occurred First
If two or more errors are logged and you perform troubleshooting in accordance with the
error that is not responsible for the encountered trouble, troubleshooting will not easily be
accomplished. It is therefore necessary to locate the error responsible for the encountered
WURXEOH WKHHUURUWKDWRFFXUUHG¿UVW EHIRUHSURFHHGLQJWRFRQGXFWWURXEOHVKRRWLQJ
FRRB201002.ai
014-247-01E
05.31.2013 FM6150
CR-IR 359 Service Manual
MT-3
MT-4
1.2.3
Analysis on the Error Code Table
:KHQWKHHUURUFDXVLQJWKHIDLOXUHLVLGHQWL¿HGVHHWKH³3UREDEOH&DXVHDQG5HPHG\´LQWKH
error code table, and proceed with the operation.
„ Error Code Table Description
The error code table lists error codes in ascending order to facilitate your error code search.
Each error code is furnished with an error name and a brief description of error occurrence
conditions.
014-247-01E
05.31.2013 FM6150
CR-IR 359 Service Manual
MT-4
MT-5
„ Error Code Detail
z Y: Error category
1XYZZ
00 to 99: Reference number for each error category
0 to 9: Error category
0 to 4: Error level
1:
1 for all RU errors
z X: Error level
FRRB201005.ai
Error level notations
FATAL error: 0
7KHXVHULVQRWL¿HGRIDQHUURURFFXUUHQFH
- Level of error where the routine processing cannot be resumed.
- It is necessary to immediately troubleshoot and take remedial action.
26 RSHUDWLQJV\VWHPVRIWZDUH OLEUDULHV
,PDJHSURFHVVLQJ&38
6FDQQHUFRQWURO IRUIURQWVLGH
&RQYH\DQFHFRQWURO
2YHUDOOFRQWURO
1HWZRUNFRQWURO
6FDQQHUFRQWURO IRUEDFNVLGH
(OHFWULFDOKDUGZDUHUHODWHG
5HVHUYHG
2WKHUV VRIWZDUHLQVWDOODWLRQYHUVLRQXSGDWHHWF
z ZZ: Reference number
It is managed according to each error category.
WARNING: 2
$QHUURULVORJJHGEXWWKHXVHULVQRWQRWL¿HG
- Level of error where the function associated with the error is rendered unusable.
- It is necessary to immediately troubleshoot and take remedial action.
WARNING: 1
7KHXVHULVQRWL¿HGRIDQHUURURFFXUUHQFH
- Errors that occur due to erroneous user operation (incorrect loading of the cassette or IP,
etc.).
- If this level of error occurred at the same time with another level of warning, it is necessary
to troubleshoot and take remedial action.
WARNING: 4
$QHUURULVORJJHGEXWWKHXVHULVQRWQRWL¿HG
- Errors that occur when a retry operation is performed.
- If the same error occurs frequently and if this level of error occurs at the same time with
another level of warning, it is necessary to troubleshoot and take remedial action.
WARNING: 3
$QHUURULVORJJHGEXWWKHXVHULVQRWQRWL¿HG
- Errors that occur when servicing procedures are performed.
014-247-01E
05.31.2013 FM6150
CR-IR 359 Service Manual
MT-5
MT-6
1.3
Turning OFF the High-Voltage Switch
CAUTION
Be sure to turn OFF the high-voltage switch when troubleshooting is to be made with
the machine cover removed and the power supply turned ON.
The photomultiplier gets damaged if the power supply of the machine is turned ON
while the high-voltage switch is ON.
(1)
Remove the front cover and the right-hand side cover.
{MC:3.1_Cover}
(2)
Remove the right-hand side board box plate.
{MC:3.2_Plate}
(3)
Turn OFF the high-voltage switch (S11) of the CPU board.
014-247-01E
05.31.2013 FM6150
CR-IR 359 Service Manual
MT-6
MT-7
2.
Error Code Table
Error
Code
10001
10002
10003
10004
014-247-01E
05.31.2013 FM6150
Error Name
File open error (1)
File read error (1)
File format error (1)
File write error (1)
Occurrence Condition
Probable Cause and Remedy
[During bootup]
:KHQWKH¿OHLVORDGHGIURPWKH)/$6+520RQWKH&38
ERDUGLQWRWKH'5$0HUURULVGHWHFWHGIRUWKH¿OHUHVLGLQJLQ
WKH)/$6+520$OWHUQDWLYHO\DQHUURULVGHWHFWHGIRUWKH¿OH
residing in the DRAM.
[During bootup]
:KHQWKH¿OHLVORDGHGIURPWKH)/$6+520RQWKH&38
ERDUGLQWRWKH'5$0HUURULVGHWHFWHGIRUWKH¿OHUHVLGLQJLQ
WKH)/$6+520$OWHUQDWLYHO\DQHUURULVGHWHFWHGIRUWKH¿OH
residing in the DRAM.
[During bootup]
:KHQWKH¿OHLVORDGHGIURPWKH)/$6+520RQWKH&38
ERDUGLQWRWKH'5$0HUURULVGHWHFWHGIRUWKH¿OHUHVLGLQJLQ
WKH)/$6+520$OWHUQDWLYHO\DQHUURULVGHWHFWHGIRUWKH¿OH
residing in the DRAM.
[During bootup]
:KHQWKH¿OHLVORDGHGIURPWKH)/$6+520RQWKH&38
board into the DRAM,
HUURULVGHWHFWHGIRUWKH¿OHUHVLGLQJLQWKH)/$6+520
$OWHUQDWLYHO\DQHUURULVGHWHFWHGIRUWKH¿OHUHVLGLQJLQWKH
DRAM.
8SGDWHWKHYHUVLRQDQGUHSDLUWKHVFDQQHUSDUDPHWHU¿OH
5HVWRUHWKHVFDQQHUPDFKLQHVSHFL¿FGDWDWRUHSDLULW
- Replace the CPU board.
8SGDWHWKHYHUVLRQDQGUHSDLUWKHVFDQQHUSDUDPHWHU¿OH
5HVWRUHWKHVFDQQHUPDFKLQHVSHFL¿FGDWDWRUHSDLULW
- Replace the CPU board.
8SGDWHWKHYHUVLRQDQGUHSDLUWKHVFDQQHUSDUDPHWHU¿OH
5HVWRUHWKHVFDQQHUPDFKLQHVSHFL¿FGDWDWRUHSDLULW
- Replace the CPU board.
8SGDWHWKHYHUVLRQDQGUHSDLUWKHVFDQQHUSDUDPHWHU¿OH
5HVWRUHWKHVFDQQHUPDFKLQHVSHFL¿FGDWDWRUHSDLULW
- Replace the CPU board.
CR-IR 359 Service Manual
MT-7
MT-8
Error
Code
10005
10207
Error Name
File close error (1)
SED board power supply error
Occurrence Condition
Probable Cause and Remedy
[During bootup]
:KHQWKH¿OHLVORDGHGIURPWKH)/$6+520RQWKH&38
ERDUGLQWRWKH'5$0HUURULVGHWHFWHGIRUWKH¿OHUHVLGLQJLQ
WKH)/$6+520$OWHUQDWLYHO\DQHUURULVGHWHFWHGIRUWKH¿OH
residing in the DRAM.
[During bootup or routine processing]
An error about the connection (power supply) with the leadingedge detection (SED) board was detected.
8SGDWHWKHYHUVLRQDQGUHSDLUWKHVFDQQHUSDUDPHWHU¿OH
5HVWRUHWKHVFDQQHUPDFKLQHVSHFL¿FGDWDWRUHSDLULW
- Replace the CPU board.
- Check the CPU board fuses. Replace the Alpha II power supply, the
PIF63A board and CPU board if the fuse blowout recurs immediately
after replacement of the fuses.
- Reseat the SED board connectors.
- Replace the SED board.
- Replace the cables connecting from the SED board to the CPU
board.
- Replace the CPU board.
10220
HV high voltage power supply
error
[During bootup]
An error was detected as the HV high voltage data were out
of range.
- Check the CPU board fuses. Replace the Alpha II power supply, the
PIF63A board and CPU board if the fuse blowout recurs immediately
after replacement of the fuses.
- Reseat the PMT board connectors.
- Replace the PMT board.
- Replace the cables connecting from the PMT board to the CPU
board.
- Replace the CPU board.
014-247-01E
05.31.2013 FM6150
CR-IR 359 Service Manual
MT-8
MT-9
Error
Code
10222
Error Name
PMT 15V voltage error
Occurrence Condition
Probable Cause and Remedy
[During bootup or routine processing]
An error is detected for the PMT analog power supply signal
(+15VOKH, 15VOKL).
- Check the CPU board fuses. Replace the Alpha II power supply, the
PIF63A board and CPU board if the fuse blowout recurs immediately
after replacement of the fuses.
- Reseat the PMT board connectors.
- Replace the PMT board.
- Replace the cables connecting from the PMT board to the CPU
board.
- Replace the CPU board.
10223
HV-ON high-voltage value error
[During bootup]
An error was detected as the HV high voltage data were out
of range when HV is on.
- Check the fuses of the CPU board. Replace the Alpha II power
supply, the PIF63A board and the CPU board if the fuse blowout
recurs immediately after replacement of the fuses.
- Reseat the PMT board connectors.
- Replace the PMT board.
- Replace the cables connecting from the PMT board to the CPU
board.
- Replace the CPU board.
- Check the CPU board fuses. Replace the Alpha II power supply, the
PIF63A board and CPU board if the fuse blowout recurs immediately
after replacement of the fuses.
10240
SYN interval count error
[During bootup]
An error was detected for the out-of-range SYN interval count.
- Reseat the connectors connecting with the scanning optics unit.
- Replace the scanning optics unit.
- Replace the cables connecting from the SYN board to the CPU
board.
- Replace the CPU board.
014-247-01E
05.31.2013 FM6150
CR-IR 359 Service Manual
MT-9
MT-10
Error
Code
10248
Error Name
Polygon lock timeout (2nd)
Occurrence Condition
Probable Cause and Remedy
[During bootup or routine processing]
The polygon OK signal cannot be detected (twice) within the
VSHFL¿HGWLPHDIWHUWXUQLQJRQWKHSRO\JRQ
- Check the CPU board fuses. Replace the Alpha II power supply, the
PIF63A board and CPU board if the fuse blowout recurs immediately
after replacement of the fuses.
- Reseat the connectors connecting with the scanning optics unit.
- Replace the scanning optics unit.
- Replace the cables connecting from the SYN board to the CPU
board.
- Replace the CPU board.
- Check the CPU board fuses. Replace the Alpha II power supply, the
PIF63A board and CPU board if the fuse blowout recurs immediately
after replacement of the fuses.
[During routine processing]
10250
Leading edge detection timeout The interrupt for detecting the leading edge did not occur
ZLWKLQWKHVSHFL¿HGWLPH
- Reseat the SED board connectors.
- Replace the SED board.
- Replace the cables connecting from the SED board to the CPU
board.
- Replace the CPU board.
- Check the error log for other errors. If any error occurs, analyze it.
- Check the CPU board fuses. Replace the Alpha II power supply, the
PIF63A board and CPU board if the fuse blowout recurs immediately
after replacement of the fuses.
10252
Image read error
[During bootup or routine processing]
The image reading error occurred.
- Reseat the connectors connecting with the scanning optics unit.
- Replace the scanning optics unit.
- Replace the SED board.
- Replace the cables connecting from the SED board to the CPU
board.
- Replace the CPU board.
014-247-01E
05.31.2013 FM6150
CR-IR 359 Service Manual
MT-10
MT-11
Error
Code
Error Name
Occurrence Condition
Probable Cause and Remedy
10253
),)2RYHUÀRZ
[During bootup or routine processing]
7KHLPDJHEXIIHU),)2ZDVRYHUÀRZHG
10287
Light-shielding check
[During routine processing]
It was detected that the QL value was 80 or more when
detecting S-value shift.
Cassette hold sensor
combination inconsistency
[During bootup]
The cassette width sensors detected an abnormal
combination when the cassette set unit performed a cassette
hold operation. The cassette IN sensor (SA1) detected that no
cassette was present (OPEN). The cassette hold sensor (SA2)
detected a cassette hold release (CLOSED). The cassette
ejection sensor (SA11) detected that no cassette was present
(OPEN).
10311
10312
014-247-02E
01.31.2014 FM8222
Cassette sensor combination
inconsistency (1)
- Replace the CPU board.
- Check the installation of the plate.
- Perform the check and the removal/reinstallation of the coaxial cable
of the PMT board.
[During bootup]
The cassette width sensors in the cassette set unit detected
an abnormal combination. The cassette IN sensor (SA1)
detected a cassette (CLOSED). The cassette ejection sensor
(SA11) detected that no cassette was present (OPEN).
- Check for abnormalities in installing the cassette hold mechanism.
- Check the detecting area of the sensor (SA2) for smears.
- Reseat the sensor (SA2) connector.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Replace the sensors.
- Check for breakage of the sensor actuators (SA1 and SA11).
- Reseat the sensor connectors.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Replace the sensors.
CR-IR 359 Service Manual
MT-11
MT-12
Error
Code
Error Name
Occurrence Condition
Probable Cause and Remedy
[When an error occurs in mechanism operations]
- Check assembly of the mechanism.
10325
Cassette cover closing
mechanism HP release error
[During bootup or routine processing]
When a home position release operation was performed for
the cassette cover closing mechanism, the cassette cover
closing mechanism driving motor (MA2) was driven. However,
the cassette cover closing mechanism HP sensor (SA8) did
not OPEN within a predetermined period of time. Although
retries were performed, the maximum retry count was
exceeded. Or, the error was detected when driving/stopping
the motor.
[When the mechanism normally works]
- Check the detecting areas of the sensors for smears.
- Reseat the sensor connectors.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When the error 12486 concurrently occurs]
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
[When an error occurs in mechanism operations]
- Check assembly of the mechanism.
10326
Cassette cover closing
mechanism home positioning
error
[During bootup or routine processing]
When an attempt was made to return the cassette cover
closing mechanism to its home position, the cassette cover
closing mechanism driving motor (MA2) was driven. However,
the cassette cover closing mechanism HP sensor (SA8) did
not CLOSE within a predetermined period of time. Although
retries were performed, the maximum retry count was
exceeded. Or, the error was detected when driving/stopping
the motor.
[When the mechanism normally works]
- Check for breakage of the sensor actuators.
- Reseat the SND board connectors.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When the error 12486 concurrently occurs]
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
014-247-01E
05.31.2013 FM6150
CR-IR 359 Service Manual
MT-12
MT-13
Error
Code
Error Name
Occurrence Condition
Probable Cause and Remedy
- Check the detecting areas of the sensors for smears.
10327
Debris fall prevention shutter
close error during bootup
[During bootup]
When a home positioning operation was performed for the
cassette cover opening mechanism, it was found that the
debris fall prevention shutter sensor (SA3) was CLOSED (the
shutter was closed).
- Reseat the sensor connectors.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Check that no debris falls in an opening of the debris fall prevention
shutter.
- Replace the sensors.
[When an error occurs in mechanism operations]
10328
IP hold release error during
bootup
[During bootup]
When a home positioning operation was performed for the
cassette cover opening mechanism, it was found that the
cassette IP holding sensor (SA10) was OPEN (the IP was
held and a new cassette was detected).
- Check assembly of the mechanism.
[When the mechanism normally works]
- Check for breakage of the sensor actuators.
- Reseat the SND board connectors.
- Replace the sensors.
[When an error occurs in mechanism operations]
- Check assembly of the mechanism.
10329
Cassette cover opening
mechanism HP detection error
[During bootup or routine processing]
When a home positioning operation was performed for the
cassette cover opening mechanism, the cassette cover
opening mechanism driving motor (MA1) was driven by one
pulse. However, the cassette cover opening mechanism HP
sensor (SA7) did not CLOSE within a predetermined period
of time. Although retries were performed, the maximum
retry count was exceeded. Or, the error was detected when
driving/stopping the motor.
[When the mechanism normally works]
- Check for breakage of the sensor actuators.
- Reseat the SND board connectors.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When the error 12485 concurrently occurs]
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
014-247-01E
05.31.2013 FM6150
CR-IR 359 Service Manual
MT-13
MT-14
Error
Code
Error Name
Occurrence Condition
Probable Cause and Remedy
[When an error occurs in mechanism operations]
10332
Debris fall prevention shutter
open error (1)
[During bootup or routine processing]
When a home positioning operation was performed for the
cassette cover opening mechanism, the cassette cover
opening mechanism driving motor (MA1) was driven (to
perform an approaching operation). However, the debris fall
prevention shutter sensor (SA3) detected that the shutter was
open.
- Check assembly of the mechanism.
[When the mechanism normally works]
- Check for breakage of the sensor actuators.
- Reseat the SND board connectors.
- Check that no debris falls in an opening of the debris fall prevention
shutter.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When an error occurs in mechanism operations]
10333
Debris fall prevention shutter
open error (2)
[During bootup or routine processing]
When a home positioning operation was performed for the
cassette cover opening mechanism, the cassette cover
opening mechanism driving motor (MA1) was driven (to
perform a returning operation). However, the debris fall
prevention shutter sensor (SA3) detected that the shutter was
open.
- Check assembly of the mechanism.
[When the mechanism normally works]
- Check for breakage of the sensor actuators.
- Reseat the SND board connectors.
- Check that no debris falls in an opening of the debris fall prevention
shutter.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When an error occurs in mechanism operations]
- Check assembly of the mechanism.
10334
Debris fall prevention shutter
open error (3)
[During bootup or routine processing]
When a home positioning operation was performed for the
cassette cover opening mechanism, the cassette cover
opening mechanism driving motor (MA1) was driven by one
pulse. However, the debris fall prevention shutter sensor (SA3)
detected that the shutter was open.
[When the mechanism normally works]
- Check for breakage of the sensor actuators.
- Reseat the SND board connectors.
- Check that no debris falls in an opening of the debris fall prevention
shutter.
- Check the SND board fuses.
- Replace the sensors or the motors.
014-247-01E
05.31.2013 FM6150
CR-IR 359 Service Manual
MT-14
MT-15
Error
Code
Error Name
Occurrence Condition
Probable Cause and Remedy
[When an error occurs in mechanism operations]
- Check assembly of the mechanism.
10336
Suction arm home positioning
error
[During bootup or routine processing]
When a suction arm home positioning operation was
performed, the suction arm driving motor (MA3) was driven.
However, it was impossible to detect that the suction arm HP
sensor (SA6) was OPEN or CLOSED. Although two retries
were performed, the sensor status was not detected, and the
system went down. Or, the error was detected when driving/
stopping the motor.
[When the mechanism normally works]
- Check the detecting areas of the sensors for smears.
- Reseat the sensor connectors.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When the error 12485 or 12491 concurrently occurs]
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
10340
10343
Cassette size sensor
combination error (2)
IP drop detection during bootup
[During bootup]
When a remaining IP search process was performed, the
cassette IN sensor and cassette ejection sensor in the
cassette set unit detected an abnormal combination. The
cassette ejection sensor (SA11) detected that no cassette
was present (OPEN). However, the cassette IN sensor (SA1)
detected a cassette (CLOSED).
[During bootup]
When a remaining IP search process was performed, the IP
GURSSLQJVHQVRU 6$ GHWHFWHGDQ,3 &/26(' WR¿QGWKDW
an IP was dropped.
- Check the detecting areas of the sensors for smears.
- Reseat the sensor connectors.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Replace the sensors.
- Check the sensors for smears (on the light-receiving and lightemitting regions).
- Reseat the sensor connectors.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Replace the sensors.
014-247-01E
05.31.2013 FM6150
CR-IR 359 Service Manual
MT-15
MT-16
Error
Code
Error Name
Occurrence Condition
Probable Cause and Remedy
[When an error occurs in mechanism operations]
- Check assembly of the mechanism.
10344
IP holding arm release error
during bootup (1)
[During bootup]
When an attempt was made to release the cassette IP
holding arm from the IP holding position, the cassette IP
holding sensor (SA10) was OPEN (the IP was held and a new
cassette was detected). Although retries were performed,
the maximum retry count was exceeded. Or, the error was
detected when driving the motor.
[When the mechanism normally works]
- Check for breakage of the sensor actuators.
- Reseat the SND board connectors.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When the error 12485 concurrently occurs]
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
[When an error occurs in mechanism operations]
- Check assembly of the mechanism.
10345
IP holding arm release error
during bootup (2)
[During bootup]
When an attempt was made to release the cassette IP holding
arm from the IP holding position while the cassette cover
opening mechanism was in the cassette cover open position,
the cassette IP holding sensor (SA10) was OPEN (the IP was
held and a new cassette was detected). Although retries were
performed, the maximum retry count was exceeded. Or, the
error was detected when driving the motor.
[When the mechanism normally works]
- Check for breakage of the sensor actuators.
- Reseat the SND board connectors.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When the error 12485 concurrently occurs]
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
014-247-01E
05.31.2013 FM6150
CR-IR 359 Service Manual
MT-16
MT-17
Error
Code
10346
Error Name
Occurrence Condition
Probable Cause and Remedy
Feed IP drop detection during
bootup (1)
[During bootup]
When an IP feed operation was performed for a remaining IP
search process, the IP dropping sensor (SA4) detected an IP
&/26(' WR¿QGWKDWDQ,3ZDVGURSSHG
- Check the sensors for smears (on the light-receiving and lightemitting regions).
- Reseat the sensor connectors.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Replace the sensors.
10347
IP sensor combination error
[During bootup]
When a remaining IP search process was performed, the IP
dropping sensor (SA4) and conveyor unit IP sensor 1 (SC3)
were CLOSED (detected an IP). Therefore, the system went
down.
- Check the detecting areas of the sensors for smears.
- Reseat the sensor connectors.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Replace the sensors.
[When a conveyance error occurs]
- Check for mixture of debris in the IP conveyance path.
10348
Remaining IP conveyance error
(conveyor unit)
[During bootup]
When a remaining IP search process was performed, the
IP transport motors (MZ1, MA4, and MC1) were driven.
However, the IP dropping sensor (SA4) in the cassette set
unit did not CLOSE within a predetermined period of time (did
not detect an IP). It is conceivable that the IP may be jammed
in the conveyor unit.
- Check for abnormalities in rotation of the conveyance roller.
[When no conveyance error occurs]
- Check the detecting areas of the sensors for smears.
- Reseat the sensor connectors.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Check the SND board fuses.
- Replace the sensors or the motors.
014-247-01E
05.31.2013 FM6150
CR-IR 359 Service Manual
MT-17
MT-18
Error
Code
Error Name
Occurrence Condition
Probable Cause and Remedy
[When a conveyance error occurs]
- Check for mixture of debris in the IP conveyance path.
10349
Remaining IP conveyance error
(sub scanning)
[During bootup]
When a remaining IP search process was performed, the IP
transport motors (MZ1, MA4, and MC1) were driven. However,
WKH,3VHQVRU 6* LQWKHKRXVLQJXQLWGLGQRW&/26(
within a predetermined period of time (did not detect an IP). It
is conceivable that the IP may be jammed in the subscanning
unit.
- Check for abnormalities in rotation of the conveyance roller.
[When no conveyance error occurs]
- Check the detecting areas of the sensors for smears.
- Reseat the sensor connectors.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When a conveyance error occurs]
- Check for mixture of debris in the IP conveyance path.
- Check for abnormalities in rotation of the conveyance roller.
10353
Remaining IP length
measurement conveyance error
(1)
[During bootup]
When a remaining IP length measurement process was
performed, the IP transport motors (MZ1, MA4, and MC1)
were driven. However, IP sensor 1 (SC3) in the conveyor unit
did not CLOSE (did not detect an IP) within a predetermined
period of time. Or, the error was detected when driving one of
the motors.
[When no conveyance error occurs]
- Check the detecting areas of the sensors for smears.
- Reseat the sensor connectors.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When the error 12485 concurrently occurs]
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
014-247-01E
05.31.2013 FM6150
CR-IR 359 Service Manual
MT-18
MT-19
Error
Code
Error Name
Occurrence Condition
Probable Cause and Remedy
[When a conveyance error occurs]
- Check for mixture of debris in the IP conveyance path.
- Check for abnormalities in rotation of the conveyance roller.
10354
Remaining IP length
measurement conveyance error
(2)
[During bootup]
When a remaining IP length measurement process was
performed, the IP transport motors (MZ1, MA4, and MC1)
were driven. However, IP sensor 1 (SC3) in the conveyor
XQLWGLGQRW23(1 GLGQRW¿QGWKDWQR,3ZDVSUHVHQW ZLWKLQ
a predetermined period of time. Or, the error was detected
when stopping one of the motors.
[When no conveyance error occurs]
- Check the detecting areas of the sensors for smears.
- Reseat the sensor connectors.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When the error 12485 concurrently occurs]
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
[When a conveyance error occurs]
- Check for mixture of debris in the IP conveyance path.
- Check for abnormalities in rotation of the conveyance roller.
10355
Remaining IP length
measurement conveyance error
(3)
[During bootup]
When a remaining IP length measurement process was
performed, the IP transport motors (MZ1, MA4, and MC1)
were driven. However, IP sensor 1 (SC3) in the conveyor
XQLWGLGQRW23(1 GLGQRW¿QGWKDWQR,3ZDVSUHVHQW ZLWKLQ
a predetermined period of time. Or, the error was detected
when driving/stopping one of the motors.
[When no conveyance error occurs]
- Check the detecting areas of the sensors for smears.
- Reseat the sensor connectors.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When the error 12485 concurrently occurs]
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
014-247-01E
05.31.2013 FM6150
CR-IR 359 Service Manual
MT-19
MT-20
Error
Code
Error Name
Occurrence Condition
Probable Cause and Remedy
- Check the detecting areas of the sensors for smears.
10356
Nonstandard IP detection
- Check to make sure that the sensors (SC3 and SC9) normally work
by means of the monitor function of the RU PC-TOOL.
[During bootup]
When a remaining IP length measurement process was
performed, a nonstandard IP size was detected.
- Replace the sensors.
[When a conveyance error occurs]
- Check for mixture of debris in the IP conveyance path.
- Check for abnormalities in rotation of the conveyance roller.
- Check the detecting areas of the sensors for smears.
- Check to make sure that the sensor (SC3) normally work by means
of the monitor function of the RU PC-TOOL.
10358
Remaining IP side-positioning
error (1)
[During bootup]
When a remaining IP side-positioning process was performed,
the IP transport motors (MA4, MC1, and MZ1) were driven.
However, IP sensor 1 (SC3) in the conveyor unit did not
CLOSE (did not detect an IP) within a predetermined period
of time. Or, the error was detected when driving/stopping the
motor.
- Replace the sensors.
[When a conveyance error occurs]
- Check for mixture of debris in the IP conveyance path.
- Check for abnormalities in rotation of the conveyance roller.
[When the error 12485 concurrently occurs]
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
10359
014-247-01E
05.31.2013 FM6150
Remaining IP search error
[During bootup]
When a remaining IP search process was performed, the IP
transport motors (MA4, MC1, and MZ1) were driven. However,
one of the motor had an error.
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
CR-IR 359 Service Manual
MT-20
MT-21
Error
Code
10360
Error Name
Occurrence Condition
Probable Cause and Remedy
Feed IP drop detection during
bootup (2)
[During bootup]
When an IP feed operation was performed within the cassette
for a remaining IP ejection process, the IP dropping sensor
6$ GHWHFWHGDQ,3 &/26(' WR¿QGWKDWDQ,3ZDV
dropped.
- Check the sensors for smears (on the light-receiving and lightemitting regions).
- Reseat the sensor connectors.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Replace the sensors.
[When an error occurs in mechanism operations]
- Check assembly of the mechanism.
10361
Cassette cover opening
mechanism home positioning
error
[During bootup or routine processing]
When a home positioning operation was performed for the
cassette cover opening mechanism, the cassette cover
opening mechanism driving motor (MA1) was driven.
However, it was impossible to detect that the cassette
cover opening mechanism HP sensor (SA7) was OPEN or
CLOSED. Although two retries were performed, the sensor
status was not detected, and the system went down. Or, the
error was detected when driving/stopping the motor.
[When the mechanism normally works]
- Check the detecting areas of the sensors for smears.
- Reseat the sensor connectors.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When the error 12485 concurrently occurs]
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
014-247-01E
05.31.2013 FM6150
CR-IR 359 Service Manual
MT-21
MT-22
Error
Code
Error Name
Occurrence Condition
Probable Cause and Remedy
[When a conveyance error occurs]
- Check for mixture of debris in the IP conveyance path.
- Check for abnormalities in rotation of the conveyance roller.
[When no conveyance error occurs]
10364
Remaining IP load conveyance
error during bootup (1)
[During bootup]
When a remaining IP ejection process was performed, the IP
transport motors (MA4 and MC1) were driven. However, IP
VHQVRU 6* LQWKHKRXVLQJXQLWGLGQRW&/26( GLGQRW
detect an IP) within a predetermined period of time. Or, the
error was detected when driving one of the motors.
- Check the detecting areas of the sensors for smears.
- Reseat the sensor connectors.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When the error 12485 concurrently occurs]
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
014-247-01E
05.31.2013 FM6150
CR-IR 359 Service Manual
MT-22
MT-23
Error
Code
Error Name
Occurrence Condition
Probable Cause and Remedy
[When a conveyance error occurs]
- Check for mixture of debris in the IP conveyance path.
- Check for abnormalities in rotation of the conveyance roller.
10365
Remaining IP load conveyance
error during bootup (2)
[During bootup]
When a remaining IP ejection process was performed, the IP
transport motors (MA4 and MC1) were driven. However, IP
VHQVRU 6* LQWKHKRXVLQJXQLWGLGQRW23(1 GLGQRW¿QG
that no IP was present) within a predetermined period of time.
Or, the error was detected when driving/stopping one of the
motors.
[When no conveyance error occurs]
- Check the detecting areas of the sensors for smears.
- Reseat the sensor connectors.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When the error 12485 concurrently occurs]
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
Cassette hold release error
[During bootup or routine processing]
An error was detected when releasing the cassette hold.
- Update the version to the newest version.
10373
Cassette hold error
[During bootup or routine processing]
An error was detected when holding cassette.
- Update the version to the newest version.
10379
014-247-01E
05.31.2013 FM6150
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
CR-IR 359 Service Manual
MT-23
MT-24
Error
Code
Error Name
Occurrence Condition
Probable Cause and Remedy
[When an error occurs in mechanism operations]
- Check assembly of the mechanism.
[When the mechanism normally works]
10380
Cassette cover opening
mechanism error
[During routine processing]
The cassette cover opening mechanism driving motor
(MA1) was driven to close the debris fall prevention shutter.
However, the cassette cover opening mechanism HP sensor
(SA7) was CLOSED. Or, the error was detected when driving
the motor.
- Check the detecting areas of the sensors for smears.
- Reseat the sensor connectors.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When the error 12485 concurrently occurs]
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
IP fall prevention driving error
[During routine processing]
An error was detected when driving the cassette cover
opening mechanism driving motor (MA1) for IP fall prevention.
- Update the version to the newest version.
10382
Opening cover error
[During routine processing]
An error was detected when driving the cassette cover
opening mechanism driving motor (MA1) to open the cover.
- Update the version to the newest version.
10386
014-247-01E
05.31.2013 FM6150
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
CR-IR 359 Service Manual
MT-24
MT-25
Error
Code
10389
10390
Error Name
Occurrence Condition
Probable Cause and Remedy
Feed IP suction error
[During routine processing]
Driving of the suction arm driving motor (MA3), turning on/
off of the IP leak valve (SVA1), turning on/off of the suction
switching valve (SVA2), and turning on of the IP suction pump
(PA1) were performed in the feed IP suction operation. Error
was detected in either operation.
Feed IP error
[During bootup or routine processing]
Turning off of the leak valve (SVA1), turning off of the suction
switching valve (SVA2), driving of the cassette cover opening
mechanism driving motor (MA1), driving of the suction arm
driving motor (MA3), and driving of the the IP transport motors
(MA4) were performed in the IP-feed operation. Error was
detected in either operation.
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
[When an error occurs in mechanism operations]
- Check assembly of the mechanism.
10391
IP holding arm release error (1)
[During routine processing]
The cassette cover opening mechanism driving motor (MA1)
was driven to release the cassette IP holding arm from the IP
holding position after IP suction. However, it was found that
the cassette IP holding sensor (SA10) was OPEN (the IP was
held and a new cassette was detected). Or, the error was
detected when driving the motor.
[When the mechanism normally works]
- Check for breakage of the sensor actuators.
- Reseat the SND board connectors.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When the error 12485 concurrently occurs]
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
014-247-01E
05.31.2013 FM6150
CR-IR 359 Service Manual
MT-25
MT-26
Error
Code
10392
Error Name
Feed IP leak error
Occurrence Condition
Probable Cause and Remedy
[During routine processing]
Turning on of the IP leak valve (SVA1), turning on of the
suction switching valve (SVA2), and turning off of the
IP suction pump (PA1) were performed in the feed-leak
operation. An error was detected in either operation.
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
[When an error occurs in mechanism operations]
- Check assembly of the mechanism.
10393
Feed IP holding error
[During routine processing]
The cassette cover opening mechanism driving motor (MA1)
for IP holding was driven. However, it was found that the
cassette IP holding sensor (SA10) was OPEN (the IP was
held and a new cassette was detected). Although retries were
performed, the maximum retry count was exceeded. Or, the
error was detected when driving the motor.
[When the mechanism normally works]
- Check for breakage of the sensor actuators.
- Reseat the SND board connectors.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When the error 12485 concurrently occurs]
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
014-247-01E
05.31.2013 FM6150
CR-IR 359 Service Manual
MT-26
MT-27
Error
Code
Error Name
Occurrence Condition
Probable Cause and Remedy
[When a conveyance error occurs]
- Check for mixture of debris in the IP conveyance path.
[When no conveyance error occurs]
10395
Pre-length-measurement IP
position detection error (2)
[During routine processing]
The IP transport motor (MA4) was driven to return an IP to
WKHFDVVHWWHDIWHUDQ,3GURS+RZHYHU,3VHQVRU 6* LQ
WKHKRXVLQJXQLWGLGQRW23(1 GLGQRW¿QGWKDWQR,3ZDV
present) within a predetermined period of time. Or, the error
was detected when driving/stopping the motor.
- Check the detecting areas of the sensors for smears.
- Reseat the sensor connectors.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When the error 12485 concurrently occurs]
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
10396
Feed IP conveyance error
[During routine processing]
The IP transport motors (MA4/MC1/MZ1) were driven/stopped
in feed-conveyance operation, and one of the motors had an
error.
10397
Feed IP conveyance retry
stopped error
[During routine processing]
The IP transport motors (MA4/MC1/MZ1) were stopped in
feed-conveyance operation, and one of the motors had an
error.
014-247-01E
05.31.2013 FM6150
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
CR-IR 359 Service Manual
MT-27
MT-28
Error
Code
Error Name
Occurrence Condition
Turn roller nip HP perform error
[During bootup or routine processing]
:KHQDWXUQUROOHUQLSFRQ¿JXUDWLRQKRPHSRVLWLRQLQJZDV
SHUIRUPHGWKHWXUQUROOHUQLSFRQ¿JXUDWLRQGULYLQJPRWRU
(MC2) was driven. However, it was impossible to detect that
WKHWXUQUROOHUQLSFRQ¿JXUDWLRQ+3VHQVRU 6& ZDV23(1
or CLOSED. Although two retries were performed, the sensor
status was not detected, and the system went down. Or, the
error was detected when driving/stopping the motor.
10404
BCR read retry conveyance
error
When an IP return conveyance operation was performed
during routine processing for the purpose of retrying to read a
barcode, the IP transport motors (MA4 and MC1) were driven.
However, the IP dropping sensor (SA4) did not CLOSE (did
not detect an IP) within a predetermined period of time.
10414
Subscanning conveyance error
[During routine processing]
The IP transport motors (MC1/MZ1) were driven/stopped in
reading conveyance, and one of the motors had an error.
10400
014-247-01E
05.31.2013 FM6150
Probable Cause and Remedy
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
CR-IR 359 Service Manual
MT-28
MT-29
Error
Code
Error Name
Occurrence Condition
Probable Cause and Remedy
[When a conveyance error occurs]
- Check for mixture of debris in the IP conveyance path.
10419
Post-reading conveyance error
(1)
[During routing processing]
The IP transport motors (MA4, MC1, and MZ1) were driven to
perform a post-IP-reading conveyance operation. However,
,3VHQVRU 6* LQWKHKRXVLQJXQLWGLGQRW&/26( GLGQRW
detect an IP) within a predetermined period of time. Although
retries were performed, the maximum retry count was
exceeded. Or, the error was detected when driving/stopping
the motor.
- Check for abnormalities in rotation of the conveyance roller.
[When no conveyance error occurs]
- Reseat the SND board connectors.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When the error 12485 concurrently occurs]
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
[When a conveyance error occurs]
- Check for mixture of debris in the IP conveyance path.
- Check for abnormalities in rotation of the conveyance roller.
10420
Erasure conveyance error
[During routine processing]
The IP transport motors (MA4 and MC1) were driven to
perform an IP erasure conveyance operation. However, IP
VHQVRU 6* LQWKHKRXVLQJXQLWGLGQRW23(1 GLGQRW¿QG
that no IP was present) within a predetermined period of time.
Or, the error was detected when driving/stopping one of the
motors.
[When no conveyance error occurs]
- Check the detecting areas of the sensors for smears.
- Reseat the sensor connectors.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When the error 12485 concurrently occurs]
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
014-247-01E
05.31.2013 FM6150
CR-IR 359 Service Manual
MT-29
MT-30
Error
Code
10421
Error Name
IP suction error (after IP
reading)
Occurrence Condition
Probable Cause and Remedy
[During routine processing]
Turning on of the leak valve (SVA1), turning on of the suction
switching valve (SVA2), and driving of the suction arm driving
motor (MA3) were performed in the IP-loading operation.
Error was detected in either operation.
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
[When an IP drops]
- Check for abnormalities of the IP retaining arm mechanism.
10422
Load IP drop (1)
[During routine processing]
After the cassette IP holding arm was released, it was found
that the IP dropping sensor (SA4) was CLOSED (due to
IP detection). Therefore, retries were performed. However,
the maximum retry count was exceeded. Or, the error was
detected when driving the motor.
[When no IP drops]
- Check for abnormalities of the sensors.
[When the error 12485 concurrently occurs]
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
10423
Load IP drop (2)
[During routine processing]
After the cassette cover was closed, it was found that the IP
dropping sensor (SA4) was CLOSED (due to IP detection).
Therefore, retries were performed. However, the maximum
retry count was exceeded.
- Check the sensors for smears (on the light-receiving and lightemitting regions).
- Reseat the sensor connectors.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Check the SND board fuses.
- Replace the sensors or the motors.
014-247-01E
05.31.2013 FM6150
CR-IR 359 Service Manual
MT-30
MT-31
Error
Code
Error Name
Occurrence Condition
Probable Cause and Remedy
[When an error occurs in mechanism operations]
- Check assembly of the mechanism.
[When the mechanism normally works]
10424
IP holding error
[During routine processing]
The cassette cover opening mechanism driving motor (MA1)
was driven to prevent an IP drop. However, it was found that
the cassette IP holding sensor (SA10) was CLOSED (the IP
was not held and an old cassette was detected). Although
retries were performed, the maximum retry count was
exceeded. Or, the error was detected when driving the motor.
- Check the detecting areas of the sensors for smears.
- Reseat the sensor connectors.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When the error 12485 concurrently occurs]
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
[When a conveyance error occurs]
- Check for mixture of debris in the IP conveyance path.
10425
IP suction positioning
preliminary conveyance error
[During routine processing]
When a suction positioning preliminary conveyance operation [When no conveyance error occurs]
- Reseat the SND board connectors.
was performed for a load IP, the IP transport motor (MA4) was
- Check the SND board fuses.
GULYHQ+RZHYHU,3VHQVRU 6* LQWKHKRXVLQJXQLWGLGQRW
- Replace the sensors or the motors.
CLOSE (did not detect an IP) within a predetermined period
of time. Or, the error was detected when driving/stopping the
[When the error 12485 concurrently occurs]
motor.
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
014-247-01E
05.31.2013 FM6150
CR-IR 359 Service Manual
MT-31
MT-32
Error
Code
Error Name
Occurrence Condition
Probable Cause and Remedy
[When a conveyance error occurs]
- Check for mixture of debris in the IP conveyance path.
[When no conveyance error occurs]
10426
IP suction positioning
conveyance error
[During routine processing]
When a suction positioning conveyance operation was
performed for a load IP, the IP transport motor (MA4) was
GULYHQ+RZHYHU,3VHQVRU 6* LQWKHKRXVLQJXQLWGLG
QRW23(1 GLGQRW¿QGWKDWQR,3ZDVSUHVHQW ZLWKLQD
predetermined period of time. Or, the error was detected
when driving/stopping the motor.
- Check the detecting areas of the sensors for smears.
- Reseat the sensor connectors.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When the error 12485 concurrently occurs]
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
[When an error occurs in mechanism operations]
- Check assembly of the mechanism.
10427
Debris fall prevention shutter
open error
[During routine processing]
The cassette cover opening mechanism driving motor
(MA1) was driven to release a held IP in the load sequence.
However, it was found that the debris fall prevention shutter
sensor (SA3) was OPEN (the shutter was open).
[When the mechanism normally works]
- Reseat the SND board connectors.
- Check the SND board fuses.
- Check that no debris falls in an opening of the debris fall prevention
shutter.
- Replace the sensors or the motors.
014-247-01E
05.31.2013 FM6150
CR-IR 359 Service Manual
MT-32
MT-33
Error
Code
Error Name
Occurrence Condition
Probable Cause and Remedy
[When an error occurs in mechanism operations]
- Check assembly of the mechanism.
10428
IP hold release error (1)
[During routine processing]
The cassette cover opening mechanism driving motor
(MA1) was driven to release a held IP in the load sequence.
However, it was found that the cassette IP holding sensor
(SA10) was OPEN (the IP was held and a new cassette was
detected). Although retries were performed, the maximum
retry count was exceeded. Or, the error was detected when
driving the motor.
[When the mechanism normally works]
- Check for breakage of the sensor actuators.
- Reseat the SND board connectors.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When the error 12485 concurrently occurs]
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
[When an error occurs in mechanism operations]
- Check assembly of the mechanism.
10429
IP hold release error (2)
[During routine processing]
The cassette cover opening mechanism driving motor
(MA1) was driven to release a held IP in the load sequence.
However, it was found that the cassette IP holding sensor
(SA10) was OPEN (the IP was held and a new cassette was
detected). Although retries were performed, the maximum
retry count was exceeded. Or, the error was detected when
driving the motor.
[When the mechanism normally works]
- Check for breakage of the sensor actuators.
- Reseat the SND board connectors.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When the error 12485 concurrently occurs]
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
014-247-01E
05.31.2013 FM6150
CR-IR 359 Service Manual
MT-33
MT-34
Error
Code
Error Name
Occurrence Condition
Probable Cause and Remedy
[When an error occurs in mechanism operations]
- Check assembly of the mechanism.
10430
Cassette cover opening
mechanism home positioning
error
[During routine processing]
The cassette cover opening mechanism driving motor (MA1)
was driven to achieve cassette cover opening mechanism
home positioning. However, it was found that the debris fall
prevention shutter sensor (SA3) was CLOSED (the shutter
was closed). Although retries were performed, the maximum
retry count was exceeded. Or, the error was detected when
driving the motor.
[When the mechanism normally works]
- Check the detecting areas of the sensors for smears.
- Reseat the sensor connectors.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When the error 12485 concurrently occurs]
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
10432
014-247-01E
05.31.2013 FM6150
IP suction relief error
[During routine processing]
,QWKHORDG,3OHDNRSHUDWLRQWKHIROORZLQJZDVSHUIRUPHG
driving of the IP transport motor (MA4), driving of suction arm
driving motor (MA3), turning off of the IP leak valve (SVA1),
turning off of the suction switching valve (SVA2), and turning
off of the IP suction pump (PA1). Error was detected in one of
the operations.
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
CR-IR 359 Service Manual
MT-34
MT-35
Error
Code
Error Name
Occurrence Condition
Probable Cause and Remedy
[When an error occurs in mechanism operations]
- Check assembly of the mechanism.
[When the mechanism normally works]
10433
IP drop after cassette cover
opening (1)
[During routine processing]
After the cassette cover opening mechanism driving motor
(MA1) was driven to retract the cassette cover opening pin,
it was found that the IP dropping sensor (SA4) was CLOSED
(due to IP detection). Or, the error was detected when driving
the motor.
- Check the sensors for smears (on the light-receiving and lightemitting regions).
- Reseat the sensor connectors.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When the error 12485 concurrently occurs]
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
10434
IP drop after cassette cover
opening (2)
[During routine processing]
After a held IP was released in the load sequence, it was
found that the IP dropping sensor (SA4) was CLOSED (due to
IP detection).
- Check the sensors for smears (on the light-receiving and lightemitting regions).
- Reseat the sensor connectors.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Check the SND board fuses.
- Replace the sensors or the motors.
014-247-01E
05.31.2013 FM6150
CR-IR 359 Service Manual
MT-35
MT-36
Error
Code
Error Name
Occurrence Condition
Probable Cause and Remedy
[When a conveyance error occurs]
- Check for mixture of debris in the IP conveyance path.
- Check for abnormalities in rotation of the conveyance roller.
10435
IP conveyance error
[During bootup or routine processing]
The IP transport motors (MA4, MC1, and MZ1) were driven.
+RZHYHU,3VHQVRU 6* LQWKHKRXVLQJXQLWGLGQRW23(1
GLGQRW¿QGWKDWQR,3ZDVSUHVHQW ZLWKLQDSUHGHWHUPLQHG
period of time. It is conceivable that the IP may be jammed
between the erasure unit and conveyor unit. Or, the error was
detected when driving/stopping the motor.
[When no conveyance error occurs]
- Check the detecting areas of the sensors for smears.
- Reseat the sensor connectors.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When the error 12485 concurrently occurs]
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
[When an error occurs in mechanism operations]
- Check assembly of the mechanism.
10436
Cassette cover closing
mechanism drive error (1)
[During routine processing]
The cassette cover closing mechanism driving motor (MA2)
was driven. However, the cassette cover closing mechanism
HP sensor (SA8) did not CLOSE within a predetermined
period of time. Although retries were performed, the maximum
retry count was exceeded. Or, the error was detected when
driving/stopping the motor.
[When the mechanism normally works]
- Check for breakage of the sensor actuators.
- Reseat the SND board connectors.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When the error 12486 concurrently occurs]
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
014-247-01E
05.31.2013 FM6150
CR-IR 359 Service Manual
MT-36
MT-37
Error
Code
10439
10440
Error Name
Occurrence Condition
Probable Cause and Remedy
Cassette cover closing
mechanism drive error (2)
[During bootup or routine processing]
The cassette cover closing mechanism driving motor (MA2)
was driven and stopped in the operation of home-positioning
the closing cover, and an error was detected in either
operation.
Cassette cover closing
mechanism drive retry error
[During bootup or routine processing]
The operation for driving the cassette cover closing
mechanism was retried, and the cassette cover closing
mechanism driving motor (MA2) was driven and stopped. An
error was detected in either operation.
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
[When an error occurs in mechanism operations]
- Check assembly of the mechanism.
10441
Debris fall prevention shutter
open error (4)
[During bootup or routine processing]
The cassette cover opening mechanism driving motor (MA1)
was driven by one pulse to perform a home positioning
operation for the cassette cover opening mechanism.
However, it was found that the debris fall prevention shutter
sensor (SA3) was OPEN (the shutter was open).
[When the mechanism normally works]
- Check for breakage of the sensor actuators.
- Reseat the SND board connectors.
- Check that no debris falls in an opening of the debris fall prevention
shutter.
- Check the SND board fuses.
- Replace the sensors or the motors.
014-247-01E
05.31.2013 FM6150
CR-IR 359 Service Manual
MT-37
MT-38
Error
Code
Error Name
Occurrence Condition
Probable Cause and Remedy
[When an error occurs in mechanism operations]
- Check assembly of the mechanism.
[When the mechanism normally works]
10443
Bootup cassette cover opening
mechanism home positioning
error
[During bootup]
When the cassette cover opening mechanism was moved
from the reference position to the home position, it was found
that the debris fall prevention shutter sensor (SA3) was OPEN
(the shutter was open). Although retries were performed,
the maximum retry count was exceeded. Or, the error was
detected when driving the motor.
- Check the detecting areas of the sensors for smears.
- Reseat the sensor connectors.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When the error 12485 concurrently occurs]
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
[When an error occurs in mechanism operations]
- Check assembly of the mechanism.
[When the mechanism normally works]
10444
Subscanning grip roller
positioning error
[During bootup]
The subscanning grip motor (MZ2) was driven in the operation
of positioning the subscanning grip roller to the reference
side before IP search, but the subscanning grip sensor (SZ2)
GLGQRWFORVHZLWKLQWKHVSHFL¿HGWLPHSHULRG2UHUURUZDV
detected when driving/stopping the motor.
- Check for breakage of the sensor actuators.
- Check if the motor is working.
- Reseat the SND board connectors.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When the error 12485 concurrently occurs]
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
014-247-01E
05.31.2013 FM6150
CR-IR 359 Service Manual
MT-38
MT-39
Error
Code
Error Name
Occurrence Condition
Probable Cause and Remedy
[When an error occurs in mechanism operations]
- Check assembly of the mechanism.
[When the mechanism normally works]
- Check the detecting areas of the sensors for smears.
10445
Subscanning grip roller free
rotation error
[During bootup or routine processing]
The subscanning grip motor (MZ2) was driven to freely rotate
the subscanning grip roller, but the subscanning grip sensor
6= GLGQRWRSHQZLWKLQWKHVSHFL¿HGWLPHSHULRG2UHUURU
was detected when driving/stopping the motor.
- Reseat the sensor connectors.
- Check if the motor is working.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When the error 12485 concurrently occurs]
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
[When an error occurs in mechanism operations]
- Check assembly of the mechanism.
[When the mechanism normally works]
10446
Subscanning grip roller homepositioning error
[During routine processing]
The subscanning grip motor (MZ2) was driven to make
the subscanning grip roller in the reference position, but
the subscanning grip sensor (SZ2) did not close within the
VSHFL¿HGWLPHSHULRG2UHUURUZDVGHWHFWHGZKHQGULYLQJ
stopping the motor.
- Check for breakage of the sensor actuators.
- Check if the motor is working.
- Reseat the SND board connectors.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When the error 12485 concurrently occurs]
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
014-247-01E
05.31.2013 FM6150
CR-IR 359 Service Manual
MT-39
MT-40
Error
Code
Error Name
Occurrence Condition
Probable Cause and Remedy
[When an error occurs in mechanism operations]
- Check assembly of the mechanism.
[When the mechanism normally works]
10447
Rejection grip roller error
[During routine processing]
In the operation of rejecting grip, the subscanning grip motor
(MZ2) was driven, but the subscanning grip sensor (SZ2)
GLGQRWFORVHZLWKLQWKHVSHFL¿HGWLPHSHULRG2UHUURUZDV
detected when driving/stopping the motor.
- Check for breakage of the sensor actuators.
- Check if the motor is working.
- Reseat the SND board connectors.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When the error 12485 concurrently occurs]
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
- Check the detecting areas of the sensors for smears.
10451
Remaining IP side-positioning
error (2)
[During bootup]
When a remaining IP side-positioning process was performed,
the IP transport motors (MA4, MC1, and MZ1) were driven
WRDFKLHYH,3SRVLWLRQLQJ+RZHYHU,3VHQVRU 6* LQWKH
housing unit was CLOSED.
- Reseat the sensor connectors.
- Check if the motor is working.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When an error occurs in mechanism operations]
- Check assembly of the mechanism.
10456
Cassette cover closing
mechanism HP sensor error
[During bootup or routine processing]
When an attempt was made to place the cassette cover
closing mechanism in its reference position, the cassette
cover CLOSE position sensor (SA12) was not OPEN.
[When the mechanism normally works]
- Check the detecting areas of the sensors for smears.
- Reseat the sensor connectors.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Check the SND board fuses.
- Replace the sensors or the motors.
014-247-01E
05.31.2013 FM6150
CR-IR 359 Service Manual
MT-40
MT-41
Error
Code
10460
Error Name
Bootup cassette new/old
determination error
Occurrence Condition
Probable Cause and Remedy
[During bootup]
The cassette cover opening mechanism driving motor (MA1)
was driven to determine new/old cassette, and error was
detected.
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
[When a conveyance error occurs]
- Check for mixture of debris in the IP conveyance path.
- Check for abnormalities in rotation of the conveyance roller.
10461
Feed conveyance retry error
[During routine processing]
The IP transport motors (MA4, MC1, and MZ1) were driven
to perform an IP return conveyance operation in the feed
FRQYH\DQFHUHWU\VHTXHQFH+RZHYHU,3VHQVRU 6* LQ
the housing unit did not OPEN within a predetermined period
of time. Or, error was detected when driving/stopping one of
the motors.
[When no conveyance error occurs]
- Check the detecting areas of the sensors for smears.
- Reseat the sensor connectors.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When the error 12485 concurrently occurs]
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
[When a conveyance error occurs]
- Check for mixture of debris in the IP conveyance path.
- Check for abnormalities in rotation of the conveyance roller.
10462
Post-reading conveyance error
(2)
[During routing processing]
The IP transport motors (MA4, MC1, and MZ1) were driven to
perform a post-IP-reading conveyance operation. However, IP
sensor 1 (SC3) in the conveyor unit did not CLOSE (did not
detect an IP) within a predetermined period of time. Or, error
was detected when driving one of the motors.
[When no conveyance error occurs]
- Reseat the SND board connectors.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When the error 12485 concurrently occurs]
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
014-247-01E
05.31.2013 FM6150
CR-IR 359 Service Manual
MT-41
MT-42
Error
Code
Error Name
Occurrence Condition
Probable Cause and Remedy
10470
IP conveyance before IP
measurement error
[During routine processing]
A feed-conveyance error occurred before measuring the
IP length, and the IP transport motor (MA4) was driven to
recover, but error was detected.
10471
Arranging IP position
conveyance error
[During routine processing]
An error was detected when the IP transport motor (MA4)
was driven in the processing for positioning IP for feedconveyance.
Roller grip 2 release error
[During routine processing]
Error was detected when driving the subscanning grip motor
(MZ2) for releasing the grip of roller 2.
- Update the version to the newest version.
10472
- Update the version to the newest version.
Roller 2 grip error
[During routine processing]
Error was detected when driving the subscanning grip motor
(MZ2) for engaging the grip of roller 2.
- Update the version to the newest version.
Roller 1 grip release error
[During routine processing]
Error was detected when driving the subscanning grip motor
(MZ2) for releasing error the grip of roller 1.
Turn roller nip error (2)
[During routine processing]
7KHWXUQUROOHUQLSFRQ¿JXUDWLRQGULYLQJPRWRU 0& ZDV
driven to perform a nip operation of the nip in the turn roller
QLSFRQ¿JXUDWLRQ+RZHYHULWZDVLPSRVVLEOHWRGHWHFWWKDWWKH
WXUQUROOHUQLSFRQ¿JXUDWLRQ+3VHQVRU 6& ZDV&/26('
within a predetermined period of time.
10473
10474
10476
014-247-01E
05.31.2013 FM6150
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
CR-IR 359 Service Manual
MT-42
MT-43
Error
Code
Error Name
10710
External erasure data
acquisition error
[During bootup]
,WIDLOHGWRUHDGWKHHUDVXUHGDWD¿OH
- Update the version to the newest version.
- Reseat the ERS board connectors.
ERS board position error
[ During bootup ]
It was found that the ERS board was not mounted in the
correct position. For the correct board position, refer to the
MD volume.
10731
10900
&RQ¿JXUDWLRQLQLWLDOL]DWLRQ
failure
Occurrence Condition
Probable Cause and Remedy
- Replace the CPU board.
- Reseat the SND board connectors (CN5 and CN6).
- Check for coating detachment or breakage of cables.
- Replace the ERS board.
[During bootup]
7KH,FRQ¿JXUDWLRQGDWD ,UVHWFIJ FRXOGQRWEHORDGHGLQWRWKH $JDLQVHWWKHFRQ¿JXUDWLRQLQIRUPDWLRQLQ(',7&21),*85$7,21
6'5$0IURPWKHÀDVK520RQWKH&38ERDUG
&KHFNWKDWWKH&38ERDUG',3VZLWFK 6 LVVHWDVIROORZV
'LS6:1R2))
10904
RU type error
[During bootup]
The RU type acquired by DIPSW of CPU board was not
correct.
'LS6:1R2))
'LS6:1R2))
- Update the version to the newest version.
- Replace the CPU board.
- If any error occurs immediately after replacing the CPU board,
H[HFXWH,QLWLDOL]H$3/
11205
Image signal monitor value
(simulated current) error
[During bootup]
When diagnosing the simulated data transfer, the A/D
conversion data for simulated image were out of range.
- Check the CPU board fuses. Replace the Alpha II power supply, the
PIF63A board and CPU board if the fuse blowout recurs immediately
after replacement of the fuses.
- Reseat the PMT board connectors.
- Replace the PMT board.
- Replace the CPU board.
014-247-02E
01.31.2014 FM8222
CR-IR 359 Service Manual
MT-43
MT-44
Error
Code
Error Name
Occurrence Condition
Probable Cause and Remedy
- Replace the scanning optics unit.
LD drive current value error
(during bootup)
[During bootup]
The laser drive current value (LDIF) is more than 1.4 times
the factory default value.
11268
Shifted sensitivity (±50 to
±70%) (WND&LOG)
[During routine processing]
The calculated SK (current SK) and the initialized SK
(SKSTART) were compared and converted to S-value, and
it was detected if the value was within the range of ±50 to
±70%.
- Replace the light-collecting guide.
11269
Shifted sensitivity (70% or
more) (WND&LOG)
[During routine processing]
The calculated SK (current SK) and the initialized SK
(SKSTART) were compared and converted to S-value, and it
was detected if the value was ±70% or more.
- Replace the light-collecting guide.
11280
Initialization HV-OFF status
[During bootup]
It was found that the high voltage of the photomultiplier (PMT
board) was OFF.
- Turn ON the HV switch of the CPU board. Check that the red LED
on the upper right of the switch is lit.
11230
- Check that there is no excessive rise in the ambient temperature.
The laser drive current value (LDIF) is affected by the ambient
temperature.
[When the cassette is set in the RU]
- Remove the cassette.
11315
Bootup improper cassette
loading detection
[During bootup]
It was found that a cassette was improperly loaded (inserted
obliquely or into a nonreference position).
[When the cassette is not set in the RU]
- Check to make sure that the sensors (SA1 and SA11) normally work
by means of the monitor function of the RU PC-TOOL.
- Check for coating detachment or breakage of cables.
- Replace the sensors.
014-247-01E
05.31.2013 FM6150
CR-IR 359 Service Manual
MT-44
MT-45
Error
Code
Error Name
Occurrence Condition
Probable Cause and Remedy
[When the cassette is set in the RU]
11316
Bootup incomplete cassette
insertion detection
[During bootup]
It was found that a cassette was incompletely inserted.
The cassette IN sensor (SA1) detected that no cassette
was present (OPEN). The cassette ejection sensor (SA11)
detected that a cassette was present (CLOSED).
- Remove the cassette.
[When the cassette is not set in the RU]
- Check to make sure that the sensors normally work by means of the
monitor function of the RU PC-TOOL.
- Check for coating detachment or breakage of cables.
- Replace the sensors.
11341
11342
014-247-01E
05.31.2013 FM6150
Improper cassette loading
detection (1)
[During bootup]
When a remaining IP search process was performed, an
incompletely inserted cassette was detected.
The cassette IN sensor (SA1) detected that a cassette was
present (CLOSED).
The cassette hold sensor (SA2) detected that a cassette hold
was released (CLOSED).
The cassette ejection sensor (SA11) detected that a cassette
was present (CLOSED).
Improper cassette loading
detection (2)
[During bootup]
When a remaining IP search process was performed, an
incompletely inserted cassette was detected.
The cassette IN sensor (SA1) detected that no cassette was
present (OPEN).
The cassette hold sensor (SA2) detected a cassette hold
(OPEN).
The cassette ejection sensor (SA11) detected that a cassette
was present (CLOSED).
- Check to make sure that the sensors normally work by means of the
monitor function of the RU PC-TOOL.
- Check for coating detachment or breakage of cables.
- Replace the sensors.
- Check to make sure that the sensors normally work by means of the
monitor function of the RU PC-TOOL.
- Check for coating detachment or breakage of cables.
- Replace the sensors.
CR-IR 359 Service Manual
MT-45
MT-46
Error
Code
11373
11375
11379
Error Name
Cassette hold retry error
Cassette not detected
Cassette hold release error
Occurrence Condition
Probable Cause and Remedy
[During routine processing]
The cassette hold pin solenoid (SOLA1) turned OFF (cassette
hold). However, the cassette hold sensor (SA2) detected that
a cassette hold was released (CLOSED). Although retries
were performed, the maximum retry count was exceeded. An
error results also when the following operation takes place.
- When the cassette is loaded upside down;
- When the cassette is loaded front side back.
[During routine processing]
The cassette hold pin solenoid (SOLA1) turned OFF (cassette
hold). However, the cassette IN sensor (SA1) detected that no
cassette was present (OPEN).
[During routine processing]
The cassette hold pin solenoid (SOLA1) turned ON (to
release a cassette hold). However, the cassette hold sensor
(SA2) detected a cassette hold (OPEN). Although retries were
performed, the maximum retry count was exceeded.
- Check for abnormalities of the solenoid operation or of the spring.
- Check for coating detachment or breakage of cables.
- Check the SND board fuses.
- Replace the solenoid or the sensors.
- Check for breakage of the sensor actuators.
- Check for abnormalities of the solenoid operation.
- Replace the sensors.
- Check for abnormalities of the solenoid operation.
- Check for coating detachment or breakage of cables.
- Replace the sensors.
[When an error occurs in mechanism operations]
- Check assembly of the mechanism.
11381
Debris fall prevention shutter
close error
[During routine processing]
The cassette cover opening mechanism driving motor (MA1)
was driven to close the debris fall prevention shutter. However,
it was found that the debris fall prevention shutter sensor (SA3)
was OPEN (the shutter was open). Although retries were
performed, the maximum retry count was exceeded.
[When the mechanism normally works]
- Check for breakage of the sensor actuators.
- Reseat the SND board connectors.
- Check that no debris falls in an opening of the debris fall prevention
shutter.
- Check the SND board fuses.
- Replace the sensors or the motors.
014-247-01E
05.31.2013 FM6150
CR-IR 359 Service Manual
MT-46
MT-47
Error
Code
11382
Error Name
Old cassette loading
Occurrence Condition
Probable Cause and Remedy
[During routine processing]
The cassette cover opening mechanism driving motor (MA1)
was driven to prevent an IP drop. However, it was found that
the cassette IP holding sensor (SA10) was CLOSE (old type
cassette). Although retries were performed, the maximum
retry count was exceeded. It was therefore concluded that an
old cassette was loaded.
[When an error occurs in mechanism operations]
- Check assembly of the mechanism.
[When the mechanism normally works]
- Check for breakage of the sensor actuators.
- Reseat the SND board connectors.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When an error occurs in mechanism operations]
11390
Feed IP suction error
[During routine processing]
It was found that the IP dropping sensor (SA4) was OPEN
GLGQRW¿QGWKDWQR,3ZDVSUHVHQW SULRUWRWKH,3IHHGDLU
leak sequence. Although an IP feed operation was retried, the
maximum retry count was exceeded.
- Check assembly of the mechanism.
[When the mechanism normally works]
- Check that the IP is correctly sucked.
- Check for deformation or an installation failure of the suction arm.
- Check for errors in the IP suction pump.
- Check for errors in the IP air leak valve.
[When a conveyance error occurs]
11396
Feed IP conveyance error (1)
[During routine processing]
The IP transport motors (MA4, MC1, and MZ1) were driven
to perform a feed conveyance operation. However, IP sensor
6* LQWKHKRXVLQJXQLWGLGQRW&/26( GLGQRWGHWHFWDQ
IP) within a predetermined period of time. Although retries
were performed, the maximum retry count was exceeded.
- Check for mixture of debris in the IP conveyance path.
- Check for abnormalities in rotation of the conveyance roller.
[When no conveyance error occurs]
- Check to make sure that the sensors normally work by means of the
monitor function of the RU PC-TOOL.
- Check the SND board fuses.
- Replace the sensors or the motors.
014-247-01E
05.31.2013 FM6150
CR-IR 359 Service Manual
MT-47
MT-48
Error
Code
Error Name
Occurrence Condition
Probable Cause and Remedy
[When a conveyance error occurs]
11397
Feed IP conveyance error (2)
[During routine processing]
The IP transport motors (MA4, MC1, and MZ1) were driven
to perform a feed conveyance operation. However, IP sensor
1 (SC3) in the conveyor unit did not CLOSE (did not detect
an IP) within a predetermined period of time. Although retries
were performed, the maximum retry count was exceeded.
- Check for mixture of debris in the IP conveyance path.
- Check for abnormalities in rotation of the conveyance roller.
[When no conveyance error occurs]
- Check to make sure that the sensors normally work by means of the
monitor function of the RU PC-TOOL.
- Check the SND board fuses.
- Replace the sensors or the motors.
11398
Nonstandard IP size
[During bootup]
When a remaining IP length measurement process was
- Check the detecting areas of the sensors for smears.
performed, IP sensor 1 (SC3) in the conveyor unit and
&KHFNWRPDNHVXUHWKDWWKHVHQVRUV 6&6*DQG6& QRUPDOO\
[[,3ZLGWKLGHQWLI\LQJVHQVRU 6& GHWHFWHG
work by means of the monitor function of the RU PC-TOOL.
an abnormal combination. It was therefore concluded that a
- Replace the sensors.
nonstandard IP size was encountered.
[ During routine processing]
[When a conveyance error occurs]
,QWKHIHHGFRQYH\DQFHRSHUDWLRQWKH,3VHQVRU 6* LQ
- Check for mixture of debris in the IP conveyance path.
WKHKRXVLQJXQLWDQG[[,3ZLGWKLGHQWLI\LQJVHQVRU - Check for abnormalities in rotation of the conveyance roller.
(SC9) were in the unlikely combination, It was therefore
concluded that a nonstandard IP size was encountered.
11403
Barcode reading retry error
The barcode could not be read during routine processing.
Although the barcode reading operation was retried, the
maximum retry count was exceeded.
014-247-01E
05.31.2013 FM6150
- Check the CPU board fuses. Replace the Alpha II power supply, the
PIF63A board and CPU board if the fuse blowout recurs immediately
after replacement of the fuses.
CR-IR 359 Service Manual
MT-48
MT-49
Error
Code
Error Name
Occurrence Condition
Probable Cause and Remedy
- Check the CPU board fuses. Replace the Alpha II power supply, the
PIF63A board and CPU board if the fuse blowout recurs immediately
after replacement of the fuses.
11405
Barcode reading retry
conveyance error
The IP transport motors (MA4 and MC1) were driven during
routine processing to perform a barcode reading retry
conveyance operation. However, IP sensor 1 (SC3) in the
side-positioning conveyor unit did not CLOSE (did not detect
an IP) within a predetermined period of time.
11406
Nonstandard IP size
During routine processing, the IP size detected in an IP length
measurement process and the IP type detected in a barcode
reading operation formed an abnormal combination.
11407
Unacceptable IP generation/
type detection
The IP type detected in a barcode reading operation during
URXWLQHSURFHVVLQJZDVRWKHUWKDQVSHFL¿FDWLRQ
[When a conveyance error occurs]
- Check for mixture of debris in the IP conveyance path.
- Check for abnormalities in rotation of the conveyance roller.
11414
Subscanning conveyance error
(1)
[During routine processing]
The IP transport motors (MZ1 and MC1) were driven to
perform a reading conveyance operation. However, IP sensor
6& LQWKHFRQYH\RUXQLWGLGQRW23(1 GLGQRW¿QGWKDW
no IP was present) within a predetermined period of time.
Or the leading-edge detection interrupt did not occur within a
predetermined period of time.
[When no conveyance error occurs]
- Check to make sure that the sensors normally work by means of the
monitor function of the RU PC-TOOL.
- Check the SND board fuses.
- Replace the sensors (SC3) or the motors.
- Check the CPU board fuses. Replace the PSU27A power supply,
the PSU27B board and CPU board if the fuse blowout recurs
immediately after replacement of the fuses.
- Reseat the SED board connectors.
- Replace the SED board.
- Replace the cables connecting from the SED board to the CPU
board.
- Replace the CPU board.
014-247-02E
01.31.2014 FM8222
CR-IR 359 Service Manual
MT-49
MT-50
Error
Code
Error Name
Occurrence Condition
Probable Cause and Remedy
[When a conveyance error occurs]
11415
Subscanning conveyance error
(2)
[During routine processing]
The IP transport motors (MZ1 and MC1) were driven to
perform a reading conveyance operation. As a result, a
leading-edge detection interrupt occurred. However, IP
sensor 1 (SC3) in the conveyor unit did not OPEN within a
predetermined period of time.
- Check for mixture of debris in the IP conveyance path.
- Check for abnormalities in rotation of the conveyance roller.
[When no conveyance error occurs]
- Check to make sure that the sensors normally work by means of the
monitor function of the RU PC-TOOL.
- Check the SND board fuses.
- Replace the sensors (SC3) or the motors.
[When a conveyance error occurs]
11416
Subscanning conveyance error
(3)
[During routine processing]
The IP transport motors (MZ1/MC1) were driven for a reading
conveyance operation, and a leading-edge detection interrupt
occurred. The IP sensor 1 (SC3) in the conveyor unit became
OPEN, but a tailing-edge detection interrupt did not occur
ZLWKLQWKHVSHFL¿HGWLPH
- Check for mixture of debris in the IP conveyance path.
- Check for abnormalities in rotation of the conveyance roller.
[When no conveyance error occurs]
- Check to make sure that the sensors normally work by means of the
monitor function of the RU PC-TOOL.
- Check the SND board fuses.
- Replace the sensors (SC3) or the motors.
11454
014-247-02E
01.31.2014 FM8222
Empty cassette ejection
request
[During bootup]
When a remaining IP ejection process was performed, an
empty cassette was detected. It was therefore requested that
the cassette be ejected.
- Remove the cassette.
- Make sure that no IP remains inside the machine.
CR-IR 359 Service Manual
MT-50
MT-51
Error
Code
Error Name
Occurrence Condition
Probable Cause and Remedy
[When an error occurs in mechanism operations]
11460
Old cassette loading during
bootup
[During bootup]
The cassette IP holding arm performed an IP holding
operation to determine whether the cassette type was old
or new. However, it was found that the cassette IP holding
sensor (SA10) was CLOSED (the IP was not held and an old
cassette was detected). Although retries were performed,
the maximum retry count was exceeded. It was therefore
concluded that an old cassette was encountered.
- Check assembly of the mechanism.
[When the mechanism normally works]
- Check the detecting areas of the sensors for smears.
- Reseat the sensor connectors.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Check the SND board fuses.
- Replace the sensors or the motors.
[During routine processing]
7KHWXUQUROOHUQLSFRQ¿JXUDWLRQGULYLQJPRWRU 0& ZDV
driven to perform a nip operation of the nip in the turn roller
QLSFRQ¿JXUDWLRQ+RZHYHULWZDVLPSRVVLEOHWRGHWHFWWKDW
WKHWXUQUROOHUQLSFRQ¿JXUDWLRQ+3VHQVRU 6& ZDV23(1
within a predetermined period of time.
11475
Turn roller nip error (1)
11480
,QVXI¿FLHQWHUDVXUHGXHWRRYHU The over X-ray dose was detected in the erasure mode
processing, so the message was displayed and the
X-ray dose
[During routine processing]
- Again erase the IP.
&RQ¿UPWKH6YDOXHDQGFDUU\RXWVHQVLWLYLW\FRUUHFWLRQZKHQ
needed.
LQVXI¿FLHQWO\HUDVHG,3ZDVUHWXUQHGWRWKHFDVVHWWH
11495
014-247-02E
01.31.2014 FM8222
Unread IP ejection during
bootup
[During bootup]
When a remaining IP search process was performed, an
unread IP in the machine was returned to a cassette and then
the cassette was ejected.
-
CR-IR 359 Service Manual
MT-51
MT-52
Error
Code
Error Name
11498
Request for an empty cassette
KDYLQJDVSHFL¿HGVL]H
[During bootup]
When a remaining IP ejection process was performed, the
LQVHUWLRQRIDQHPSW\FDVVHWWHKDYLQJDVSHFL¿HGVL]HZDV
requested.
-
11499
Unread IP ejection during
bootup
[During bootup]
When a remaining IP search process was performed, an
unread IP in the machine was returned to a cassette and then
the cassette was ejected.
-
11510
Unread IP ejection
The IP was ejected into the cassette without being read.
-
11511
Patient information not
registered
<User operation>
This error occurs if no menu is selected at the time of image
output.
<Occurrence condition analysis>
The patient information relevant to the processed IP was not
registered in the CL.
-
11530
Image data retransmission
The RU has retransmitted the image data to the CL
([HFXWHWKH3,1*FRPPDQGLQWKH583&722/DQGFKHFNWKH
connection between the CL and RU.
Retransmission retry failure
[During routine processing]
An attempt is made to retransmit the unsent image data
from the RU to the CL after communication with the CL is
suspended; however, the CL rejects it, so that the image data
is lost and the cassette is ejected.
11531
11700
014-247-02E
01.31.2014 FM8222
Erasure time extension due
to erasure lamp illumination
failure
Occurrence Condition
Probable Cause and Remedy
Some erasure lamps failed to illuminate. Therefore, the message
appeared, and a process was performed in the erasure
extension mode in which the erasure time was extended. For the
number of unlit erasure lamps, refer to the MD volume.
&KHFNWKDWWKH,3DGGUHVVRIWKH³PDVWHU&/´VHWLQWKH58LVFRUUHFW
- Check for errors on the network equipment such as the LAN cable
and the hub.
- Replace the lamp assembly.
CR-IR 359 Service Manual
MT-52
MT-53
Error
Code
Error Name
Occurrence Condition
Probable Cause and Remedy
Inadequate erasure due to
erasure lamp illumination
failure
A predetermined number of erasure lamps failed to illuminate.
The erasure degeneration mode then prevailed due to
inadequate erasure. An unerased IP was ejected into the
cassette. The message appeared and the user made a mode
selection. For the number of unlit erasure lamps, refer to the
MD volume.
- Replace the lamp assembly.
Erasure lamp life end advance
notice
A predetermined cumulative erasure lamp illumination
time was exceeded. Therefore, the message appeared to
indicate that the lamp life end is about to be reached. For the
predetermined cumulative erasure lamp illumination time,
refer to the MD volume.
- Replace the lamp assembly.
Erasure lamp life end 1
The life end warning message appeared because a
predetermined cumulative erasure lamp illumination time was
exceeded. For the predetermined cumulative erasure lamp
illumination time, refer to the MD volume.
- Replace the lamp assembly.
11704
Erasure lamp life end 2
The life end message appeared because a predetermined
cumulative erasure lamp illumination time was exceeded. For
the predetermined cumulative erasure lamp illumination time,
refer to the MD volume.
- Replace the lamp assembly.
11732
Erasure time extension due to
ERS board failure
Some erasure lamps failed to illuminate due to an ERS board
failure. Therefore, the erasure time was extended. For the
number of unlit erasure lamps, refer to the MD volume.
- Replace the lamp assembly.
11733
Erasure degeneration due to
ERS board failure
A predetermined number of erasure lamps failed to illuminate
due to an ERS board failure. The erasure degeneration mode
then prevailed, and an unerased IP was ejected into the
cassette. For the number of unlit erasure lamps, refer to the
MD volume.
- Replace the lamp assembly.
11760
Inadequately erased IP ejection
An IP that was inadequately erased due, for instance, to an
erasure lamp illumination failure was returned to the cassette,
and the cassette was ejected.
- Replace the lamp assembly.
11701
11702
11703
014-247-02E
01.31.2014 FM8222
CR-IR 359 Service Manual
MT-53
MT-54
Error
Code
Error Name
Occurrence Condition
Probable Cause and Remedy
11780
Erasure lamp unit cleaning
preliminary message
Erasure lamp cleaning preliminary message was displayed
since the number of days since the last cleaning date or the
QXPEHURIHUDVXUHSURFHVVLQJH[FHHGHGWKHVSHFL¿HGYDOXH
&OHDQWKHHUDVXUH¿OWHU
11781
Erasure lamp unit cleaning
warning
Erasure lamp cleaning warning message was displayed since
the number of days since the last cleaning date or the number
RIHUDVXUHSURFHVVLQJH[FHHGHGWKHVSHFL¿HGYDOXH
&OHDQWKHHUDVXUH¿OWHU
11901
5LJKWVLGHFRYHUDLU¿OWHUOLIH
end indication
The message appeared and the error was logged because
WKHOLIHHQGRIWKHULJKWFRYHUDLU¿OWHUZDVUHDFKHGWKDWLV
an IP conveyance count of 90,000 (2 years) was exceeded.
5HSODFHWKHDLU¿OWHU
11902
Erasure unit brush roller life
end indication
The message appeared and the error was logged because
the life end of the erasure unit brush roller was reached, that
is, an IP conveyance count of 90,000 (2 years) was exceeded.
Replace the brush roller.
- Replace the brush roller.
11904
(UDVXUHODPS¿OWHUOLIHHQG
indication
The message appeared and the error was logged because
WKHOLIHHQGRIWKHHUDVXUHODPS¿OWHUZDVUHDFKHGWKDWLV
an IP conveyance count of 90,000 (2 years) was exceeded.
5HSODFHWKHODPS¿OWHU
5HSODFHWKHHUDVXUH¿OWHU
11905
IP suction pump life end
The message appeared and the error was logged because
the life end of the IP suction pump was reached, that is, an
IP conveyance count of 135,000 (3 years) was exceeded.
Replace the pump.
- Replace the IP suction pump.
11906
Laser life end
The message appeared because a predetermined cumulative
laser illumination time was exceeded.
- Replace the scanning optics unit.
014-247-02E
01.31.2014 FM8222
CR-IR 359 Service Manual
MT-54
MT-55
Error
Code
Error Name
Occurrence Condition
Probable Cause and Remedy
([HFXWHWKH3,1*FRPPDQGLQWKH583&722/DQGFKHFNWKH
connection between the CL and RU.
11907
Log information save error
during shutdown process
[During shutdown processing]
An error occurred when an attempt was made to save error
log/trace information in the FTP server.
11950
Cassette insertion before
console connection
establishment
The message appeared and the cassette was ejected
because the cassette was inserted before the connection to
the console was established.
-
Cassette setting failure
The message appeared because the cassette was not
inserted all the way in and two seconds elapsed.
An error results also when the following operation takes place.
- When the cassette is slantly loaded;
- When the cassette is inserted into an opposite side to
reference;
- When a cassette of an inch type is loaded into a metric-type
machine.
-
11951
- Execute the FTP command in the RU PC-TOOL, and check to make
sure that the FTP server is correctly set.
- Check for errors on the network equipment such as the LAN cable
and the hub.
12001
File open error 1 (FTP)
[During MUTL operation]
$QHUURURFFXUUHGLQWKH)73VHUYHU¿OHRSHQVHTXHQFH
([HFXWHWKH3,1*FRPPDQGLQWKH583&722/DQGFKHFNWKH
connection between the CL and RU.
- Execute the FTP command in the RU PC-TOOL, and check to make
sure that the FTP server is correctly set.
- Make sure that the IIS (Internet information service) is installed.
- Check for errors on the network equipment such as the LAN cable
and the hub.
12004
File write error 1 (FTP)
([HFXWHWKH3,1*FRPPDQGLQWKH583&722/DQGFKHFNWKH
connection between the CL and RU.
[During MUTL operation]
$QHUURURFFXUUHGLQWKH)73VHUYHU¿OHZULWHVHTXHQFH
- Execute the FTP command in the RU PC-TOOL, and check to make
sure that the FTP server is correctly set.
- Make sure that the IIS (Internet information service) is installed.
12207
014-247-02E
01.31.2014 FM8222
SED board power supply error
(during routine processing)
[During routine processing]
An error about the connection (power supply) with the leadingedge detection (SED) board was detected.
- Take action when the error code 10207 occurs.
CR-IR 359 Service Manual
MT-55
MT-56
Error
Code
Error Name
Occurrence Condition
12220
HV high voltage power supply
error
[During routine processing]
An error was detected as the HV high voltage data were out
of range.
- Take action when the error code 10220 occurs.
12223
HV-ON high-voltage value error
[During routine processing]
An error was detected as the HV high voltage data were out
of range when HV is on.
- Take action when the error code 10223 occurs.
Difference value error of HV
high voltage power supply
[During routine processing]
An error about the HV detection value signal of PMT board
was detected. The difference between the minimum and
maximum monitor values is out of range when compared to
the setting value.
12224
Probable Cause and Remedy
- Reseat the PMT board connectors.
- Replace the PMT board.
- Replace the Alpha II power supply.
- Replace the PIF63A board.
- Replace the CPU board.
- Reseat the connectors connecting with the scanning optics unit.
12231
LD monitor value error warning
[During routine processing]
The difference between minimum and maximum of the laser
GULYHFXUUHQWPRQLWRUYDOXHLVRXWRIVSHFL¿FDWLRQ
- Replace the scanning optics unit.
- Replace the Alpha II power supply.
- Replace the PIF63A board.
- Replace the CPU board.
- Reseat the connectors connecting with the scanning optics unit.
12233
LD light intensity error
- Replace the scanning optics unit.
[During routine processing]
The laser light intensity is less than 50%.
- Replace the Alpha II power supply.
- Replace the PIF63A board.
- Replace the CPU board.
12240
SYN interval count error
[During routine processing]
An error was detected for the out-of-range SYN interval count.
- Take action when the error code 10240 occurs.
12245
Polygon surface counter
timeout
[During bootup or routine processing]
7KHLQWHUUXSWZDVQRWQRWL¿HGZLWKLQPVRI/'21
- Same as the error code 10248.
014-247-02E
01.31.2014 FM8222
CR-IR 359 Service Manual
MT-56
MT-57
Error
Code
Error Name
Occurrence Condition
Probable Cause and Remedy
- Reseat the connectors connecting with the scanning optics unit.
12246
SYN interval count difference
value error
[During bootup or routine processing]
The difference between the minimum and maximum SYN
LQWHUYDOFRXQWVGXULQJUHDGLQJZDVRXWRIWKHVSHFL¿HGUDQJH
- Replace the scanning optics unit.
- Replace the Alpha II power supply.
- Replace the PIF63A board.
- Replace the CPU board.
Polygon improper index
[During bootup or routine processing]
The interrupt status occurred as there was an error of interval
for the index signal, which is generated for every rotation of
polygon.
- Same as the error code 10248.
Polygon lock timeout (1st)
[During bootup or routine processing]
$IWHUSRO\JRQ21WKHSRO\JRQ2.VLJQDOFDQQRWGHWHFW
within predetermined period of time (1st time).
- Same as the error code 10248.
12249
Polygon lock error
[During bootup or routine processing]
An error for the polygon lock signal (POKL, PONL) is
detected.
- Same as the error code 10248.
12254
Trailing edge detection timeout
[During routine processing]
The interrupt for detecting the tailing edge did not occur within
WKHVSHFL¿HGWLPH
-
12268
Shifted sensitivity
(±50 to ±70%) (LOG)
[During routine processing]
The calculated SK (current SK) and the initialized SK
(SKSTART) were compared and converted to S-value, and
it was detected if the value was within the range of ±50 to
±70%.
- Again carry out sensitivity correction.
12269
Shifted sensitivity
(70% or more) (LOG)
[During routine processing]
The calculated SK (current SK) and the initialized SK
(SKSTART) were compared and converted to S-value, and it
was detected in case the value was ±70% or more.
- Again carry out sensitivity correction.
12288
Scanner retry
[During bootup or routine processing]
The operation of the polygon or HV ON was retried.
-
12247
12248
014-247-02E
01.31.2014 FM8222
CR-IR 359 Service Manual
MT-57
MT-58
Error
Code
Error Name
Occurrence Condition
Probable Cause and Remedy
[When an error occurs in mechanism operations]
12325
Cassette cover closing
mechanism HP release retry
[During bootup or routine processing]
The cassette cover closing mechanism driving motor (MA2)
was driven to perform a home position release operation for
the cassette cover closing mechanism. However, the cassette
cover closing mechanism HP sensor (SA8) did not OPEN
within a predetermined period of time. Therefore, a retry was
performed.
- Check assembly of the mechanism.
[When the mechanism normally works]
- Check the detecting areas of the sensors for smears.
- Reseat the sensor connectors.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Check the SND board fuses.
- Replace the sensors or the motors.
12326
12329
014-247-02E
01.31.2014 FM8222
Cassette cover closing
mechanism home positioning
retry
Cassette cover opening
mechanism home positioning
retry (1)
[During bootup or routine processing]
The cassette cover closing mechanism driving motor (MA2)
was driven to perform a home positioning operation for the
cassette cover closing mechanism. However, the cassette
cover closing mechanism HP sensor (SA8) did not CLOSE
within a predetermined period of time. Therefore, a retry was
performed.
[During bootup or routine processing]
The cassette cover opening mechanism driving motor (MA1)
was driven by one pulse to perform a home positioning
operation for the cassette cover opening mechanism.
However, the cassette cover opening mechanism HP sensor
(SA7) did not CLOSE within a predetermined period of time.
Therefore, a retry was performed.
[When an error occurs in mechanism operations]
- Check assembly of the mechanism.
[When the mechanism normally works]
- Check for breakage of the sensor actuators.
- Reseat the SND board connectors.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When an error occurs in mechanism operations]
- Check assembly of the mechanism.
[When the mechanism normally works]
- Check for breakage of the sensor actuators.
- Reseat the SND board connectors.
- Check the SND board fuses.
- Replace the sensors or the motors.
CR-IR 359 Service Manual
MT-58
MT-59
Error
Code
12330
Error Name
Occurrence Condition
Probable Cause and Remedy
Cassette cover opening
mechanism home positioning
retry (2)
[During bootup or routine processing]
The cassette cover opening mechanism driving motor (MA1)
was driven to perform a home positioning operation for the
cassette cover opening mechanism. However, the cassette
cover opening mechanism HP sensor (SA7) did not CLOSE
within a predetermined period of time. Therefore, a retry was
performed.
[When an error occurs in mechanism operations]
- Check assembly of the mechanism.
[When the mechanism normally works]
- Check for breakage of the sensor actuators.
- Reseat the SND board connectors.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When an error occurs in mechanism operations]
12331
Cassette cover opening
mechanism home positioning
retry
[During bootup or routine processing]
The cassette cover opening mechanism driving motor (MA1)
was driven to perform a home positioning operation for the
cassette cover opening mechanism. However, the cassette
cover opening mechanism HP sensor (SA7) did not OPEN
within a predetermined period of time. Therefore, a retry was
performed.
- Check assembly of the mechanism.
[When the mechanism normally works]
- Check for breakage of the sensor actuators.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When an error occurs in mechanism operations]
- Check assembly of the mechanism.
12336
Suction arm home positioning
retry (1)
[During bootup or routine processing]
The suction arm driving motor (MA3) was driven by one pulse
to perform a home positioning operation for the suction arm.
However, the suction arm HP sensor (SA6) did not CLOSE
within a predetermined period of time. Therefore, a retry was
performed.
[When the mechanism normally works]
- Check the detecting areas of the sensors for smears.
- Reseat the sensor connectors.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Check the SND board fuses.
- Replace the sensors or the motors.
014-247-02E
01.31.2014 FM8222
CR-IR 359 Service Manual
MT-59
MT-60
Error
Code
Error Name
Occurrence Condition
Probable Cause and Remedy
[When an error occurs in mechanism operations]
- Check assembly of the mechanism.
12337
Suction arm home positioning
retry (2)
[During bootup or routine processing]
The suction arm driving motor (MA3) was driven to perform
a home positioning operation for the suction arm. However,
the suction arm HP sensor (SA6) did not CLOSE within
a predetermined period of time. Therefore, a retry was
performed.
[When the mechanism normally works]
- Check the detecting areas of the sensors for smears.
- Reseat the sensor connectors.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When an error occurs in mechanism operations]
- Check assembly of the mechanism.
12338
Suction arm home positioning
retry
[During bootup or routine processing]
The suction arm driving motor (MA3) was driven to perform
a home positioning operation for the suction arm. However,
the suction arm HP sensor (SA6) did not OPEN within
a predetermined period of time. Therefore, a retry was
performed.
[When the mechanism normally works]
- Check the detecting areas of the sensors for smears.
- Reseat the sensor connectors.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When an error occurs in mechanism operations]
12344
IP holding arm release retry
during bootup (1)
[During bootup]
When an attempt was made to release the cassette IP
holding arm from the IP holding position, it was found that the
cassette IP holding sensor (SA10) was OPEN (the IP was
held and a new cassette was detected). Therefore, a retry
was performed.
- Check assembly of the mechanism.
[When the mechanism normally works]
- Check for breakage of the sensor actuators.
- Reseat the SND board connectors.
- Check the SND board fuses.
- Replace the sensors or the motors.
014-247-02E
01.31.2014 FM8222
CR-IR 359 Service Manual
MT-60
MT-61
Error
Code
Error Name
Occurrence Condition
Probable Cause and Remedy
[When an error occurs in mechanism operations]
12345
IP holding arm release retry
during bootup (2)
[During bootup]
When an attempt was made to release the cassette IP holding
arm from the cassette cover opening position, it was found
that the cassette IP holding sensor (SA10) was OPEN (the
IP was held and a new cassette was detected). Therefore, a
retry was performed.
- Check assembly of the mechanism.
[When the mechanism normally works]
- Check for breakage of the sensor actuators.
- Reseat the SND board connectors.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When an error occurs in mechanism operations]
12361
Cassette cover opening
mechanism home positioning
retry (1)
[During bootup or routine processing]
The cassette cover opening mechanism driving motor (MA1)
was driven by one pulse to perform a home positioning
operation for the cassette cover opening mechanism.
However, the cassette cover opening mechanism HP sensor
(SA7) did not CLOSE within a predetermined period of time.
Therefore, a retry was performed.
- Check assembly of the mechanism.
[When the mechanism normally works]
- Check the detecting areas of the sensors for smears.
- Reseat the sensor connectors.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When an error occurs in mechanism operations]
12362
Cassette cover opening
mechanism home positioning
retry (2)
[During bootup or routine processing]
The cassette cover opening mechanism driving motor (MA1)
was driven to perform a home positioning operation for the
cassette cover opening mechanism. However, the cassette
cover opening mechanism HP sensor (SA7) did not CLOSE
within a predetermined period of time. Therefore, a retry was
performed.
- Check assembly of the mechanism.
[When the mechanism normally works]
- Check the detecting areas of the sensors for smears.
- Reseat the sensor connectors.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Check the SND board fuses.
- Replace the sensors or the motors.
014-247-02E
01.31.2014 FM8222
CR-IR 359 Service Manual
MT-61
MT-62
Error
Code
Error Name
Occurrence Condition
Probable Cause and Remedy
[When an error occurs in mechanism operations]
12363
Cassette cover opening
mechanism home positioning
retry
[During bootup or routine processing]
The cassette cover opening mechanism driving motor (MA1)
was driven to perform a home positioning operation for the
cassette cover opening mechanism. However, the cassette
cover opening mechanism HP sensor (SA7) did not OPEN
within a predetermined period of time. Therefore, a retry was
performed.
- Check assembly of the mechanism.
[When the mechanism normally works]
- Check the detecting areas of the sensors for smears.
- Reseat the sensor connectors.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Check the SND board fuses.
- Replace the sensors or the motors.
12373
Cassette hold retry
[During routine processing]
The cassette hold pin solenoid (SOLA1) turned OFF (cassette
hold). However, the cassette hold sensor (SA2) detected that
a cassette hold was released (CLOSED). Therefore, a retry
was performed.
- Check for abnormalities of the solenoid operation or of the spring.
- Check for coating detachment or breakage of cables.
- Check the SND board fuses.
- Replace the solenoid or the sensors.
[During routine processing]
12376
Cassette undetected in cassette The cassette hold pin solenoid (SOLA1) turned OFF (cassette - Check for breakage of the sensor actuators.
hold). However, the cassette ejection sensor (SA11) detected - Replace the sensors.
hold sequence
that no cassette was present (OPEN).
12379
014-247-02E
01.31.2014 FM8222
Cassette hold release retry
[During routine processing]
The cassette hold pin solenoid (SOLA1) turned ON (to
release a cassette hold). However, the cassette hold sensor
(SA2) detected a cassette hold (OPEN). Therefore, a retry
was performed.
- Check for abnormalities of the solenoid operation.
- Check for coating detachment or breakage of cables.
- Replace the sensors.
CR-IR 359 Service Manual
MT-62
MT-63
Error
Code
Error Name
Occurrence Condition
Probable Cause and Remedy
[When an error occurs in mechanism operations]
- Check assembly of the mechanism.
12381
Debris fall prevention shutter
close retry
[During routine processing]
The cassette cover opening mechanism driving motor
(MA1) was driven to close the debris fall prevention shutter.
However, it was found that the debris fall prevention shutter
sensor (SA3) was OPEN (the shutter was open). Therefore, a
retry was performed.
[When the mechanism normally works]
- Check for breakage of the sensor actuators.
- Reseat the SND board connectors.
- Check that no debris falls in an opening of the debris fall prevention
shutter.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When an error occurs in mechanism operations]
12382
Old cassette loading retry
[During routine processing]
The cassette cover opening mechanism driving motor (MA1)
was driven to prevent an IP drop. However, it was found that
the cassette IP holding sensor (SA10) was CLOSE (old type
cassette). Therefore, a retry was performed.
- Check assembly of the mechanism.
[When the mechanism normally works]
- Check for breakage of the sensor actuators.
- Reseat the SND board connectors.
- Check the SND board fuses.
- Replace the sensors or the motors.
12383
014-247-02E
01.31.2014 FM8222
Suction arm home positioning
[During bootup or routine processing]
When a suction arm home position was checked, it was found
that the suction arm HP sensor (SA6) was OPEN. Therefore,
the suction arm was returned to its home position.
-
CR-IR 359 Service Manual
MT-63
MT-64
Error
Code
Error Name
Occurrence Condition
Probable Cause and Remedy
[When an error occurs in mechanism operations]
- Check assembly of the mechanism.
12386
IP drop detection (1)
[During routine processing]
After the cassette cover was opened, it was found that the IP
dropping sensor (SA4) was CLOSED (due to IP detection).
[When the mechanism normally works]
- Check the sensors for smears (on the light-receiving and lightemitting regions).
- Reseat the sensor connectors.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Replace the sensors.
[When an error occurs in mechanism operations]
- Check assembly of the mechanism.
12388
IP drop detection (2)
[During routine processing]
After IP suction, it was found that the IP dropping sensor (SA4)
was CLOSED (due to IP detection).
[When the mechanism normally works]
- Check the sensors for smears (on the light-receiving and lightemitting regions).
- Reseat the sensor connectors.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Replace the sensors.
[When an error occurs in mechanism operations]
- Check assembly of the mechanism.
12390
Feed IP suction retry
[During routine processing]
It was found that the IP drop sensor (SA4) was OPEN (did
QRW¿QGWKDWQR,3ZDVSUHVHQW SULRUWRWKH,3IHHGDLUOHDN
sequence. Therefore, an IP feed operation was retried.
[When the mechanism normally works]
- Check that the IP is correctly sucked.
- Check for deformation or an installation failure of the suction arm.
- Check for errors in the IP suction pump.
- Check for errors in the IP air leak valve.
014-247-02E
01.31.2014 FM8222
CR-IR 359 Service Manual
MT-64
MT-65
Error
Code
Error Name
Occurrence Condition
Probable Cause and Remedy
IP holding arm release error (2)
[During routine processing]
The cassette cover opening mechanism driving motor (MA1)
was driven to release the cassette IP holding arm from the IP
holding position after IP suction. However, it was found that
the cassette IP holding sensor (SA10) was OPEN (the IP was
held and an new type cassette was detected).
[When an error occurs in mechanism operations]
12391
- Check assembly of the mechanism.
[When the mechanism normally works]
- Check for breakage of the sensor actuators.
- Reseat the SND board connectors.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When an error occurs in mechanism operations]
12393
Feed IP fall prevention retry
[During routine processing]
The cassette cover opening mechanism driving motor (MA1)
was driven to hold an IP. However, it was found that the
cassette IP holding sensor (SA10) was CLOSED (the IP was
not held and a old type cassette was detected). Therefore, a
retry was performed.
- Check assembly of the mechanism.
[When the mechanism normally works]
- Check the detecting areas of the sensors for smears.
- Reseat the sensor connectors.
- Reseat the SND board connectors.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When a conveyance error occurs]
12396
Feed IP conveyance retry (1)
[During routine processing]
The IP transport motors (MA4, MC1, and MZ1) were driven
to perform a feed conveyance operation. However, IP
VHQVRU 6* LQWKHKRXVLQJXQLWGLGQRW&/26(ZLWKLQ
a predetermined period of time. Therefore, a retry was
performed.
- Check for mixture of debris in the IP conveyance path.
- Check for abnormalities in rotation of the conveyance roller.
[When no conveyance error occurs]
- Check to make sure that the sensors normally work by means of the
monitor function of the RU PC-TOOL.
- Check the SND board fuses.
- Replace the sensors or the motors.
014-247-01E
05.31.2013 FM6150
CR-IR 359 Service Manual
MT-65
MT-66
Error
Code
Error Name
Occurrence Condition
Probable Cause and Remedy
[When a conveyance error occurs]
12397
Feed IP conveyance retry (2)
[During routine processing]
The IP transport motors (MA4, MC1, and MZ1) were driven
to perform a feed conveyance operation. However, IP
sensor 1 (SC3) in the conveyor unit did not CLOSE within
a predetermined period of time. Therefore, a retry was
performed.
- Check for mixture of debris in the IP conveyance path.
- Check for abnormalities in rotation of the conveyance roller.
[When no conveyance error occurs]
- Check to make sure that the sensors normally work by means of the
monitor function of the RU PC-TOOL.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When a conveyance error occurs]
12399
IP length measurement retry
[During routine processing]
An IP length measurement process was performed with IP
VHQVRU 6* LQWKHKRXVLQJXQLWLQWKHIHHGFRQYH\DQFH
VHTXHQFH+RZHYHU,3VHQVRU 6* &/26('ZLWKLQD
short period of time. Therefore, the IP length measurement
process was retried.
- Check for mixture of debris in the IP conveyance path.
- Check for abnormalities in rotation of the conveyance roller.
[When no conveyance error occurs]
- Check to make sure that the sensors normally work by means of the
monitor function of the RU PC-TOOL.
- Check the SND board fuses.
- Replace the sensors or the motors.
12400
014-247-01E
05.31.2013 FM6150
Turn grip roller mechanism
home positioning retry (1)
[During bootup or routine processing]
7KHWXUQUROOHUQLSFRQ¿JXUDWLRQGULYLQJPRWRU 0& ZDV
driven by one pulse to perform a home positioning operation
IRUDWXUQUROOHUQLSFRQ¿JXUDWLRQ+RZHUYHUWKHWXUQUROOHU
QLSFRQ¿JXUDWLRQ+3VHQVRU 6& GLGQRW&/26(ZLWKLQ
a predetermined period of time. Therefore, a retry was
performed.
CR-IR 359 Service Manual
MT-66
MT-67
Error
Code
Error Name
Occurrence Condition
Probable Cause and Remedy
Turn grip roller mechanism
home positioning retry (2)
[During bootup or routine processing]
7KHWXUQUROOHUQLSFRQ¿JXUDWLRQGULYLQJPRWRU 0& ZDV
driven to perform a home positioning operation for a turn roller
QLSFRQ¿JXUDWLRQ+RZHUYHUWKHWXUQUROOHUQLSFRQ¿JXUDWLRQ
HP sensor (SC1) did not CLOSE within a predetermined
period of time. Therefore, a retry was performed.
12402
Turn grip roller mechanism
home positioning retry
[During bootup or routine processing]
7KHWXUQUROOHUQLSFRQ¿JXUDWLRQGULYLQJPRWRU 0& ZDV
driven to perform a home positioning operation for a turn roller
QLSFRQ¿JXUDWLRQ+RZHUYHUWKHWXUQUROOHUQLSFRQ¿JXUDWLRQ
HP sensor (SC1) did not OPEN within a predetermined period
of time. Therefore, a retry was performed.
12403
Barcode reading retry
The barcode could not be read during routine processing.
Therefore, the barcode reading operation was retried.
12401
[When a conveyance error occurs]
12419
Post-reading conveyance retry
[During routing processing]
The IP transport motors (MA4, MC1, and MZ1) were driven
to perform a postreading conveyance operation. However, IP
VHQVRU 6* LQWKHKRXVLQJXQLWGLGQRW&/26( GLGQRW
detect an IP) within a predetermined period of time. Therefore,
a retry was performed.
- Check for mixture of debris in the IP conveyance path.
- Check for abnormalities in rotation of the conveyance roller.
[When no conveyance error occurs]
- Check to make sure that the sensors normally work by means of the
monitor function of the RU PC-TOOL.
- Check the SND board fuses.
- Replace the sensors or the motors.
014-247-01E
05.31.2013 FM6150
CR-IR 359 Service Manual
MT-67
MT-68
Error
Code
12422
Error Name
Load IP drop retry (1)
Occurrence Condition
Probable Cause and Remedy
[During routine processing]
After an IP hold release operation was performed, it was
found that the IP dropping sensor (SA4) was CLOSED (due to
IP detection). Therefore, a retry was performed.
- Check the sensors for smears (on the light-receiving and lightemitting regions).
- Reseat the sensor connectors.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Check the SND board fuses.
- Replace the sensors or the motors.
12423
Load IP drop retry (2)
[During routine processing]
After the cassette cover was closed, it was found that the IP
dropping sensor (SA4) was CLOSED (due to IP detection).
Therefore, a retry was performed.
- Check the sensors for smears (on the light-receiving and lightemitting regions).
- Reseat the sensor connectors.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When an error occurs in mechanism operations]
- Check assembly of the mechanism.
12424
Load IP hold retry
[During routine processing]
The cassette cover opening mechanism driving motor (MA1)
was driven to prevent an IP drop. However, it was found that
the cassette IP holding sensor (SA10) was CLOSED (the
IP was not held and an old type cassette was detected).
Therefore, a retry was performed.
[When the mechanism normally works]
- Check the detecting areas of the sensors for smears.
- Reseat the sensor connectors.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Check the SND board fuses.
- Replace the sensors or the motors.
014-247-01E
05.31.2013 FM6150
CR-IR 359 Service Manual
MT-68
MT-69
Error
Code
Error Name
Occurrence Condition
Probable Cause and Remedy
[When an error occurs in mechanism operations]
12428
Load IP hold release retry (1)
[During routine processing]
The cassette cover opening mechanism driving motor (MA1)
was driven to release an IP hold in the load sequence.
However, it was found that the cassette IP holding sensor
(SA10) was OPEN (the IP was held and a new type cassette
was detected). Therefore, a retry was performed.
- Check assembly of the mechanism.
[When the mechanism normally works]
- Check for breakage of the sensor actuators.
- Reseat the SND board connectors.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When an error occurs in mechanism operations]
12429
Load IP hold release retry (2)
[During routine processing]
The cassette cover opening mechanism driving motor (MA1)
was driven to release an IP hold in the load sequence.
However, it was found that the cassette IP holding sensor
(SA10) was OPEN (the IP was held and a new type cassette
was detected). Therefore, a retry was performed.
- Check assembly of the mechanism.
[When the mechanism normally works]
- Check for breakage of the sensor actuators.
- Reseat the SND board connectors.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When an error occurs in mechanism operations]
12430
Cassette cover opening
mechanism HP drive retry
[During routine processing]
The cassette cover opening mechanism driving motor (MA1)
was driven to perform a home positioning operation for the
cassette cover opening mechanism. However, it was found
that the debris fall prevention shutter sensor (SA3) was
CLOSED (the shutter was closed). Therefore, a retry was
performed.
- Check assembly of the mechanism.
[When the mechanism normally works]
- Check the detecting areas of the sensors for smears.
- Reseat the sensor connectors.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Check the SND board fuses.
- Replace the sensors or the motors.
014-247-01E
05.31.2013 FM6150
CR-IR 359 Service Manual
MT-69
MT-70
Error
Code
Error Name
Occurrence Condition
Probable Cause and Remedy
[When an error occurs in mechanism operations]
12436
Cassette cover closing
mechanism drive retry
[During routine processing]
The cassette cover closing mechanism driving motor (MA2)
was driven. However, the cassette cover closing mechanism
HP sensor (SA8) did not CLOSE within a predetermined
period of time. Therefore, a retry was performed.
- Check assembly of the mechanism.
[When the mechanism normally works]
- Check for breakage of the sensor actuators.
- Reseat the SND board connectors.
- Check the SND board fuses.
- Replace the sensors or the motors.
12438
12439
014-247-01E
05.31.2013 FM6150
Cassette cover closing
mechanism home positioning
retry
Cassette cover closing
mechanism home positioning
retry error
[During bootup or routine processing]
The cassette cover closing mechanism driving motor (MA2)
was driven to perform a home positioning operation for the
cassette cover closing mechanism. However, the cassette
cover closing mechanism HP sensor (SA8) did not CLOSE
within a predetermined period of time. Therefore, a retry was
performed.
[During bootup or routine processing]
The cassette cover closing mechanism driving motor (MA2)
was driven to perform a home positioning operation for the
cassette cover closing mechanism. However, the cassette
cover closing mechanism HP sensor (SA8) did not CLOSE
within a predetermined period of time. Although retries were
performed, the maximum retry count was
exceeded.
[When an error occurs in mechanism operations]
- Check assembly of the mechanism.
[When the mechanism normally works]
- Check for breakage of the sensor actuators.
- Reseat the SND board connectors.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When an error occurs in mechanism operations]
- Check assembly of the mechanism.
[When the mechanism normally works]
- Check for breakage of the sensor actuators.
- Reseat the SND board connectors.
- Check the SND board fuses.
- Replace the sensors or the motors.
CR-IR 359 Service Manual
MT-70
MT-71
Error
Code
Error Name
Occurrence Condition
Probable Cause and Remedy
Cassette cover closing
mechanism close positioning
error
[During bootup or routine processing]
The cassette cover closing mechanism driving motor (MA2)
was driven to place the cassette cover closing mechanism
in the close position. However, the cassette cover CLOSE
position sensor (SA12) did not CLOSE within a predetermined
period of time.
[When an error occurs in mechanism operations]
12440
- Check assembly of the mechanism.
[When the mechanism normally works]
- Check for breakage of the sensor actuators.
- Reseat the SND board connectors.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When an error occurs in mechanism operations]
12441
Cassette cover closing
mechanism HP check
[During bootup or routine processing]
When a home position check was performed on the cassette
cover closing mechanism, the cassette cover closing
mechanism HP sensor (SA8) was OPEN. Therefore, the
cassette cover closing mechanism was placed at its home
position.
- Check assembly of the mechanism.
[When the mechanism normally works]
- Check for breakage of the sensor actuators.
- Reseat the SND board connectors.
- Check the SND board fuses.
- Replace the sensors or the motors.
12442
[During bootup]
IP found in remaining IP
When a remaining IP ejection process was performed, an IP
ejection cassette during bootup was found in the cassette.
- Set an empty cassette.
[When an error occurs in mechanism operations]
- Check assembly of the mechanism.
12443
Bootup cassette cover opening
mechanism home positioning
retry
[During bootup]
When the cassette cover opening mechanism was moved
from the reference position to the home position, it was
found that the debris fall prevention shutter sensor (SA3)
was CLOSED (due to IP detection). Therefore, a retry was
performed.
[When the mechanism normally works]
- Check the detecting areas of the sensors for smears.
- Reseat the sensor connectors.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Check the SND board fuses.
- Replace the sensors or the motors.
014-247-01E
05.31.2013 FM6150
CR-IR 359 Service Manual
MT-71
MT-72
Error
Code
12445
12446
Error Name
Subscanning grip roller free
rotation error
Subscanning grip roller homepositioning error
Occurrence Condition
Probable Cause and Remedy
[During bootup or routine processing]
The subscanning grip motor (MZ2) was driven to freely rotate
the subscanning grip roller, but the subscanning grip sensor
6= GLGQRWRSHQZLWKLQWKHVSHFL¿HGWLPHSHULRG2UHUURU
was detected when driving/stopping the motor.
[During routine processing]
The subscanning grip motor (MZ2) was driven to make
the subscanning grip roller in the reference position, but
the subscanning grip sensor (SZ2) did not close within the
VSHFL¿HGWLPHSHULRG2UHUURUZDVGHWHFWHGZKHQGULYLQJ
stopping the motor.
- Check the detecting areas of the sensors for smears.
- Reseat the sensor connectors.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Check the SND board fuses.
- Replace the sensors or the motors.
- Check the detecting areas of the sensors for smears.
- Reseat the sensor connectors.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When an error occurs in mechanism operations]
- Check assembly of the mechanism.
12449
Cassette cover opening
mechanism operation error
[During routine processing]
The cassette cover opening mechanism driving motor (MA1)
was driven to release an IP hold in the load sequence.
However, it was found that the cassette cover opening
mechanism HP sensor (SA7) was CLOSED.
[When the mechanism normally works]
- Check the detecting areas of the sensors for smears.
- Reseat the sensor connectors.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When the cassette is set in the RU]
12452
No remaining-IP ejection empty
cassette during bootup
[During bootup]
When a remaining IP ejection process was performed, a
remaining IP was detected in the machine. However, it was
found that there was no ejection cassette in the cassette set
unit.
- Check to make sure that the sensors (SA1, SA2 and SA11) normally
work by means of the monitor function of the RU PC-TOOL.
- Check for coating detachment or breakage of cables.
- Replace the sensors.
[When the cassette is not set in the RU]
- Set the cassette.
014-247-02E
01.31.2014 FM8222
CR-IR 359 Service Manual
MT-72
MT-73
Error
Code
Error Name
Occurrence Condition
Probable Cause and Remedy
[When a plurality of IPs are present in the machine]
- Once turn OFF the main power switch of the machine, and then turn
it ON again. (Restarting the machine, operation of automatically
returning the IP to the cassette will be repeated.)
12455
Two IPs remaining during
bootup
[During bootup]
When a remaining IP search process was performed, the IP
dropping sensor (SA4) in the cassette set unit and IP sensor
1 (SC3) in the side-positioning conveyor unit were both
CLOSED (due to IP detection). It was therefore concluded
that there were a plurality of IPs in the machine.
[When no IP or a single IP is present in the machine]
- Check for mixture of debris in the IP conveyance path.
- Check the detecting areas of the sensors for smears.
- Reseat the sensor connectors.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Check the SND board fuses.
- Replace the sensors or the motors.
[When an error occurs in mechanism operations]
- Check assembly of the mechanism.
12460
Old/new cassette judgment
retry during bootup
[During bootup]
When the cassette IP holding arm held an IP to determine
whether an old or new cassette is used, it was found that the
cassette IP holding sensor (SA10) was CLOSED (the IP was
not held and an old cassette was detected). Therefore, a retry
was performed.
[When the mechanism normally works]
- Check the detecting areas of the sensors for smears.
- Reseat the sensor connectors.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Check the SND board fuses.
- Replace the sensors or the motors.
014-247-02E
01.31.2014 FM8222
CR-IR 359 Service Manual
MT-73
MT-74
Error
Code
Error Name
Occurrence Condition
Probable Cause and Remedy
[When a conveyance error occurs]
- Check for mixture of debris in the IP conveyance path.
12474
Feed IP conveyance error (3)
[During routine processing]
The IP transport motors (MA4, MC1, and MZ1) were driven
to perform a feed conveyance operation. However, IP
VHQVRU 6* LQWKHKRXVLQJXQLWGLGQRW&/26(ZLWKLQ
a predetermined period of time. Therefore, a retry was
performed.
- Check for abnormalities in rotation of the conveyance roller.
[When no conveyance error occurs]
- Check to make sure that the sensors normally work by means of the
monitor function of the RU PC-TOOL.
- Check the detecting areas of the sensors for smears.
- Check the SND board fuses.
- Replace the sensors or the motors.
12477
Turn grip roller mechanism HP
check
[ During bootup or routine processing ]When a home position
check was performed on the turn grip roller mechanism, the
turn grip roller mechanism HP sensor (SC1) was OPEN.
Therefore, the cassette cover closing mechanism was placed
at its home position.
[When the error 13485 concurrently occurs]
- Not problem. No countermeasure is necessary.
12485
Pulse motor error
Error occurred when driving/stopping the pulse motor.
[When the error does not concurrently occur with the error 13485]
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
- Update the version to the newest version.
12486
DC motor error
Error occurred when driving/stopping the DC motor.
12487
Sensor error
Error occurred when acquiring the sensor status.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
- Update the version to the newest version.
014-247-02E
01.31.2014 FM8222
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
CR-IR 359 Service Manual
MT-74
MT-75
Error
Code
Error Name
Occurrence Condition
Probable Cause and Remedy
- Update the version to the newest version.
12488
Fuse error
Error occurred when acquiring the fuse condition.
12489
Solenoid error
Error occurred when turning on/off the solenoid.
12490
Pump error
Error occurred when turning on/off the pump.
12491
Valve error
Error occurred when turning on/off the valve.
12510
Message format error
[During bootup or routine processing]
An illegal command was received from the CL.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
- Update the version to the newest version.
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
-
- Check for errors on the network equipment such as the LAN cable
and the hub.
12520
Message transmission failure
[During bootup or routine processing]
An attempt to transmit a message from the RU to the CL
failed.
([HFXWHWKH3,1*FRPPDQGLQWKH583&722/DQGFKHFNWKH
connection between the CL and RU.
- Execute the FTP command in the RU PC-TOOL, and check to make
sure that the FTP server is correctly set.
- Make sure that the IIS (Internet information service) is installed.
12521
RES message receiving timeout
[During bootup or routine processing]
A REQUEST message is transmitted from RU to CL, however,
RU cannot receive a RESPONSE message, thus resulting in
a time-out.
- Check for errors on the network equipment such as the LAN cable
and the hub.
([HFXWHWKH3,1*FRPPDQGLQWKH583&722/DQGFKHFNWKH
connection between the CL and RU.
- Execute the FTP command in the RU PC-TOOL, and check to make
sure that the FTP server is correctly set.
- Make sure that the IIS (Internet information service) is installed.
014-247-02E
01.31.2014 FM8222
CR-IR 359 Service Manual
MT-75
MT-76
Error
Code
Error Name
Occurrence Condition
Probable Cause and Remedy
- Check for errors on the network equipment such as the LAN cable
and the hub.
12522
ACK receiving time-out
[During bootup or routine processing]
A message is transmitted from RU to CL, however, RU cannot
receive ACK, thus resulting in a time-out.
([HFXWHWKH3,1*FRPPDQGLQWKH583&722/DQGFKHFNWKH
connection between the CL and RU.
- Execute the FTP command in the RU PC-TOOL, and check to make
sure that the FTP server is correctly set.
- Make sure that the IIS (Internet information service) is installed.
12523
SET command CL receiving
error
[During routine processing]
Although the SET command was transmitted from the RU, a
signal other than OK was received as a response from the
CL. After the processed IP returns to a cassette, the cassette
is ejected so that the associated message appears on the RU
panel.
Unlit erasure lamp detection
error
[During bootup or routine processing]
An error was detected when acquiring the status of lamp
being unlit.
- Update the version to the newest version.
12750
Erasure lamp turning off error
[During bootup or routine processing]
An error was detected when turning off the erasure lamps.
- Update the version to the newest version.
12753
Erasure lamp lighting error
[During bootup or routine processing]
An error was detected when turning on the erasure lamps.
- Update the version to the newest version.
12754
ERS board port 1 failure
[During bootup or routine processing]
It was detected that the ERS-board-mounted fuse for port 1
was blown. For the ERS board location and port numbers,
refer to the MD volume.
12770
014-247-02E
01.31.2014 FM8222
-
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
- A driver defect is suspended if the problem is not solved by version
update. (For design analysis)
- Replace the lamp assembly.
CR-IR 359 Service Manual
MT-76
MT-77
Error
Code
Error Name
Occurrence Condition
Probable Cause and Remedy
12817
Blown fuse F7 of CPU board
[During bootup or routine processing]
It was detected that the fuse F7 of CPU board was blown.
- Replace the fuse.
12818
Blown fuse F10 of CPU board
[During bootup or routine processing]
It was detected that the fuse F10 of CPU board was blown.
- Replace the fuse.
12825
Blown fuse F19 of CPU board
[During bootup or routine processing]
It was detected that the fuse F19 of CPU board was blown.
- Replace the fuse.
12845
Blown fuse F4 of SND board
[During bootup or routine processing]
It was detected that the fuse F4 of SND board was blown.
- Replace the fuse.
12846
Blown fuse F9 of SND board
[During bootup or routine processing]
It was detected that the fuse F9 of SND board was blown.
- Replace the fuse.
12847
Blown fuse F10 of SND board
[During bootup or routine processing]
It was detected that the fuse F10 of SND board was blown.
- Replace the fuse.
12848
Blown fuse F13 of CPU board
[During bootup or routine processing]
It was detected that the fuse F13 of CPU board was blown.
- Replace the fuse.
12990
FTP server access error
[During bootup or routine processing]
The FTP server cannot be accessed for communication from
the RU to the CL. Or, the FTP server may be accessed, but a
connection cannot be established.
- Check for errors on the network equipment such as the LAN cable
and the hub.
([HFXWHWKH3,1*FRPPDQGLQWKH583&722/DQGFKHFNWKH
connection between the CL and RU.
- Execute the FTP command in the RU PC-TOOL, and check to make
sure that the FTP server is correctly set.
- Make sure that the IIS (Internet information service) is installed.
13230
014-247-02E
01.31.2014 FM8222
Laser drive current value error
[During routine processing]
The laser drive current value (LDIF) is more than 1.4 times
the factory default value.
- Take action when the error code 10230 or 11906 occurs.
CR-IR 359 Service Manual
MT-77
MT-78
Error
Code
Error Name
Occurrence Condition
Probable Cause and Remedy
13232
Updating the drive current
maximum value
[During bootup or routine processing]
The drive current maximum value was more than the total of
LQLWLDOFXUUHQWYDOXHPD[LPXPYDOXHVSHFL¿HGYDOXH
-
13275
Format adjustment data error
[During MUTL operation]
When format adjustments are performed, out-of-range data is
inputted.
-
13276
File restore error
[During MUTL operation]
An error occurred when restoring the SCN data.
&KHFNWKDW¿OHH[WHQVLRQLV³GDW´
13277
Correction recording
calculation cancel
[During MUTL operation]
It failed to create the shading correction data. Shading
correction should be performed again.
- Replace the CPU board, and again carry out shading correction.
13281
Reading IP size error
[During MUTL operation]
The IP of the size other than the input size is inserted for
shading correction, so that error is detected.
- Carry out shading correction by means of a 14 x 17 inch (35 x 43 cm)
or 14 x 14 inch (35 x 35 cm) IP.
13282
SHD/POLYGON correction data
error
[During MUTL operation]
It failed to create the correction data as the difference between
the minimum and maximum QL values of the shading data
H[FHHGHGWKHVSHFL¿HGYDOXH
- Carry out shading correction by means of a scratch-free IP.
014-247-02E
01.31.2014 FM8222
CR-IR 359 Service Manual
MT-78
MT-79
Error
Code
Error Name
Occurrence Condition
Probable Cause and Remedy
13283
HVCNT value error
[During MUTL operation]
An out-of-spec HV is inputted.
- Carry out sensitivity correction by means of IPs exposed to doses of
1 mR to 10 mR.
13288
SHD data write error
[During MUTL operation]
It failed to write the SHD data into the Flash ROM.
- Replace the CPU board, and again carry out shading correction.
Bootup cassette sensor
combination inconsistency
[During bootup]
The cassette IN sensor (SA1), cassette hold sensor (SA2),
cassette OUT sensor (SA11) and cassette size sensor(SA9)
detected an abnormal combination.
- Check for breakage of the sensor actuators.
13312
- Check the detecting areas of the sensors for smears.
- Reseat the sensor connectors.
- Reseat the SND board connectors.
- Check for coating detachment or breakage of cables.
- Replace the sensors.
13485
Stop command for the stopped
motor
Although the motor was already stopped, a command for
stopping was sent.
-
- Check for errors on the network equipment such as the LAN cable
and the hub.
13520
Detection of communication
abortion to CL
[During bootup or routine processing]
It is detected that the communication between the CL and the
RU is broken.
([HFXWHWKH3,1*FRPPDQGLQWKH583&722/DQGFKHFNWKH
connection between the CL and RU.
- Execute the FTP command in the RU PC-TOOL, and check to make
sure that the FTP server is correctly set.
- Make sure that the IIS (Internet information service) is installed.
13521
014-247-02E
01.31.2014 FM8222
CL communication failure
detected
[During bootup or routine processing]
The connection is suspended and initialization of
communication between the CL and RU is performed again,
because the communication between the CL and RU is
broken.
- Check for errors on the network equipment such as the LAN cable
and the hub.
([HFXWHWKH3,1*FRPPDQGLQWKH583&722/DQGFKHFNWKH
connection between the CL and RU.
- Execute the FTP command in the RU PC-TOOL, and check to make
sure that the FTP server is correctly set.
- Make sure that the IIS (Internet information service) is installed.
CR-IR 359 Service Manual
MT-79
MT-80
Error
Code
13530
Error Name
Occurrence Condition
Probable Cause and Remedy
CL image data receive timeout
The CL was too late receiving the image data sent from the
RU, so that the image was retransmitted from the RU.
The network is overloaded, or a communication error occurs
due to hardware failure of the network, thereby causing
frequent retries.
- Check for errors on the network equipment such as the LAN cable
and the hub.
([HFXWHWKH3,1*FRPPDQGLQWKH583&722/DQGFKHFNWKH
connection between the CL and RU.
- Check for errors on the network equipment such as the LAN cable
and the hub.
13900
FTP server data acquisition
failure
[During bootup]
The data cannot be gotten from FTP server and it is set to an
initial value.
([HFXWHWKH3,1*FRPPDQGLQWKH583&722/DQGFKHFNWKH
connection between the CL and RU.
- Execute the FTP command in the RU PC-TOOL, and check to make
sure that the FTP server is correctly set.
- Make sure that the IIS (Internet information service) is installed.
014-247-02E
01.31.2014 FM8222
CR-IR 359 Service Manual
MT-80