THE COMPLETE g n i s r Nu l oo Sch BUNDLE BROUGHT TO YOU BY Nurse in the making Nurse in the making WWW.ETSY.COM/SHOP/NURSEINTHEMAKING @KRISTINE_NURSEINTHEMAKING @NURSESINTHEMAKING KRISTINE@ANURSEINTHEMAKING.COM @NURSEINTHEMAKINGKRISTINE TABLE OF CONTENTS Head To Toe Assessment...................................................................4 Dosage Calculation.........................................................................6 Lab Value Cheat Sheet...................................................................18 Lab Value Memory Tricks................................................................19 Blood Types................................................................................20 Fundamentals..............................................................................21 Pharmacology: Suffixes, Prefixes, & Antidotes...................................... 41 Mental Health Disorders............................................................... 49 Mental Health Pharmacology.......................................................... 59 Mother Baby.............................................................................. 65 Pediatric Milestones.....................................................................80 Med-Surg Renal / Urinary System.......................................................... 85 Cardiac System.................................................................... 95 Endocrine System................................................................107 Respiratory Disorders............................................................117 Hematology Disorders........................................................... 122 Gastrointestinal Disorders..................................................... 125 Neurological Disorders.......................................................... 129 Burns............................................................................... 134 ABG’s ..................................................................................... 138 Templates & Planners.................................................................. 142 Note from Kristine..................................................................... 161 3 HEAD-TO-TOE ASSESSMENT Introduction INSPECT • Knock PALPATE • Introduce yourself PERCUSS • Wash hands • Provide privacy AUSCULTATE Orientation "Normal" Vital Signs • What is your name? PULSE: 60-100 bpm • Do you know where you are? • Do you know what month it is? • Verify patient ID and DOB • Explain what you are doing (using non-medical language) • Who is the current U.S. president? BLOOD PRESSURE:120/80 mmHg O2 SATURATION: 95-100% • What are you doing here? TEMPERATURE: 97.8-99.1° F • A&O X4 = Oriented to Person, Place, Time, and Situation RESPIRATIONS: 12-20 breaths per min Head & Face HEAD Neck, Chest (Lungs) & Heart NECK • Inspect head/scalp/hair • Inspect and palpate • Palpate head/scalp/hair • Palpate carotid pulse FACE • Inspect • Check for symmetry • To assess Cranial Nerve 7, check the following: – Raise eyebrows – Smile – Frown – Show teeth – Puff out cheeks – Tightly close eyes EYES • Check skin turgor (under clavicle) POSTERIOR CHEST • Inspect • Auscultate lung sounds in posterior and lateral chest – Note any crackles or diminished breath sounds ANTERIOR CHEST • Inspect: – Use of accessory muscles – AP to transverse diameter – 6WHUQXPFRQILJXUDWLRQ • Inspects external eye structures • Palpate: symmetric expansion • Inspect color of conjunctiva and sclera • Auscultate lung sounds – anteriorand lateral • PERRLA – Pupils Equal, Round, Reactive to Light, & Accommodation – Note any crackles or diminished breath sounds HEART • Auscultate heart sounds (A, P, E, T, M) with diaphragm and bell – Note any murmurs, whooshing, bruits, RUPXIŶHGKHDUWVRXQGV 4 Peripherals Spine PERIPHERALS ELBOWS • Have the patient stand up (if able) Upper extremities • Inspect, palpate, and assess • Inspect the skin on the back • Inspect and palpate. HANDS AND FINGERS • Inspect: spinal curvature (cervical/thoracic/lumbar) • Note any texture, lesions, temperature, moisture, tenderness, & swelling • Palpate radial pulses bilaterally (+1, +2, +3, +4) SHOULDER • Inspect, palpate, and assess Ř ,QVSHFWKDQGVŵQJHUVQDLOV • Palpate spine Ř 3DOSDWHKDQGVDQGŵQJHUMRLQWV • Check muscle strength of hands bilaterally – Does each hand grip evenly? +1 = Diminished +2 =”Normal” +3 =Full +4 =Bounding, strong Lower Extremities (hips, knees, ankles) LOWER EXTREMITIES • Inspect: – Overall skin coloration – Lesions – Hair distribution – Varicosities – Edema • Palpate: Check for edema (pitting or non-pitting) Ř &KHFNFDSLOODU\UHŵOOELODWHUDOO\ • Note any lesions, lumps, or abnormalities Abdomen • Inspect: – Skin color – Contour – Scars – Aortic pulsations • Auscultate bowel sounds: all 4 quadrants (start in RLQ and go clockwise) • Light palpation: all 4 quadrants ABSENT: Must listen for at least 5 minutes to chart absent bowel sounds HIPS • Inspect and palpate HYPOACTIVE: One bowel sound every 3-5 minutes NORMOACTIVE: Gurgles 5-30 time per minute KNEES • Inspect and palpate HYPERACTIVE: Can sometimes be heard without a stethoscope constant bowFl sounds, > 30 sounds per minute ANKLES • Inspect and palpate • Post tibial pulse (+1, +2, +3, +4) • Dorsal pedis pulse bilaterally (+1, +2, +3, +4) – Check strength bilaterally – 'RUVLŶH[LRQŶH[LRQDJDLQVWUHVLVWDQFH OVERALL • Positions and drapes patient appropriately during exam (gave patient privacy) • Gave patient feedback/instructions • Exhibits professional manner during exam, treated patient with respect and dignity • Organized: exam followed a logical sequence (order of exam “made sense”) 5 v DOSAGE CALCULATION BROUGHT TO YOU BY Nurse in the making 6 ABBREVIATIONS LE EXAMP TIMES OF MEDICATIONS ac before meals pc after meals daily every day bid two times a day tid three times a day qid four times a day qh every hour ad lib A patient is receiving 1 mg tid. How many mg will they receive in one day? Remember: tid = 3X a day Answer: if they are receiving 1 mg for 3X a day, that’s 1 mg x 3 = 3 mg per day ROUTES OF ADMINISTRATION PO by mouth IM intramuscularly PR per rectum as desired SubQ subcutaneously stat immediately SL sublingual q2h every 2 hours ID intradermal q4h every 4 hours GT gastrostomy tube q6h every 6 hours IV intravenous IVP intravenous push prn as needed IVPB intravenous piggyback hs at bedtime NG nasogastric tube DRUG PREPARATION tab, tabs tablet cap, caps capsule gtt drop EC APOTHECARY AND HOUSEHOLD METRIC gtt drop min, m, mx minim tsp teaspoon pt pint kilogram gal gallon L liter dr dram mL milliliter oz ounce mEq milliequivalent T, tbs, tbsp tablespoon qt quart g (gm, Gm) gram mg milligram enteric coated mcg microgram CR controlled release kg (Kg) susp suspension el, elix elixir sup, supp suppository SR sustained release 7 CONVERSIONS BASED ON VOLUME THE METRIC SYSTEM 1 mg = 1,000 mcg Large unit to small unit Small unit to large unit 1 g = 1,000 mg 1 oz = 30 mL 8 oz = 1 cup 1 tsp = 5 mL 1 dram = 5 mL 1 tbsp = 15 mL 1 tbsp = 3 tsp 1 L = 1,000 mL 1 mL = 15 gtts (drops) TIP move decimal to the right move decimal to the left Moving to a larger unit? Move the decimal place to the Left (Ex: mcg → mg) (Larger unit think Left) EXAMPLE 1500 mcg = mg A “mg” is larger (Larger unit think Left) than a “mcg” Therefore you move decimal 3 places to the Left 1500. mcg = 1.500 mg (1.5 mg) BASED ON WEIGHT 1 kg = 2.2 lbs 1 lb = 16 oz lb kg DIVIDE by 2.2 kg lb MULTIPLY by 2.2 Example: 120 lbs = _____kg Example: 45.6 kg = ______lb 120 lbs / 2.2 = 54.545 kg 45.6 kg x 2.2 = 100.32 lb 8 DOSAGE CALC RULES KEY Medication errors kill, PREVENTION is crucial! 1 Show ALL your work. 2 Leading zeros must be placed before any decimal point. The decimal point may be missed without the zero EXAMPLE .2 mg should be 0.2 mg WHY? .2 could appear to be 2 (0.2 mg of morphine is VERY different than 2 mg of morphine!) 3 No trailing zeros. 4 DO NOT round until you have the final anwser! 0.7 mL NOT 0.70 mL 1 mg NOT 1.0 mg WHY? 1.0 could appear to be 10! HOW TO ROUND YOUR FINAL ANSWER If the number in the thousands place is 5 or greater → The # in the hundredth place is rounded up EXAMPLES: 1.995 mg is rounded to 2 mg 1.985 mg is rounded to 1.99 mg If the number in the thousands place is 4 or less 5 → DECIMAL REFERENCE GUIDE 34.732 tens ones The # is dropped thousandths hundredths tenths EXAMPLE: 0.992 mg is rounded to 0.99 mg Most nursing schools, if not all, do not give partial credit. (THIS MEANS EVERY STEP MUST BE DONE CORRECTLY!) 9 FORMULA METHOD (FOR VOLUME-RELATED DOSAGE ORDERS) D x V = A H D = DESIRED NOTE: Some medications like Heparin and Insulin are prescribed in units/hour Example: “The physician orders 120 mg...” H = DOSAGE OF MEDICATION AVAILABLE Example: “The medication is supplied as 100 mg/5 mL” V = VOLUME THE MEDICATION IS AVAILABLE IN Example: “The medication is supplied as 100 mg/5 mL” A = AMOUNT OF MEDICATION REQUIRED FOR ADMINISTRATION KEY Your answer EXAMPLE 1 Ordered: Drug C 150 mg Available: Drug C 300 mg/tab How many tablets should be given? D x V = A H What’s our desired? Drug C 150mg PO What do we have? Drug C 300mg/tab What’s our quantity/volume? tablets 150 mg 150 300 mg x 1 tab = 0.5 tabs 300 = 0.5 x 1 = 0.5 tabs FINAL ANSWER: 0.5 tabs You should assume that all questions are asked “per dose” unless the question gives a timeframe (example: “how many tablets will you give in 24 hours?”) EXAMPLE 2 Ordered: Drug C 10,000 units SubQ Available: Drug C 5,000 units/mL How many mL should be given? D x V = A H What’s our desired? Drug C 10,000 SubQ What do we have? Drug C 5,000 units What’s our quantity/volume? 1 mL 10,000 units 10,000 5,000 units x 1 mL = 2 mL 5,000 = 2 x 1 = 2 mL FINAL ANSWER: 2 mL 10 IV FLOW RATES mL / hour mL of solution total hours = mL/hr What if the question is given in minutes? If the question is asking for flow rate and you’re given units of mL, you need to write the answers in mL/hr! mL/hr is always rounded to the nearest whole number! mL of solution min 333.333 mL/hr 50 mL mL of solution total minutes gtt / min Remember our abbreviations: gtt means “drop”! 60 min 30 min ANSWER: 333 mL/hr What if the question is given in hours? NOTE: If a drop factor is included, the question is asking for flow rate in gtt/min. You need to write the answers in gtt/minute! Convert hours to minutes! For example: 1 hours = 60 minutes 2.5 hours = 150 minutes EXAMPLE #2 Ordered: 1000 mL of Lactated Ringer’s to infuse at 50 mL/hour. Drop factor for tubing is a 5 gtt/mL. (Convert: 1 hour = 60 min) 5 gtt/mL 4 gtt/min 50 ÷ 60 = 0.833 x 5 = 4.166 Round to the nearest whole number → 4 Ordered: 100 mL of Metronidazole to infuse over 45 minutes. The tubing you are using has a drop factor of 10 gtt/mL. 100 mL 45 min 10 gtt/mL 4 gtt/min Remember Rule #4 Don’t round till the end! 22 gtt/min 100 ÷ 45 = 2.222 x 10 = 22.222 Round to the nearest whole number → 22 NOTE: NOTE: FINAL ANSWER: 100 mL/hr ANSWER: 100 mL/hr drop factor = gtt/min EXAMPLE #1 60 min = mL/hr Ordered: Infuse 3 grams of Penicillin in 50 mL normal saline over 30 minutes. (rounded to the nearest whole number) 50 mL 60 (minutes) EXAMPLE #2 Ordered: 1000 mL D5W to infuse over 3 hours. What will the flow rate be? 3 hr NOTE: Since there are 60 minutes in one hour, use this formula: EXAMPLE #1 1000 mL NOTE: FINAL ANSWER: 22 gtt/min Remember Rule #4 Don’t round till the end! 11 PRACTICE QUESIONS Do all 10 questions without looking at the correct answers on the following pages. Don’t forget to show all your work. After you are done, walk through each question…even the questions you got correct! 1 ORDERED: Rosuvastatin 3000 mcg PO ac AVAILABLE: Rosuvastatin 2 mg tablet (scored) How many tabs will you administer in 24 hours? 2 ORDERED: Tylenol supp 2 g PR q6h AVAILABLE: Tylenol supp 700 mg How many supp will you administer? Round to nearest tenth. 3 4 ORDERED: Potassium cholride 0.525 mEq/lb PO dissolved in 6 oz of juice at 0930 AVAILABLE: Potassium cholride 12 mEq/mL How many mL of potassium chloride will you add to the juice for a 66.75 kg patient? Round to nearest tenth. 6 250 mL normal saline over 5 hours. Tubing drop factor of 10 gtt/mL. 7 Humulin R 200 units in 100 mL of normal saline to infuse at 4 units/hr. 8 Dopamine 600 mg in 200 mL of normal saline to infuse at 10mcg/kg/min. Pt weight = 190 lbs. 9 2.5 L normal saline to infuse over 48 hours. 1000 mL D5W to infuse over 4 hours. 10 5 ORDERED: Morphine 100 mg IM q12h prn pain AVAILABLE: Morphine 150 mg/2.6 mL How many mL will you administer? Round to nearest hundredth. 150 mL Cipro 250 mcg to infuse over 45 minutes. 12 COMPREHENSIVE REVIEW 1 ORDERED: Rosuvastatin 3000 mcg PO ac AVAILABLE: Rosuvastatin 2 mg tablet (scored) 2 ORDERED: Tylenol supp 2 g PR q6h AVAILABLE: Tylenol supp 700 mg How many tabs will you administer in 24 hours? How many supp will you administer? Round to nearest tenth. STEP 1: CONVERT DATA STEP 1: CONVERT DATA mcg → mg g → mg 3000 mcg = 3 mg 2g = 2000 mg Remember: small to big, move the decimal point 3 to the left (unit is getting Larger think Left) Remember: big to small, move the decimal point 3 to the right STEP 2: READY TO USE DATA STEP 2: READY TO USE DATA Ordered: 3 mg Available: 2 mg Volume: 1 tab Administered ac: before each meal Question is asking: dosage in 24 hours Ordered: 2000 mg Available: 700 mg Volume: 1 supp STEP 3: IRRELEVANT DATA STEP 3: IRRELEVANT DATA N/A N/A STEP 4: FORMULA USED STEP 4: FORMULA USED SHOW YOUR WORK SHOW YOUR WORK D x V = A H 3 mg 2 mg NOTE: = 1.5 1.5 x 1 tab = 1.5 1.5 x 3 = 4.5 tabs per day ROUND: No rounding necessary FINAL ANSWER: D x V = A H 4.5 tabs Don’t forget to check times of medication! The medication is ordered to be given AC, which means before each meal. Since there are 3 meals in a day (24 hours), the answer must be multiplied by 3. 2000 mg 700 mg NOTE: = 2.857 Remember Rule #4 Don’t round till the end! 2.857 x 1 supp = 2.857 supp ROUND: Nearest tenth 2.857 supp → 2.9 supp FINAL ANSWER: 2.9 supp 13 COMPREHENSIVE REVIEW 3 ORDERED: Potassium chloride 0.525 mEq/lb PO dissolved in 6 oz of juice at 0930 AVAILABLE: Potassium chloride 12 mEq/mL 4 1000 mL D5W to infuse over 4 hours. How many mL of potassium chloride will you add to the juice for a 66.75 kg patient? Round to nearest tenth. STEP 1: CONVERT DATA STEP 1: CONVERT DATA kg → lb N/A 66.75 kg x 2.2 (lb/kg) = 146.85 lb NOTE: In this case, ordered amount depends on patient weight mEq/lb → mEq ( 0.525 mEq/lb x 146.85 lb = 77.096 mEq ) STEP 2: READY TO USE DATA STEP 2: READY TO USE DATA Ordered: 77.096 mEq Available: 12 mEq Volume: 1 mL 1000 mL 4 hr STEP 3: IRRELEVANT DATA Dissolved in 12 oz of juice at 0930 STEP 3: IRRELEVANT DATA KEY Question asked for “per dose” because no timeframe was given STEP 4: FORMULA USED STEP 4: FORMULA USED D x V = A H mL of solution = mL/hr total hours SHOW YOUR WORK 77.096 mEq 12 mEq = 6.424 6.424 X 1 mL = 6.424 mL ROUND: Nearest tenth 6.424 mL → 6.4 mL FINAL ANSWER: N/A SHOW YOUR WORK NOTE: 1000 mL Remember rule #4 Don’t round till the end! 4 hr = 250 mL/hr NOTE: mL/hr is always rounded to nearest whole number! ROUND: No rounding necessary 6.4 mL FINAL ANSWER: 250 mL/hr 14 COMPREHENSIVE REVIEW 5 6 150 mL Cipro 250 mcg to infuse over 45 minutes. Remember: If the question is asking for flow rate (“to infuse”) and you’re given mL of solution, you need to write the answer in mL/hours! STEP 1: CONVERT DATA 250 mL normal saline over 5 hours. Tubing drop factor of 10 gtt/mL. STEP 1: CONVERT DATA hr → min N/A 1 hour = 60 minutes 5 hr x STEP 2: READY TO USE DATA mL of solution: 150 mL total hours: 45 min 60 min = 300 min 1 hr STEP 2: READY TO USE DATA mL of solution: 250 mL total minutes: 300 min Drop factor: 10 gtt/mL STEP 3: IRRELEVANT DATA Cipro 250 mcg Important: don’t let this information lead you to use the wrong formula. In this example, we’re asked for a flow rate which requires mL of solution and total time. STEP 4: FORMULA USED mL of solution total minutes 45 min mL of IV solution x drop factor = gtt/min time in minutes x 60 = mL/hr NOTE: Remember rule #4 Don’t round till the end! = 3.333 x 60 = 200 mL/hr NOTE: mL/hr is always rounded to nearest whole number! ROUND: No rounding necessary FINAL ANSWER: 200mL/hr N/A STEP 4: FORMULA USED SHOW YOUR WORK 150 mL STEP 3: IRRELEVANT DATA SHOW YOUR WORK 250 mL 300 min NOTE: = 0.8333 mL/min Don’t round till the end! 0.8333 mL/min x 10 gtt/mL = 8.3333 gtt/min ROUND: gtt/mL is always rounded to the nearest whole number! 8.3333 gtt/min → 8 gtt/min FINAL ANSWER: 8 gtt/min NOTE: The question may not specify to round the final answer to a whole number; you are expected to know this with gtt/min units. 15 COMPREHENSIVE REVIEW 7 Humulin R 200 units in 100 mL of normal saline to infuse at 4 units/hr. 8 Dopamine 600 mg in 200 mL of normal saline to infuse at 10 mcg/kg/min. Pt weight = 190 lbs. Remember: If the question is asking for flow rate (“to infuse”) and you’re given mL of solution, you need to write the answer in mL/hr! STEP 1: CONVERT DATA STEP 1: CONVERT DATA mcg → mg N/A Remember: Small to big: move the decimal point 3 to the left (unit is getting Larger think Left) 10 mcg = 0.010 mg lb → kg 190 lb / 2.2 = 86.363 kg STEP 2: READY TO USE DATA KEY mg/kg mg → min min Desired: 4 units/hr Available: 200 units Volume: 100 mL In this case, ordered amount depends on patient weight 0.010 mg/kg/min x 86.363 kg = 0.863 mg/min STEP 2: READY TO USE DATA STEP 3: IRRELEVANT DATA Desired: 0.863 mg/min Available: 600 mg Volume: 200 mL N/A STEP 3: IRRELEVANT DATA N/A STEP 4: FORMULA USED STEP 4: FORMULA USED SHOW YOUR WORK SHOW YOUR WORK D x V = A H 4 units/hr 200 units D x V = A H 0.863 mg/min = 0.02 /hr 0.02 /hr x 100 mL = 2 mL/hr ROUND: No rounding necessary FINAL ANSWER: 2 mL/hr = 0.00143 /min 600 mg 0.00143 /min x 200 mL = 0.2878 mL/min NOTE: mL/hr is always rounded to nearest whole number! 0.2878 mL/min x 60 min = 17.2727 mL/hr WAIT! This is mL/min... we need units of mL/hr! ROUND: mL/hr is always rounded to nearest whole number! 17.2727 mL/hr → 17 mL/hr FINAL ANSWER: 17 mL/hr 16 COMPREHENSIVE REVIEW 9 2.5 L normal saline to infuse over 48 hours. Remember: If the question is asking for flow rate (“to infuse”) and you’re given mL of solution, you need to write the answer in mL/hours! STEP 1: CONVERT DATA L → mL 10 ORDERED: Morphine 100 mg IM q12h prn pain AVAILABLE: Morphine 150 mg/2.6 mL How many mL will you administer? Round to nearest hundredth. STEP 1: CONVERT DATA N/A Remember: big to small, move the decimal point 3 to the right 2.5 L = 2500 mL STEP 2: READY TO USE DATA STEP 2: READY TO USE DATA mL of solution: 2500 mL total hours: 48 hr Ordered: 100 mg Available: 150 mg Volume: 2.6 mL STEP 3: IRRELEVANT DATA N/A STEP 3: IRRELEVANT DATA IM q12h prn pain STEP 4: FORMULA USED mL of solution = mL/hr total hours SHOW YOUR WORK 2500 mL 48 hours ROUND: mL/hr is always rounded to nearest whole number! 52.0833 mL/hr FINAL ANSWER: → 52 mL/hr 52 mL/hr Question asked for “per dose” because no timeframe was given STEP 4: FORMULA USED D x V = A H SHOW YOUR WORK 100 mg = 52.0833 mL/hr KEY = 0.6666 150 mg 0.6666 x 2.6 mL = 1.7333 mL ROUND: nearest hundredth 1.7333 mL → 1.73 mL FINAL ANSWER: 1.73 mL 17 LAB VALUE CHEAT SHEET VITAL SIGNS BASAL METABOLIC PANEL (BMP) • Blood pressure RENAL • Sodium: 135 – 145 mEq/L • Systolic: 120 mmHg • Potassium: 3.5 – 5.0 mEq/L • Diastolic: 80 mmHG • Chloride: 95 - 105 mEq/L • Heart Rate: 60 - 100 BPM • Calcium: 9 - 11 mg/dL • Respirations: 12 - 20 Breaths per min • BUN: 7 - 20 mg/dL • Oxygen: 95% - 100% • Creatinine: 0.6 – 1.2 mg/dL • Temperature: 97.8 °F - 99 °F • Albumin: 3.4 - 5.4 g/dL • Calcium: 9 - 11 mg/dL • Magnesium: 1.5 - 2.5 mg/dL • Phosphorus: 2.5 - 4.5 mg/dL • Specific gravity: 1.010 - 1.030 • GFR: 90 - 120 mL/min/1.73 m2 • BUN: 7 - 20 mg/dL • Creatinine: 0.6 – 1.2 mg/dL • Total protein: 6.2 - 8.2 g/dL LIVER FUNCTION TEST (LFT) LIPID PANEL ABG’S • ALT: 7 - 56 U/L • Total cholesterol: <200 mg/dL • AST: 5 - 40 U/L • Triglyceride: <150 mg/dL • ALP: 40 - 120 U/L • LDL: <100 mg/dL → Bad cholesterol • Bilirubin: 0.1 - 1.2 mg/dL • HDL: >60/dL → Happy cholesterol • PH: 7.35 - 7.45 • PaCO2: 35 - 45 mmHg • PaO2: 80 - 100 mmHg • HCO3: 22 - 26 mEq/L HbA1c REMEMBER • Non-diabetic: 4 - 5.6% PANCREAS ROME • Pre-diabetic: 5.7 - 6.4% Opposite Metabolic Equal • Diabetic: > 6.5% (GOAL for diabetic: < 6.5%) • Amylase: 30 - 110 U/L Respiratory • Lipase: 0 - 150 U/L COMPLETE BLOOD COUNT ( CBC ) COAGs • WBC: 4,500 - 11,000 • RBC’s: 4.5 - 5.5 • PT: 10 - 13 sec • PLT: 150,000 - 450,000 • PTT: 25 - 35 sec • Hemoglobin (Hgb) Female: 12 - 16 g/dL Male: 13 - 18 g/dL • Hematocrit (HCT) Female: 36% - 48% Male: 39% - 54% • aPTT: 30 - 40 sec (heparin) • INR - NOT ON Warfarin < 1 sec - ON Warfarin 2 - 3 sec OTHER Measured with Therapeutic Range Antidote HEPARIN aPTT 1.5 - 2.0 x normal “control” value Protamine Sulfate WARFARIN PT/INR 1.5 - 2.0 x normal “control” value Vitamin K *The higher these numbers = higher chance of bleeding • MAP: 70 - 100 mmHg • ICP (intracranial pressure): 5 - 15 mmHg • BMI: 18.5 - 24.9 • Glascow coma scale: Best = 15 Mild: 13-15 Moderate: 9-12 Severe: 3-8 18 ELECTROLYTES LAB VALUE MEMORY TRICKS SODIUM: 135 - 145 POTASSIUM: 3.5 - 5 *Commit to memory! BANANAS: There are about 3-5 in every bunch & you want them half ripe (½) PHOR: 4 US: 2 (me + you = 2) *don’t forget the .5 So, think 3.5 - 5.0 CALCIUM: 9 - 11 CALL 911 COMPLETE BLOOD COUNT (CBC) PHOSPHORUS: 2.5 - 4.5 MAGNESIUM: 1.5 - 2.5 MAGnifying glass you see 1.5 - 2.5 bigger than normal CHLORIDE: 95 -105 Think of a chlorinated pool that you want to go in when it’s SUPER HOT: 95 - 105 °F • Hemoglobin (Hgb) Female: 12 - 16 g/dL Male: 13 - 18 g/dL • Hematocrit (HCT) Female: 36% - 48% Male: 39% - 54% To remember HCT, multiply Hgb by 3 12 X 3 = 36 16 X 3 = 48 13 X 3 = 39 BASAL METABOLIC PANEL (BMP) 18 X 3 = 54 BUN: 7 - 20 mg/dL Think hamburger BUNs... Hamburgers can cost anywhere from $7 - $20 dollars (Female) (Male) CREATININE: 0.6 – 1.2 mg/dL This is the same value as LITHIUM’s therapeutic range (0.6 - 1.2 mmol/L) Lithium is excreted almost solely by the kidneys... And creatinine is a value that tests how well your kidneys filter 19 BLOOD TYPES ANTIGENS: Proteins that elicit immune response → → → Plasma WBC’s RBC’s A Identifies the cell PLASMA ANTIBODIES Protects body from “invaders” (think ANTI) Opposite of the type of antigen that is found on the RBC B rsal Unive ENT RECIPI AB rsal Unive R DONO Antigen: A Antigen: B Antigen: Antibodies: B Antibodies: A Antibodies: NONE Recipient: Donor: A, O A, AB Recipient: Donor: B, O B, AB A&B Recipient: Donor: ALL AB O Antigen: NONE Antibodies: A&B Recipient: Donor: O ALL Rh FACTOR Has Rh on surface Can receive Does not have Rh on surface Can receive 20 FUNDAMENTALS Nurse in the making 21 $EG$EGRPHQ $%*$UWHULDOEORRGJDV $'/$FWLYLWLHVRIGDLO\OLYLQJ DF%HIRUHPHDOV $ 2$OHUW RULHQWHG %3%ORRG3UHVVXUH GF'LVFRQWLQXH + ++HPRJORELQ KHPDWRFULW '15'RQRWUHVXVFLWDWH ';'LDJQRVLV (&*(OHFWURFDUGLRJUDP )[)UDFWXUH KV$WEHGWLPH +2%+HDGRIEHG +2++DUGRIKHDULQJ + 3+LVWRU\ SK\VLFDO +5+HDUW SDWH '212786( 8 ,8 4'4'TGTG42' 42'TRGTRG 7UDLOLQJ]HUR ;PJ /DFNRIOHDGLQJ]HUR ;PJ ,&8,QWHQVLYHFDUHXQLW , 2,QWDNH RXWSXW ,0,QWUDPXVFXODU ,9,QWUDYHQRXV 1*71DVRJDVWULFWXEH 1321RWKLQJE\PRXWK &35&DUGLRSXOPRQDU\UHVXVFLWDWLRQ 33(3HUVRQDOSURWHFWLYHHTXLSPHQW 32%\PRXWK SUQ$VQHHGHG 5205DQJHRIPRWLRQ 6 66LJQV V\PSWRPV 6WDW,PPHGLDWHO\ 8$8ULQDO\VLV 969LWDOVLJQV 3(55/$3XSLOVHTXDOURXQG UHDFWLYHWROLJKW DFFRPPRGDWLRQ 327(17,$/352%/(0 ,167($':5,7( 0LVWDNHQIRUŷŸ ]HUR RUŷFFŸ XQLW 0LVWDNHQIRU,9 LQWUDYHQRXV RUWKHQXPEHU WHQ 0LVWDNHQIRUHDFKRWKHU ,QWHUQDWLRQDO8QLW GDLO\RUHYHU\RWKHUGD\ 'HFLPDOSRLQWLVPLVVHG ;PJ;PJ 060620J62 &DQPHDQPRUSKLQHVXOIDWHRU PDJQHVLXPVXOIDWH PRUSKLQHVXOIDWH PDJQHVLXPVXOIDWH # 0LVWDNHQIRUWKHQXPEHUŷŸ WZR ŷDWŸ FF 0LVWDNHQIRU8 XQLWV ZKHQ SRRUO\ZULWWHQ ŷP/ŸRUŷPLOOLOLWHUVŸ 22 7+(1856,1*352&(66 $'3,( 68%-(&7,9('$7$ :KDWWKHSWWHOOVWKHQXUVH $ VVHVVPHQW ' LDJQRVLV *DWKHULQIRUPDWLRQ UHYLHZ 9HULI\WKHLQIRUPDWLRQFROOHFWHG LVFOHDU DFFXUDWH 2%-(&7,9('$7$ 'DWDWKHQXUVHREWDLQVWKURXJK WKHLUDVVHVVPHQW REVHUYDWLRQ ,QWHUSUHWWKHLQIRUPDWLRQFROOHFWHG ,GHQWLI\ SULRULWL]HWKHSUREOHPWKURXJKD QXUVLQJGLDJQRVLV EHVXUHLW V1$1'$DSSURYHG 6HW60$57JRDOV 3 ODQQLQJ 6HWJRDOVWRVROYHWKHSUREOHP 3ULRULWL]HWKHRXWFRPHVRIFDUH 6SHFLILF 0HDVXUDEOH $FKLHYDEOH 5HOHYDQW 7LPHIUDPH # PSOHPHQWDWLRQ ( YDOXDWLRQ 5HDFKLQJWKRVHJRDOVWKURXJKSHUIRUPLQJWKHQXUVLQJDFWLRQV ,PSOHPHQWLQJWKHJRDOVVHWDERYHLQWKHSODQQLQJVWDJH 'HWHUPLQHWKHRXWFRPHRIJRDOV (YDOXDWHSWFRPSOLDQFH 'RFXPHQWFOLHQW'VUHVSRQVHWRSDLQ 0RGLI\ DVVHVVIRUQHHGHGFKDQJHV 23 0DVORZ V+LHUDUFK\RI%DVLF1HHGV +RSH 6HOI $FWXDOL]DWLRQ 6SLULWXDOZHOOEHLQJ (QKDQFHGJURZWK 6HOI(VWHHP &RQWURO &RPSHWHQFH 3RVLWLYH UHJDUG $FFHSWDQFHZRUWKLQHVV /RYH %HORQJLQJ 6DIHW\ 6HFXULW\ 3K\VLRORJLFDO1HHGV 0DLQWDLQVXSSRUWV\VWHPV 3URWHFWIURPLVRODWLRQ 3URWHFWLRQIURPLQMXU\ 3URPRWHIHHOLQJRI VHFXULW\ 7UXVWLQQXUVHFOLHQW UHODWLRQVKLS $LUZD\ 5HVSLUDWRU\HIIRUW +HDUWUDWHUK\WKP DQGVWUHQJWKRI FRQWUDFWLRQ 1XWULWLRQ (OLPLQDWLRQ 24 1856,1*(7+,&6 /$: 3DWLHQW5LJKWV (WKLFDO3ULQFLSOHV 5HVSHFWIRUDQ LQGLYLGXDOŶVULJKWWRPDNH WKHLURZQGHFLVLRQV $XWRQRP\ 1RQPDOHILFHQFH 2EOLJDWLRQWRGR FDXVH QRKDUPWRRWKHUV 'XW\WRGRJRRGWRRWKHUV %HQHILFHQFH 'LVWULEXWLRQRIEHQHILWV VHUYLFHVIDLUO\ -XVWLFH 9HUDFLW\ 2EOLJDWLRQWRWHOOWKHWUXWK )LGHOLW\ )ROORZLQJWKURXJKZLWKD SURPLVH 5LJKWWR 35,9$&< &216,'(5$7( 5(63(&7)8/ &$5( %( ,1)250(' .12: 7+( 1$0(6 52/(6 2) 7+( 3(56216 :+2 $5( ,192/9(' ,1 &$5( &216(17 25 5()86( $ 75($70(17 +$9( $1 $'9$1&( ',5(&7,9( 2%7$,17+(,52:10(',&$/ 5(&25'6 5(68/76 &RQVHQW +,3$$ 7KH +HDOWK ,QVXUDQFH 3RUWDELOLW\ $FFRXQWDELOLW\ $FW 3DWLHQW'V UHFRUGV DUH SULYDWH WKH\ 7<3(62)&216(17 $GPLVVLRQ$JUHHPHQW,PPXQL]DWLRQ&RQVHQW %ORRG7UDQVIXVLRQ&RQVHQW6XUJLFDO&RQVHQW 5HVHDUFK&RQVHQW 6SHFLDO&RQVHQWV KDYH WKH ULJKW WR HQVXUH WKH PHGLFDO 7UHDWPHQW FDQ QRW EH GRQH ZLWKRXW SW LQIRUPDWLRQ LV QRW VKDUHG ZLWKRXW FRQVHQW SHUPLVVLRQ ,Q WKH FDVH RI DQ HPHUJHQF\ ZKHQ D SW FDQ $OO KHDOWK FDUH SURIHVVLRQDOV PXVW QRW JLYH FRQVHQW FRQVHQW LV LPSOLHG WKURXJK LQIRUP WKH SW KRZ WKHLU KHDOWK LQIRUPDWLRQ LV XVHG 7KH SW KDV WKH ULJKW WR REWDLQ D FRS\ RI WKHLU SHUVRQDO KHDOWK LQIRUPDWLRQ HPHUJHQF\ ODZV 0LQRUV XQGHU FRQVHQW PXVW EH REWDLQHG IURP D SDUHQW RU OHJDO JXDUGLDQ %HIRUHVLJQLQJWKHFRQVHQWWKHSWPXVWEHLQIRUPHGRI WKHIROORZLQJULVNV EHQHILWVRIVXUJHU\WUHDWPHQWV SURFHGXUHV SODQRIFDUHLQOD\PDQ VWHUPVVRWKHSW XQGHUVWDQGVFOHDUO\ZKDWLVEHLQJGRQH 25 0$,17$,16$)(7< 75$160,66,21%$6('35(&$87,216 $,5%251( 7KLQN079 0 HDVOHV 7 XEHUFXORVLV 9 DULFHOOD &KLFNHQSR[ 6LQJOHURRPXQGHUQHJDWLYHSUHVVXUH GRRUUHPDLQVFORVHG +HDOWKFDUHZRUNHUVZHDUDUHVSLUDWRU\ 'LVVHPLQDWHGYDULFHOOD]RVWHU PDVN 1RUKLJKHUOHYHO '523/(7 $GHQRYLUXV 'LSKWKHULD SKDU\QJHDO (SLJORWWLWLV ,QIOXHQ]D IOX 0HQLQJLWLV 0XPSV 3DUYRYLUXV% 3ULYDWHURRPRUDSWZKRVHERG\ 3HUWXVVLV 3QHXPRQLD 5XEHOOD 6FDUOHWIHYHU 6HSVLV 6WUHSWRFRFFDOSKDU\QJLWLV FXOWXUHVFRQWDLQWKHVDPHRUJDQLVP :HDUDVXUJLFDOPDVN 3ODFHDPDVNRQWKHSWZKHQHYHUWKH\ OHDYHWKHURRP &217$&7 &RORQL]DWLRQRULQIHFWLRQZLWKDPXOWLGUXJUHVLVWDQWRUJDQLVP (QWHULFLQIHFWLRQV &ORVWULGLXPGLIILFLOH 5HVSLUDWRU\LQIHFWLRQV 569,QIOXHQ]D :RXQG VNLQLQIHFWLRQV FXWDQHRXVGLSKWKHULDKHUSHVVLPSOH[LPSHWLJR SHGLFXORVLVVFDELHVVWDSK\ORFRFFL YDULFHOOD]RVWHU (\HLQIHFWLRQV FRQMXQFWLYLWLV 33( 3ULYDWHURRPRUFRKRUWFOLHQW 8VHJORYHV DJRZQZKHQHYHU HQWHULQJWKHSW VURRP 3(5621$/3527(&7,9((48,30(17 'RQQLQJ33( *2:1 *2**/(6 )$&(6+,(/' *ORYHV *2:1 '272*(7+(5 0$6. 5(63,5$725 5HPRYLQJ33( *ORYHV 0$6. 5(63,5$725 :$6++$1'6 6$1,7,=(5 26 ,1)(&7,21&21752/ &DXVDWLYH$JHQW 6XVFHSWLEOH +RVW /HDYHVWKHKRVWPRUH VXVFHSWLEOHWR LQIHFWLRQV %DFWHULD 9LUXV )XQJXV 3ULRQ 3DUDVLWH &KDLQ 2I ,QIHFWLRQ 2I,QIHFWLRQ +RZLWJHWV WRWKHKRVW 6DPHDV SRUWDORI H[LW 0RGH2I 7UDQVPLVVLRQ 5HVHUYRLU +XPDQ $QLPDO 6XUIDFHV )RRG 6RLO ,QVHFWV 3RUWDO2I([LW 0RXWK WRPLWTDOLYD %ORRG DXWVRQWKH VNLQ &RQWDFW 'URSOHW $LUERUQH 9HFWRUERUQH 67$*(62),1)(&7,21 ,QFXEDWLRQ 3URGURPDO6WDJH ,OOQHVV6WDJH &RQYDOHVFHQFH ,QWHUYDOEHWZHHQWKHSDWKRJHQHQWHULQJWKH ERG\ WKHSUHVHQWDWLRQRIWKHILUVWV\PSWRP 2QVHWRIJHQHUDOV\PSWRPVWRPRUHGLVWDQW V\PSWRPVWKHSDWKRJHQLVPXOWLSO\LQJ 6\PSWRPVVSHFLILFWRWKHLQIHFWLRQDSSHDU $FXWHV\PSWRPVGLVDSSHDUDQGWRWDOUHFRYHU\ FRXOGWDNHGD\VWRPRQWKV 27 62',80 ,0%$/$1&( 0$-25(/(&752/<7()281',1(&)(66(17,$/ )25$&,'%$6()/8,'%$/$1&($&7,9( 3$66,9(75$1632570(&+$1,60,55,7$%,/,7< &21'8&7,212)1(59(086&/(7,668( +<3(51$75(0,$ 0DQDJHPHQW 5LVN)DFWRUV 6LJQV 6\PSWRPV !P(T/ ) OXVKHGVNLQ 5 HVWOHVVDQ[LRXVFRQIXVHGLUULWDEOH , QFUHDVH%3 GOXLGUHWHQWLRQ ( GHPD SLWWLQJ ' HFUHDVHGXULQHRXWSXW 6 NLQIOXVKHG GU\ $ JLWDWLRQ / RZJUDGHIHYHU 7 KLUVW GU\PXFRXVPHPEUDQHV ,QFUHDVHGVRGLXPLQWDNH ([FHVVRUDOVRGLXPLQJHVWLRQ ([FHVVDGPLQLVWUDWLRQRI,9IOXLGVZ VRGLXP +\SHUWRQLF,9IOXLGV ,QFUHDVHGZDWHUORVV )HYHU :DWHU\GLDUUKHD 'LDEHWHV,QVLSLGXV ([FHVVLYHGLDSKRUHVLV 'HFUHDVHGVRGLXPH[FUHWLRQ ,IGXHWRIOXLGORVV $GPLQLVWHU,9LQIXVLRQV ,IWKHFDXVHLVLQDGHTXDWHUHQDO H[FUHWLRQRIVRGLXP *LYHGLXUHWLFVWKDWSURPRWHVRGLXP ORVV 5HVWULFWVRGLXP IOXLGLQWDNHDV SUHVFULEHG P(T/ +<321$75(0,$ P(T/ 6WXSRUDRPD $QRUH[LD ODXVHDWRPLWLQJ / HWKDUJ\ 7 DFK\FDUGLD WKUHDG\SXOVH / LPSPXVFOHV PXVFOHZHDNQHVV 2UWKRVWDWLFK\SRWHQVLRQ 6HL]XUHV+HDGDFKH 6WRPDFKFUDPSLQJ +\SHUDFWLYHERZHOV ,QFUHDVHGVRGLXPH[FUHWLRQ ([FHVVLYHGLDSKRUHVLV 'LXUHWLFV 9RPLWLQJ ELDUUKHD ,QDGHTXDWHVRGLXPLQWDNH )DVWLQJ132MRZVDOWGLHW .LGQH\GLVHDVH 6\QGURPHRILQDSSURSULDWH DQWLGLXUHWLFKRUPRQHVHFUHWLRQ +HDUWIDLOXUH ,QVWUXFWWKHFOLHQWWRLQFUHDVHRUDO VRGLXPLQWDNH ,IGXHWRK\SRYROHPLD *LYH,9VRGLXPFKORULGHLQIXVLRQV ,IGXHWRK\SHUYROHPLD *LYHRVPRWLFGLXUHWLFV 28 3/$<6$9,7$/52/(,1&(//0(7$%2/,6075$16,7,212) 1(59(,038/6(67+()81&7,21,1*2)&$5',$&/81* 086&/(7,668(6 $&,'%$6(%$/$1&( 327$66,80 62',80$5($/:$<623326,7(6:+(1 21(65,6(67+(27+(5)$//6 327$66,80 ,0%$/$1&( +<3(5.$/(0,$ 0DQDJHPHQW 5LVN)DFWRUV 6LJQV 6\PSWRPV !P(T/ JXVFOHFUDPSV r ULQHDEQRUPDOLWLHV d HVSLUDWRU\GLVWUHVV HFUHDVHGFDUGLDFFRQWUDFLWOL\ ! &*FKDQJHV d HIOH[HV 7DOOSHDNHG7ZDYHV )ODW3ZDYHV :LGHQHG456FRPSOH[HV 3URORQJHG35LQWHUYDOV P(T/ +<32.$/(0,$ P(T/ 7KUHDG\ZHDNLUUHJXODUSXOVH 2UWKRVWDWLFK\SRWHQVLRQ 6KDOORZUHVSLUDWLRQV $Q[LHW\OHWKDUJ\FRQIXVLRQFRPD 3DUHVWKHVLDV +\SRUHIOH[LD +\SRDFWLYHERZHOVRXQGVFRQVWLSDWLRQ 1DXVHDYRPLWLQJDEGRPLQDOGLVWHQWLRQ (&*FKDQJHV ([FHVVLYHSRWDVVLXPLQWDNH 5DSLGLQIXVLRQRISRWDVVLXP FRQWDLQLQJ,9VROXWLRQV 'HFUHDVHGSRWDVVLXPH[FUHWLRQ 3RWDVVLXPUHWDLQLQJGLXUHWLFV .LGQH\GLVHDVH 3RWDVVLXP $GUHQDOLQVXIILFLHQF\ LPEDODQFHFDQ $GGLVRQŵVGLVHDVH FDXVHFDUGLDF 7LVVXHGDPDJH G\VUK\WKPLDV $FLGRVLV WKDWFDQEH +\SHUXULFHPLD OLIHWKUHDWHQLQJ +\SHUFDWDEROLVP 'LVFRQWLQXH,9 32SRWDVVLXP ,QLWLDWHDSRWDVVLXPUHVWULFWHGGLHW 3RWDVVLXPH[FUHWLQJGLXUHWLFV 3UHSDUHWKHFOLHQWIRUGLDO\VLV LIVRGLXP LVFULWLFDOO\KLJK 3UHSDUHIRUDGPLQLVWUDWLRQ ,9FDOFLXP ,9K\SHUWRQLFJOXFRVH $YRLGWKHXVHRIVDOWVXEVWLWXWHVRURWKHU SRWDVVLXPFRQWDLQLQJVXEVWDQFH 67GHSUHVVLRQ 6KDOORZRULQYHUWHG7ZDYH 3URPLQHQW8ZDYH $FWXDO WRWDO ERG\ SRWDVVLXP ORVV ,QDGHTXDWH SRWDVVLXP LQWDNH )DVWLQJ 132 0RYHPHQW RI SRWDVVLXP IURP WKH H[WUDFHOOXODUIOXLG WR WKH LQWUDFHOOXODU IOXLG $ONDORVLV +\SHULQVXOLQLVP 'LOXWLRQ RI VHUXP SRWDVVLXP :DWHULQWR[LFDWLRQ ,9WKHUDS\ZLWKSRWDVVLXP GHILFLHQWVROXWLRQV 2UDOSRWDVVLXPVXSSOHPHQWV /LTXLGSRWDVVLXPFKORULGH 3RWDVVLXPUHWDLQLQJGLXUHWLF 3RWDVVLXPLVQHYHUDGPLQLVWHUHG E\,9SXVK,0RUVXEFXWURXWHV ,9SRWDVVLXPLVDOZD\VGLOXWHG DGPLQLVWHUHGXVLQJDQ LQIXVLRQGHYLFH 29 &$/&,80 ,0%$/$1&( )281',17+(%2'< 6&(//6%21(6$1'7((7+ 1(('(')253523(5)81&7,21,1*2)7+(&$5',29$6&8/$5 1(852086&8/$5(1'2&5,1(6<67(06%/22'&/277,1* 7((7+)250$7,21 +<3(5&$/&(0,$ +<32&$/&(0,$ !PJG/ PJG/ RQYXOVLRQV UUK\WPLDV GLPLQLVKHGSXOVHV RQHSDLQ HWDQ\ UUK\WKPLDV SDVPV VWULGRU DUGLDFDUUHVW ERXQGLQJSXOVHV QHVVLQWKHILQJHUVIDFH OLPEV LGQH\VWRQHV XVFOHZHDNQHVV GHHSWHQGRQUHIOH[HV 3RVLWLYH7URXVVHDXŶV&DUSDOVSDVPFDXVHG [FHVVLYHXULQDWLRQ E\LQIODWLQJDEORRGSUHVVXUHFXII 5LVN)DFWRUV &KYRVWHNŶVVLJQV&RQWUDFWLRQRIIDFLDOPXVFOHV ZOLJKWWDSRYHUWKHIDFLDOQHUYH ,QFUHDVHGFDOFLXPDEVRUSWLRQ 'HFUHDVHGFDOFLXPH[FUHWLRQ .LGQH\GLVHDVH 7KLD]LGHGLXUHWLFV ,QFUHDVHGERQHUHVRUSWLRQRIFDOFLXP +\SHUSDUDWK\URLGLVP +\SHUWK\URLGLVP 0DOLJQDQF\ ERQHGHVWUXFWLRQIURP PHWDVWDWLFWXPRUV +HPRFRQFHQWUDWLRQ 0DQDJHPHQW 6LJQV 6\PSWRPV b PJG/ '&,9RU32FDOFLXP '&7KLD]LGHGLXUHWLFV $GPLQLVWHUSKRVSKRUXVFDOFLWRQLQ ELVSKRVSKRQDWHV SURVWDJODQGLQ V\QWKHVLVLQKLELWRUV 16$,'6 $YRLGIRRGVKLJKLQFDOFLXP ,QKLELWLRQRIFDOFLXP DEVRUSWLRQIURPWKH*,WUDFW ,QFUHDVHGFDOFLXPH[FUHWLRQ .LGQH\GLVHDVHSRO\XULF SKDVH 'LDUUKHD 6WHDWRUUKHD :RXQGGUDLQDJH &RQGLWLRQVWKDWGHFUHDVHWKH LRQL]HGIUDFWLRQRIFDOFLXP $GP FDOFLXP 32 RU ,9 )RU ,9 ZDUP EHIRUH DGP VORZO\ $GP BOXPLQXP K\GUR[LGH WLWBNJO ' ,QLWLDWH VHL]XUH SUHFDXWLRQV FDOFLXP DFXWH FDOFLXP GHILFLW &RQVXPH IRRGV KLJK LQ FDOFLXP $ FOLHQW ZLWK D FDOFLXP LPEDODQFH LV DW ULVN IRU SDWKRORJLFDO IUDFWXUH 0RYH WKH FOLHQW FDUHIXOO\ DQG VORZO\ 30 0$*1(6,80 ,0%$/$1&( 02672)7+(0$*1(6,80)281',1 7+(%2'<,6)281',17+(%21(6 +<3(50$*1(6(0,$ 0DQDJHPHQW 5LVN)DFWRUV 6LJQV 6\PSWRPV !P(T/ P(T/ +<320$*1(6(0,$ P(T/ 35/3 ! ³ ÍÏæÄ CS ! ³ ÍÏæÄ /RZ (QHUJ\ GURZVLQHVV FRPD /RZ +5 CUDG\FDUGLD /RZ %3 I\SRWHQVLRQ /RZ 55 CUDG\SQHD 'HFUHDVHG GHHS WHQGRQ UHIOH[ +LJK +5 WDFK\FDUGLD +LJK %3 I\SHUWHQVLRQ ,QFUHDVHG GHHS WHQGRQ UHIOH[ I\SHUUHIOH[LD 6KDOORZ UHVSLUDWLRQV 7ZLWFKHV SDUHVWKHVLDV 7HWDQ\ VHL]XUHV ,UULWDELOLW\ &RQIXVLRQ 3RVLWLYH 7URXVVHDXŶV &DUSDO VSDVPFDXVHG E\ LQIODWLQJ D EORRG SUHVVXUHDVGG ,QFUHDVHG PDJQHVLXP LQWDNH 0DJQHVLXPFRQWDLQLQJ BOUBDJETMBYBUJWFT ([FHVVLYHDGPRI PDJQHVLXP,9 5HQDOLQVXIILFLHQF\ GHFUHDVHGUHQDOH[FUHWLRQRI PDJQHVLXP 'LXUHWLFV ,9DGPFDOFLXPFKORULGHRUFDOFLXP JOXFRQDWH 5HVWULFWGLHWDU\LQWDNHRI PDJQHVLXPFRQWDLQLQJIRRGV $YRLGWKHXVHRIOD[DWLYHV DQWDFLGVFRQWDLQLQJPDJQHVLXP &KYRVWHNŶV VLJQV &RQWUDFWLRQ RI IDFLDO PXVFOHV Z OLJKW WDS RYHU WKH IDFLDO QHUYH ,QVXIILFLHQWPDJQHVLXPLQWDNH 0DOQXWULWLRQWRPLWLQJGLDUUKHD 0DODEVRUSWLRQ V\QGURPH &HOLDF &URIQ V GLVHDVH ,QFUHDVHGPDJQHVLXPH[FUHWLRQ GLXUHWLFVRUFKURQLFDOFRKROLVP ,QWUDFHOOXODUPRYHPHQWRIPDJQHVLXP +\SHUJO\FHPLD JQVXOLQ DGP 6HSVLV 0DJQHVLXP VXOIDWH ,9 RU 32 6HL]XUH SUHFDXWLRQV ,QVWUXFW WKH FOLHQW WR LQFUHDVH PDJQHVLXP FRQWDLQLQJ IRRGV 31 ,97+(5$3< 7<3(62),962/87,216 +<3(5721,& '16 8VHGZKHQORZOHYHOVRIVRGLXP RUFKORULGH IRUPHWDEROLF DONDORVLV GH[WURVHLQ VDOLQH &RPPRQO\XVHGDVPDLQWHQDQFH IOXLG GH[WURVHLQ/5 5HSODFHVIOXLGV )RUEXUQVEOHHGLQJGHK\GUDWLRQ 0RUHFRQFHQWUDWHG LQFUHDVHGRVPRODOLW\ ,62721,& VDOLQH 16 5LQJHUŶVODFWDWH /5 GH[WURVH ': +HOSIXOIRUVRGLXPRUFKORULGH UHSODFHPHQW 8VHGZLWKEORRGSURGXFWV 5HSODFHVIOXLGV )RUEXUQVEOHHGLQJGHK\GUDWLRQ 5HSODFHVGHILFLWVRIWRWDOERG\ ZDWHU 1RWXVHGDORQHGLOXWLRQRI HOHFWURO\WHVFDQRFFXU 6DPHRVPRODOLW\ DVERG\IOXLGV +<32721,& 16 +HOSVNLGQH\VH[FUHWHH[FHVV IOXLGV 'H[WURVH 7UHDWVLQWUDFHOOXODUGHK\dUDWLRQ VXFKDV'.$ 16 1HYHUJLYHWRSWVZEXUQVRU OLYHUGLVHDVH 0RUHGLOXWHG GHFUHDVHGRVPRODOLW\ 32 ,97+(5$3< &203/,&$7,216 $LU(PEROLVP 6\PSWRPV 7DFK\FDUGLD &KHVWSDLQ +\SRWHQVLRQ /2& &\DQRWLF 7UHDWPHQW &ODPSWKHWXELQJ 7XUQSWRQWKHOHIW VLGH SODFHLQ 7UHQGHOHQEXUJ SRVLWLRQ 1RWLI\WKH+&3 ,QILOWUDWLRQ 6\PSWRPV $WWKHVLWH 3DLQ 6ZHOOLQJ &RROQHVV 1XPEQHVV 1REORRGUHWXUQ 7UHDWPHQW ,QIHFWLRQ 6\PSWRPV 7DFK\FDUGLD 5HGQHVV 6ZHOOLQJ &KLOOV GHYHU 0DODLVH 1DXVHD YRPLWLQJ 5HPRYHWKH,9 (OHYDWHWKH H[WUHPLW\ $SSO\DZDUPRU FRROFRPSUHVV 'RQRWUXEWKH DUHD 7UHDWPHQW 5HPRYHWKH,9 2EWDLQFXOWXUHV 3RVVLEOH DQWLELRWLFV DGPLQLVWUDWLRQ 33 ,97+(5$3< &203/,&$7,216 &LUFXODWRU\2YHUORDG 6\PSWRPV EORRGSUHVVXUH 'LVWHQGHGQHFN YHLQV '\VSQHD :HWFRXJK FUDFNOHV Ø7 æ µ î tî ÊæÙ 3KOHELWLV 6\PSWRPV $WWKHVLWH +HDW 5HGQHVV 7HQGHUQHVV )ORZRI,9 7UHDWPHQW IORZUDWH NHHS YHLQRSHQUDWH (OHYDWHWKHKHDGRI WKHEHG .HHSWKHSWZDUP 1RWLI\WKH+&3 7UHDWPHQW Ê îÊæ Ê ß Ø Ü îÜ Ù 5HPRYHWKH,9 1RWLI\WKH+&3 5HVWDUWWKH,9 RQWKHRSSRVLWH VLGH +HPDWRPD 6\PSWRPV (FFK\PRVLV $WWKHVLWH %ORRG +DUG SDLQIXOOXPS 7UHDWPHQW (OHYDWH WKH H[WUHPLW\ $SSO\ QUHVVXUH JFH 34 %/22'75$16)86,216 %ORRG7\SHV $ $QWLJHQ $ $QWLERGLHV% 5HFLSLHQW$2 'RQRU $$% % $QWLJHQ % $QWLERGLHV$ 5HFLSLHQW%2 'RQRU %$% $GPLQLVWUDWLRQRIWKH7UDQVIXVLRQ ,QVHUWDQ,9OLQHXVLQJDQRUJDXJH,9QHHGOH 5XQLWZLWKQRUPDOVDOLQH NHHSYHLQRSHQUDWH 8VHWKHODUJHVWFDWKHWHUSRUWDYDLODEOH %HJLQWKHWUDQVIXVLRQVORZO\ D 7KHILUVWPLQ 0267&5,7,&$/ PRQLWRUWKHSWIRU $% $QWLJHQ$ % 5HFLSLHQW$// $QWLERGLHV121( 'RQRU $% 8QLYHUVDO 5(&Ζ3Ζ(17 66RIDQ\WUDQVIXVLRQUHDFWLRQ E 9LWDOVLJQVDUHPRQLWRUHGHYHU\PLQXWHVKRXU 2 $QWLJHQ 121( $QWLERGLHV$ % 5HFLSLHQW2 'RQRU $// 8QLYHUVDO '2125 F $IWHUPLQXWHVWKHIORZFDQEHLQFUHDVHG XQOHVVD WUDQVIXVLRQUHDFWLRQKDVRFFXUUHG 5KFDQUHFLHYHIURP 'RFXPHQWWKHFOLHQWŵVWROHUDQFHWRWKHDGPLQLVWUDWLRQRI 5KFDQUHFLHYHIURP WKHEORRGSURGXFW 75$16)86,215($&7,21 ,PPHGLDWH WUDQVIXVLRQUHDFWLRQ $75$16)86,215($&7,21,6$1$'9(56(5($&7,217+$7 +$33(16$6$5(68/72)5(&(,9,1*%/22'b75$16)86,216 &KLOOV GLDSKRUHVLV DFKHV FKHVW SDLQ UDVK KLYHV LWFKLQJ VZHOOLQJ UDSLG WKUHDG\ SXOVH G\VSQHDFRXJKRUZKHH]LQJ 1XUVLQJ$FWLRQVWRD7UDQVIXVLRQ5HDFWLRQ 6WRS WKH WUDQVIXVLRQ ,QIXVLRQRIEORRGWRRUDSLGIRUWKHSWWRWROHUDWH &LUFXODWRU\RYHUORDG &RXJK G\VSQHD FKHVW SDLQ KHDGDFKH K\SHUWHQVLRQ WDFK\FDUGLD ERXQGLQJ SXOVH GLVWHQGHG QHFN YHLQ ZKHH]LQJ %ORRGWKDWLVFRQWDPLQDWHGZLWKPLFURRUJDQLVPV 6HSWLFHPLD 5DSLGRQVHWRIFKLOOVKLJKIHYHUYRPLWLQJGLDUUKHD &KDQJH WKH ,9 WXELQJ GRZQ WR WKH ,9 VLWH .HHS WKH ,9 RSHQ Z QRUPDO VDOLQH 1RWLI\ WKH +&3 EORRG EDQN 'R QRW OHDYH WKH FOLHQW DORQH IZQPUFOTJPO VKRFN PRQLWRU SW YLWDO VLJQV &RPSOLFDWLRQ WKDW RFFXUV LQ SW V ZKR UHFHLYH ,URQRYHUORDG FRQWLQXH WR DVVHVV WKH SW PXOWLSOHEORRGWUDQVIXVLRQV 9RPLWLQJ GLDUUKHD K\SRWHQVLRQ DOWHUHG KHPDWRORJLFDOYDOXHV 35 3+$50$&2.,1(7,&6 "#40315*0/ 0HGLFDWLRQJRLQJIURP WKHORFDWLRQRI DGPLQLVWUDWLRQWRWKH EORRGVWUHDP 25$/ 6XEFXW ,0 ,9 7DNHVWKH ORQJHVWWR DEVRUE 'HSHQGVRQWKHVLWH RIEORRGSHUIXVLRQ 0RUHEORRG SHUIXVLRQ UDSLG DEVRUSWLRQ 4XLFNHVW DEVRUSWLRQ WLPH ',675,%87,21 ,QIOXHQFLQJbIDFWRUV 7UDQVSRUWDWLRQE\ ERGLO\IOXLGVRIWKH PHGLFDWLRQWRZKHUHLW QHHGVWRHR &LUFXODWLRQ 3HUPHDELOLW\RIWKHFHOOPHPEUDQH 3ODVPDSURWHLQELQGLQJ 0(7$%2/,60 +RZLVWKHPHGLFDWLRQ JRLQJWREHEURNHGRZQ" 0RVWFRPPRQVLWH/,9(5 ,QIOXHQFLQJIDFWRUV $JH ,QIDQWV HOGHUO\KDYHDOLPLWHG PHGPHWDEROL]LQJFDSDFLW\ 0HGLFDWLRQW\SH )LUVWSDVVHIIHFW /LYHUPD\LQDFWLYHVRPHPHGLFDWLRQ PD\QHHGQRQHQWHUDOURXWH 1XWULWLRQDOTWDWXV (;&5(7,21 +RZLVWKHPHGLFDWLRQJRLQJWREH HOLPLQDWHGIURPWKHERG\" 0RVWFRPPRQO\GRQHE\.,'1(<6 ,QIOXHQFLQJbIDFWRUV .LGQH\G\VIXQFWLRQ /HDGVWRDQLQFUHDVHLQWKHGXUDWLRQ DQGLQWHQVLW\RIDPHGLFDWLRQUHVSRQVH 36 0(',&$7,21$'0,1,675$7,21 5LJKWVRI0HG$GPLQ 5LJKW3$7,(17 5LJKW 0(' 5LJKW7,0( 5LJKW 5287( 5LJKW'26( 7\SHVRI2UGHUV 5287,1( *LYHQRQDUHJXODUVFKHGXOH ZLWKRUZLWKRXWDWHUPLQDWLRQ GDWH 6LQJOH 2QHWLPH )RUDGPLQLVWUDWLRQRQFHDWD 5LJKW '2&80(1 7$7,21 &RPPRQ0HGLFDWLRQ(UURUV 0HGLFDWLRQHUURUNLOOV SUHYHQWLRQLVFUXFLDO :URQJPHGLFDWLRQ ,QFRUUHFWGRVH :URQJ VSHFLILFWLPHFRPPRQSUHRSW &OLHQW 67$7 2QO\IRUDGPLQLVWUDWLRQRQFH DQGJLYHQLPPHGLDWHO\ 5RXWH 7LPH $GPLQLVWHUJOHDPHGLFDWLRQWKHSW 351 $VQHHGHGPXVWKDYHDQ LQGLFDWLRQIRUXVHVXFKDVSDLQ QDXVHD YRPLWLQJ LVDOOHUJLFWR ,QFRUUHFW'&RINHGLFDWLRQ ,QDFFXUDWHSUHVFULELQJ 37 1213$5(17(5$/$'0,1,675$7,21 2UDORUHQWHUDO 6XSSRVLWRULHV &RQWUDGLFWLRQVYRPLWLQJDVSLUDWLRQSUHFDXWLRQVDEVHQFH RIDJDJUHIOH[GHFUHDVHG/2&GLIILFXOW\VZDOORZLQJ 5HFWDO /DWHUDORUVLPV SRVLWLRQ +DYHQUVLWDWBDQJOHWRKHOSZLWKVZDOORZLQJ 8VHOXEULFDWLRQ ,QVHUWEH\RQGWKHLQWHUQDOVSKLQFWHU 1(9(5FUXVKHQWHULFFRDWHGRUWLPHUHOHDVHPHGLFDWLRQV %UHDNRUFXWVFRUHGWDEOHWVRQO\ 7UDQVGHUPDO 3ODFHWKHSDWFKRQDGU\DQGFOHDQDUHDRIVNLQ IUHHRI KDLU /HDYHLWLQIRUPLQXWHV 9DJLQDO 6XSLQHZLWKNQHHVEHQW IHHWIODWRQWKHEHGFORVH WRKLSV ,QVHUWWKHVXSSRVLWRU\DORQJWKHSRVWHULRUZDOORI WKHYDJLQD LQFKHVGHHS 6WD\VXSLQHIRUDWOHDVWPLQXWHV 5RWDWHWKHVLWHVRIWKHSDWFKWRSUHYHQWVNLQLUULWDWLRQ ,QVWDOODWLRQ $OZD\VWDNHRIIWKHROGSDWFKEHIRUHSODFLQJDQHZRQH Õ ,QKDODWLRQ íý È à íÏæ å³æ È à ý Ö à (<(6 +DYHQUWLOWWKHLUKHDGEDFNVOLJKWO\ 5LQVHPRXWKDIWHUWKHXVHRIVWHURLGV +ROGWKHGURSSHUFPDERYHWKHFRQMXQFWLYD VHFRQGVEHWZHHQSXIIV VDF GURSPHGLFDWLRQGLUHFWO\LQWRWKHVDF $SSO\JHQWOHSUHVVXUHRQWKHQDVRODFULPDOGXFWIRU PLQXWHVEHWZHHQGLIIHUHQWPHGLFDWLRQV 8VHDVSDFHULISRVVLEOHWRSUHYHQWWKUXVK 6XEOLQJXDO %XFFDO VHFRQGV ($5 +DYHSWWLOWWKHLUKHDG :DUPWKHVROXWLRQEHIRUHDGPWRSUHYHQWYHUWLJR GL]]LQHVV 6XEOLQJXDOXQGHUWKH7RQJXH %XFFDO%HWZHHQWKHFKHHN WKHJXP .HHSWKHWDEOHWLQSODFHXQWLOLWKDVFRPSOHWHO\DEVRUEHG '2127HDWRUGULQNXQWLOWKHWDEOHWKDVFRPSOHWHO\ $GXOWVSXOOHDUXSZDUG RXWZDUG \HDUVRIDJHSXOOHDUGRZQ EDFN 126( +DYHSWOBZVXSLQH 'RQRWEORZQRVHIRUPLQDIWHUGURSLQVWLOODWLRQ GLVVROYHG 38 3$5(17(5$/$'0,1,675$7,21 $1<5287(2)b$'0,1,675$7,217+$7 '2(6127,192/9('58*$%62537,21 7+528*+7+(*,75$&7 ,QWUDGHUPDO 8VHV7%WHVWLQJDOOHUJ\VHQVLWLYLWLHV FKHFNLQJIRU PHGLFDWLRQV 1HHGOHVL]HJDXJH o'HJUHH$QJOH 6KRXOGIRUPDEOHE 6XEFXWDQHRXV 8VHVQRQLUULWDWLQJZDWHUVROXEOHPHGLFDWLRQ LQVXOLQ KHSDULQ 1HHGOHVL]HJDXJH 'RQRWLQMHFWPRUHWKDQPORIVROXWLRQ o'HJUHH$QJOH ,QWUDPXVFXODU 8VHVLUULWDWLQJVROXWLRQVLQRLOVDQGDTXHRXVVXVSHQVLRQV 1HHGOHVL]HJDXJH 'RQRWLQMHFWPRUHWKDQP/ P/IRUWKHGHOWRLG 'LYLGHODUJHUYROXPHVLQWRWZRV\ULQJHV XVHWZR o'HJUHH$QJOH GLIIHUHQWVLWHV 8VHWKH=WUDFNPHWKRG ,QWUDYHQRXV 8VHVDGPLQLVWHULQJPHGLFDWLRQVIOXLGV EORRG SURGXFWV 1HHGOHVL]H JDXJHSDWLHQWVZKRKDYHWUDXPD o'HJUHH$QJOH JDXJHVXUJHU\ EORRGDGPLQLVWUDWLRQ 7KHVPDOOHUWKH JDXJHWKHODUJHU WKH,9ERUH ([DPSOHJDXJH LVWKHODUJHVW QHHGOHVL]H JDXJHFKLOGUHQROGHUDGXOWV FOLHQWVZKR KDYHPHGLFDOLVVXHVRUDUHVWDEOHSRVWRS 39 SCOPE OF PRACTICE RN LPN/LVN UAP • Post-op assessment • Stable client • Routine, stable vital signs • Initial client teaching • Monitor RN’s findings & gather data • Documenting input and output • Specific assessments • Can get blood from the blood bank • Starting blood products • Sterile procedures • IV’s & IV medications • Discharge education • Clinical assessment ADPIE • Reinforce teaching • Routine procedures (catheterization, ostomy care, wound care) • Monitors IVF’s & blood products • Administer injections & narcotics (not IV’s meds & 1st IV bag) • Tube potency & enteral feedings NOTE: When a registered nurse delegates tasks to others, responsibility is transferred but accountability for patient care is not transferred. The RN is still responsible! • Sterile procedures SPECIFIC ASSESSMENTS • Activities of daily living (ADL’s) ADL’S • Feeding (not with aspiration risk) • Positioning • Ambulation • Cleaning • Linen change • Hygiene care Lung sounds, bowel sounds, & neurovascular checks RN = Registered Nurse, LPN = Licensed Practical Nurse, LVN = Licensed Vocational Nurse, UAP = Unlicensed Assistive Personnel 40 PHARMACOLOGY Suffixes, Prefixes, & Antidotes in the making 41 ANTIBIOTICS / ANTIBACTERIALS Broad spectrum antibiotics -oxacin Tetracyclines -cycline Sulfonamides sulf- Cephalosporins -cef ceph- Penicillins -cillin Aminoglycosides & macrolides -mycin Fluoroquinolones -floxacin ANTIVIRALS Antiviral (disrupts viral maturation) -virimat Antiviral (undefined group) vir- -vir- -vir Antiviral (neuraminidase inhibitors) -amivir Antiviral (acyclovir) -cyclovir HIV protease inhibitors -navir HIV / AIDS -vudine ANTIFUNGAL Antifungal -azole 42 CARDIAC ANT I H Y P ERT EN S IV ES ACE inhibitors -pril Beta-blockers -olol Angiotensin II receptor antagonists -sartan Calcium channel blockers -pine -amil Vasopressin receptor antagonists -vaptan Alpha-1 blockers -osin Loop diuretics -ide -semide Thiazide diuretics -thiazide Potassium sparing diuretics -actone ANT I H Y P ERLIP ID EM IC S HMG-CoA reductase inhibitor -statin O T H ER Anticoagulants (Factor Xa inhibitors) -xaban Anticoagulants (Dicumarol type) -arol Anticoagulants (Hirudin type) -irudin Low-molecular-weight heparin (LMWH) -parin Thrombolytics (clot-buster) -teplase -ase Antiarrhythmics -arone 43 RESPIRATORY UP P ER RES P IRAT O RY Second-gen antihistamines (H1 antagonist) -adine Second-gen antihistamines (H1 antagonist) -tirizine Second-gen antihistamines (H1 antagonist) -ticine Nasal decongestants -ephrine -zoline L O W E R RES P IRAT O RY Beta2-agonists (Bronchodilator) -terol Xanthine derivatives -phylline Cholinergic blockers -tropium Cholinergic blockers -clindidiun Immunomodulators & leukotriene modifiers -zumab -lukast 44 ANESTHETICS / ANTIANXIETY Local anesthetics -caine Barbiturates (CNS depressant) -barbital Benzodiazepines (for anxiety/sedation) -zolam Benzodiazepines (for anxiety/sedation) -zepam ANTIDEPRESSANTS Selective serotonin reuptake inhibitors (SSRIs) -oxetine -talopram -zodone Serotonin-norepinephrine -faxine -zodone -nacipram reuptake inhibitors (SNRI/DNRI) Tricyclic antidepressants (TCAs) -triptyline -pramine 45 ANALGESICS / OPIOIDS Opioids -done Opioids -one NSAID’s (anti-inflammatory) -olac -profen Salicylates Asprin (ASA) Nonsalicylates Acetaminophen GASTROINTESTINAL Histamine H2 antagonists (H2-blockers) -tidine -dine Proton pump inhibitors (PPIs) -prazole Laxatives -lax 46 ANTIDIABETIC Oral hypoglycemics -ide -tide -linide Inhibitor of the DPP-4 enzyme -gliptin Thiazolidinedione -glitazone MISCELLANEOUS Corticosteroids -asone -olone -inide Triptans (anti-migraine) -triptan Ergotamines (anti-migraine) -ergot- Antiseptics -chloro Antituberculars (TB) rifa- Bisphosphonates -dronate Neuromuscular blockers -nuim Retinoids (anti-acne) tretin- Phosphodiesterase 5 inhibitors -afil Carbonic anhydrase inhibitors -lamide Progestin (female hormone) -trel Atypical antipsychotics -ridone 47 ANTIDOTES Opioids / narcotics Naloxone (Narcan) Warfarin Vitamin K Heparin Protamine sulfate Digoxin Digibind Anticholinergics Physostigmine Benzodiazepines Flumazenil (Romazicon) Cholinergic crisis Atropine (Atropen) Acetaminophen (Tylenol) Acetylcysteine Magnesium sulfate Calcium gluconate Iron Deferoxamine Lead Chelation agents Lead Dimercaprol & disodium Alcohol withdrawal chlordiazepoxide (Librium) Beta blockers Glucagon Calcium channel blockers Glucagon, insulin, or calcium Aspirin Sodium bicarbonate Insulin Glucose Pyridoxine Deferoxamine Tricyclic antidepressants Sodium bicarbonate Cyanide Hydroxocobalamin 48 MENTAL HEALTH DISORDERS Nurse in the making 49 THERAPEUTIC COMMUNICATION TECHNIQUES Client-centered type of communication to build and help relationships with clients, families, and all relationships. DON’T DO • Ask “why” • Allow client to control the discussion • Give recognition/validation • Active listening! • Use open-ended questions • Ask too many questions • Give advice • Give false reassurance Don’t be a LOSER, be an active listener! L O S E R • Change the conversation topic Lean forward toward the client Open posture Sit squarely facing the client Establish eye contact Relax & listen • Give approval or disapproval • Use close-ended questions/statements EXAMPLES EXAMPLES “Is there something you would like to talk about?” “Don’t worry!” “Tell me more about that” “I think you should _____” “So you are saying you haven’t been sleeping well?” “Don’t be silly” “That’s great!” “Tell me more about ______” THERAPEUTIC COMMUNICATION CAN BE BOTH... VERBAL COMMUNICATIONS Words a person speaks & 35% 65% NON-VERBAL COMMUNICATIONS You may say all the “right” things but deliver it poorly. Facial expressions Movement Eye contact Appearance Posture Body language Vocal cues (yawning, tone of voice, pitch of voice) 50 CLUSTER C CLUSTER B CLUSTER A PERSONALITY DISORDERS PARANOID Odd or Eccentric SCHIZOID Indifferent Suspicious of others Seclusive Thinks everyone wants to harm them Detached Strange appearance BORDERLINE HISTRIONIC NARCISSTIC Unstable Seeks attention Manipulative Manipulative to self & others Doesn’t follow the rules Fear of neglect Center of attention by being seductive & flirtatious Egocentric AKA narcissus No care for others Aggressive AVOIDANT Anxious or Insecure Odd thinking (magical thinking) Doesn’t care for close relationships ANTISOCIAL Dramatic or Emotional SCHIZOTYPAL Anxious in social settings Avoids social interactions but desires close relationships Fear of abandonment NURSING CARE • Safety is a priority DEPENDENT OBSESSIVE-COMPULSIVE Extreme dependency one someone Perfectionist Searches urgently to find a new relationship when the other fails Clients with a personality disorder are at a ↑ risk for violence & self-harm • Develop a therapeutic relationship • Respect the patient’s needs while still setting limits and consistency • Give the client choices to improve their feeling of control Needs consistent applause Control issue Rigid TREATMENT Medications such as • Antidepressants • Anxiolytics • Antipsychotics • Mood stabilizers Therapies such as • Psycho • Group • Cognitive • Behavioral 51 EATING DISORDERS ANOREXIA NERVOSA BULIMIA NERVOSA ↓ Weight (BMI <18.5) Binge eating followed by purging ↓ Blood pressure Normal weight to overweight (BMI 18.5 - 30) ↓ Heart rate from dehydration & electrolyte imbalance ↓ Sexual development Teeth erosion ↓ Subcutaneous tissue = Hypothermia Bad breath ↓ Period regularity May use laxatives and/or diuretics BINGE EATING Binge eating not followed by purging Tend to be overweight Binging causes: • Depression • Hatred • Shame TREATMENT Amenorrhea (period may stop) Refuses to eat Monitor client during and after meals for acts of purging Lanugo (thin hair to keep the body warm) Typically does not purge Restricts self from eating Fear of gaining weight Constipation (from dehydration) TREATMENT ↑ Weight slowly (2 -3 lbs a week) Monitor excerise REFEEDING SYNDROME Potential complications when fluids, electrolytes, and carbohydrates are introduced too quickly to a malnourished client. Treatment should be done slowly to avoid this syndrome. TREATMENT FOR ALL EATING DISORDERS Teach coping skills Maintain trust Have the client be a part of the decision making & the plan of care! Therapy group, individual or family 52 BIPOLAR DISORDER MOOD SWINGS: Depression to mania with periods of normalcy SWI N GS FRO M MANIC PHASE DEPRESSIVE PHASE Periods of HIGH mood Irritable & hyper May require hospitalization Periods of LOW mood SIGNS & SYMPTOMS Sad SIGNS & SYMPTOMS Restless ↓ Sleep Low energy levels Flight of ideas Delusions Sleep disturbances: Conversation is all over the place with rapid speech Grandiosity Hyper mood Leads to exhaustion Poor judgement Manipulative behavior too much or too little sleep Hallucinations Impulsivity Examples: maxing out credit cards, engaging in risky behavior Elevated activity Leads to malnutrition & dehydration For clients with mania, the nurse should offer energy & protein-dense foods that are easily consumed on the go (finger foods!) HAMBURGERS • SANDWICHES FRUIT JUICES • GRANOLA BARS • SHAKES TREATMENT • Provide a safe environment Remove harmful objects from the room NURSING CONSIDERATIONS FOR THE ACUTE PHASE • Set limits on manipulative behavior • Provide finger foods & fluids • Re-channel energy for physical activity • ↓ Stimuli – Turn off or turn down the TV & music – Keep away from other clients if they are bothersome • Lithium carbonate PHARMACOLOGY • Anticonvulsants • Antidepressants • Antipsychotics • Antianxiety See pharmacology section for more details 53 SCHIZOPHRENIA SPECTRUM DISORDER OVERVIEW POSSIBLE CAUSES (not fully known) PHASES 1 PRE-MORBID Normal functioning. Symptoms have not become apparent yet. 2 PRODROMAL More tempered form of the disorder. Can be months to years for the disorder to become obvious. 3 SIGNS & SYMPTOMS 4 SCHIZOPHRENIA RESIDUAL ↑ in the neurotransmitter DOPAMINE Positive symptoms are noticeable and apparent. Periods of remission. Negative symptoms may remain, but S&S of the acute stage (positive symptoms) are gone. POSITIVE NEGATIVE Delusions Flattened/bland effect Lack of energy Anxiety/agitation Reduced speech Hallucinations Avolition Auditory *most common Lack of motivation Jumbled speech Disorganized behavior Anhedonia Illicit substance (LDS & Marijuana) Environmental (malnutrition, toxins, viruses during pregnancy) Genetics (family history) TREATMENT • Medication - Antipsychotic medications - Antidepressants - Mood stabilizers (lithium) - Benzodiazepines Not capable of feeling joy or pleasure • Therapy Lack of social interaction • Exercise NURSING CONSIDERATIONS • Try to establish trust with the patient HOW TO ADDRESS HALLUCINATIONS? • Encourage compliance with the medications • Don’t address the hallucinations Example: “I don’t see spiders on the wall but I see you are scared” • Promote self-care • Be compassionate • Encourage group activities • Offer therapeutic communication • Bring the conversation back to reality • Do not argue with the client • Provide safety for the client & the staff! 54 TYPES OF DEPRESSION MAJOR DEPRESSIVE DISORDER (MDD) Has at least 5 of these symptoms every day for at least 2 weeks: • • • • • Depressed mood • Not able to feel pleasure • ↑ or ↓ motor activity Too much or too little sleep • Weight fluctuations Indecisiveness (5% change within a month) Thoughts of death (suicide) ↓ ability to think/concentrate FACTS • MDD impairs the client’s normal functioning • MDD is not the same depression seen in bipolar disorder • MDD is not a mood swing, it’s constant TREATMENT PHASES FOR MDD ACUTE: 6 - 12 weeks Hospitalization & medications may be perscribed GOALS: • ↓ Depressive symptoms • ↑ Functionality CONTINUATION: 4 - 9 monthsMedication is continued GOALS: • Prevent relapse MAINTENANCE: 1+ year Medication may be continued or be phased out GOALS: • Prevent relapse & further depressive episodes PREMENSTRUAL DYSPHORIC DISORDER (PMDD) Depression that occurs during the luteal phase of the menstrual cycle. SUBSTANCE INDUCED DEPRESSIVE DISORDER Depression associated with withdrawal or the use of alcohol and drugs. PERSISTENT DEPRESSIVE DISORDER (DYSTHYMIA) A more mild form of depression compared to MDD, although it can turn into MDD later in life. SEASONAL AFFECTIVE DISORDER (SAD) Depression that occurs seasonally. Often occurs during the winter months when there is less sunshine. TREATMENT: Light therapy TREATMENT ELECTROCONVULSIVE THERAPY (ECT) Used for clients who are unresponsive to other treatments. MEDICATIONS Transmits a brief electrical stimulation to the patient’s brain. • SSRI’s • TCA’s • The patient is asleep under anesthesia • SNRI’s • MAOI’s • The client will not remember and is unaware of the procedure NON-PHARMACOLOGICAL • Muscle relaxants may be given to THERAPIES ↓ seizure activity & ↓ risk for injury • Light therapy • Client may have memory loss, confusion, • St. John’s wort & headache post-procedure THE PROCEDURE Treatme nt for the c will refle lient ct w phase th hat ey are in! SYMPTOMS • Emotional • ↑ Eating • ↓ Energy • ↓ Concentration POSTPARTUM Depression that happens after a woman goes through childbirth. The woman may feel disconnected from the world. She may have a fear of harming her newborn. NURSING CONSIDERATIONS • Safety is a priority. Those struggling with depression have a higher suicide risk. Initiate suicide precautions: - Remove sharp things - Keep medications out of reach - Remove objects that may be used for strangulation (wires) • Help the client identify coping methods & teach alternatives if needed • Provide local resources such as churches, local programs, community resources, etc. • Encourage: - Physical activity - Self-care - Supportive relationships Individual therapy, support groups, & peer support 55 DIFFERENT TYPES OF ANIXETY DISORDERS LEVELS OF ANXIETY WORST MILD MODERATE SEVERE PANIC Normal/healthy amount of anxiety. Allows one to have sharp focus & problem solve. Thinking ability is impaired. Sharp focus & problem-solving can still happen just at a lower level. Focus & problem solving are not possible. Feelings of doom may be felt. Most extreme anxiety. Unstable & not in touch with reality. SYMPTOMS NORMAL Nail-biting Tapping Foot jitters GI upset Headache Voice is shakey Dizziness Headache Nausea Sleeplessness Hyperventilation Pacing Yelling Running Hallucinations Separation Anxiety Disorder Experiences extreme fear of anxiety when separated from someone they are emotionally connected to. This is a normal part of infancy, but not a normal part of adulthood. SOME EXAMPLES: ANXIETY DISORDERS Specific Phobia Social Anxiety Disorder (Social Phobia) Panic Disorder Agoraphobia OBSESSIVE COMPULSIVE DISORDERS Generalized Anxiety Disorder (GAD) Obsessive Compulsive Disorder (OCD) Irrational fear of a particular object or situation. • Monophobia - Fear of being alone • Zoophobia - Fear of animals • Acrophobia - Fear of heights Fear of social situations or presenting in front of groups. They fear embarrassment. They may have symptoms (real or fake) to escape the situation. Reoccurring panic attacks that last 15 - 30 minutes with physical manifestations. Extreme fear of certain places where the client feels unsafe or defenseless. May even be too fearful of places to maintain employment. Agora means “open space” Uncontrolled extreme worry for at least 6 months that causes impairment of functionality. OBSESSION: Recurrent thoughts COMPULSION: Recurrent acts or behaviors This obsessiveness is usually because it decreases stress & helps deal with anxiety. Hoarding Disorder Compulsive desire to save items even if they have no value to the person. It may even lead to unsafe living environments. Body Dysmorphic Disorder Preoccupied with perceived flaws or imperfections in physical appearance that the client thinks they have. 56 SOMATIC SYMPTOM & RELATED DISORDERS (SOMATOFORM DISORDERS) SOMATIC SYMPTOM DISORDER Somatization is psychological stress that presents through physical symptoms that can not be explained by any pathology or diagnosis. NURSING CONSIDERATIONS • SAFETY is a priority Asses for symptoms or thoughts of self-harm or suicide MANIFESTATIONS • Consumed by physical manifestations to the point it disrupts daily life • Seeks medical help from multiple places • Remission & exacerbations • Overmedicates with analgesic and antianxiety medications • Understand the somatic symptoms are real to the client even though they are not real • ↑ Stress = ↑ somatic symptoms • Help the client verbalize their feelings while limiting the amount of time talking about their somatic symptoms PHQ-15: PATIENT HEALTH QUESTIONNAIRE 15 • Asses coping mechanism & educate on alternative ways of coping CONVERSION DISORDER Sudden onset of neurological manifestations & physical symptoms without a known neurological diagnosis. It can be related to a psychological conflict/need beyond their conscious control. NURSING CONSIDERATIONS • Ensure SAFETY • Gain trust & rapport with the client • Asses coping mechanism & educate on alternative ways of coping • Asses stress management methods An assessment tool used to identify 15 of the most common somatic symptoms MANIFESTATIONS MOTOR Paralysis pseudoseizures Pseudocyesis: Signs & symptoms of pregnancy without the presence of a fetus AKA false pregnancy. This may be present in a client who desires to become pregnant SENSORY Blindness Deafness Sensations (burning/tingling) Inability to smell/speak • Encourage therapy such as: - Individual therapies - Group therapies - Support groups MEDICATIONS POSTTRAUMATIC STRESS DISORDER (PTSD) MANIFESTATIONS Mental health condition where exposure to a traumatic event has occured. NURSING CONSIDERATIONS • Teach relaxation techniques • Teach ways to ↓ anxiety • Support groups The client may be prescribed antidepressants or anxiolytics Lasting longer than 1 month: • Anxiety • Detachment • Nightmares of the event MEDICATIONS Antidepressants may be prescribed 57 NEUROCOGNITIVE DISORDERS Dementia & Alzheimer’s are NOT the same. Dementia is a general term that refers to a group of symptoms, not a specific disease. Dementia may advance to a major neurocognitive disorder such as Alzheimer’s disease. SHORT TERM / SUDDEN CHANGE Impairment (hours - days) ALZHEIMER’S ONSET DELIRIUM CONTINUOUS Decline of function (months - years) There is always an underlying cause... something is causing the delirium! Delirium is a medical emergency and requires prompt diagnosis & treatment • Disorganization - Most common to time & place - Happens mostly at night • ↓ Memory • Anxiety & agitation • Delusional thinking Head Injury Traumatic brain injuries (TBI) & head trauma Advanced Age >65 have the highest risk Cardiovascular Disease & Lifestyle Factors Inactivity, unhealthy diet, high cholesterol, obesity, & diabetes STAGES OF ALZHEIMERS DISEASE • Ranges from lethargic to hypervigilance! SEVERE MODERATE MILD • Secondary to a medical condition (infection, electrolyte imbalance, substance abuse...etc) RISK FACTORS • Stroke • Surgery • Restraints MANIFESTATIONS • Hospitalization • ICU delirium • Polypharmacy • Old age Genetics Family history (immediate family) Early stage not noticeable to others Middle Stage noticeable to others Late Stage Requires full assistance • Memory lapse • Misplacing things • Short term memory • Difficulty focusing • Can still accomplish own ADL's • Forgets own history • Gets lost & wanders often • Difficulty completing tasks • Gets angry & frustrated • Personality changes • Unable to do some ADL’s & self-care (may be incontinent) • Needs assistant with all ADL’s • Losing the capability to have discussions • Losing physical skills (walking, sitting, swallowing) • May result in death or coma • Safety: prevent physical harm • Avoid restrains when possible • Remember physical needs (Hygiene, food, water, sleep, etc) • May be prescribed anti-anxiety/antipsychotic medications INTERVENTIONS Caring for a pt. with Alzheimer’s is very complex! • Help families in planning for extended care • Monitor nutrition, weight, & fluids status • Maintain a quiet environment to ↓ stimuli • Cholinesterase inhibitor may be prescribed to improve quality of life but does NOT cure the disease. Communication • Speak slowly • Give one direction at a time • Don’t ask complex or open-ended questions • Ask simple, direct questions • Face the client directly when speaking RX Reversible if prompt treatment is initiated CURE? Used in early & moderate stages of dementia & Alzheimer’s disease. May also be used for Parkinson’s dementia. GENERIC TRADE NAME donepezil Aricept galantamine Razadyne Rivastigmine Exelon Irreversible 58 MENTAL HEALTH PHARMACOLOGY Nurse in the making 59 LITHIUM CARBONATE MOOD STABILIZER: Known for its side effects and narrow therapeutic range THERAPEUTIC RANGE: 0.6 - 1.2 mEq/L USES ADVERSE REACTIONS • Nausea Bipolar disorder Helps regulate the “mood swings” (depression & mania) TOXICITY LEVELS • Confusion • Diarrhea • Thirst • Polyuria TOXICITY! • Blurred vision • Vomiting Mild: 1.5 - 2 mEq/L Moderate: 2 - 3 mEq/L • Tinnitus Ringing in ears Severe: > 3 mEq/L • Slurred speech • Coma • Convulsions • Tremors • Weight gain HOW DOES TOXICITY HAPPEN? • Dehydration causes ↑ lithium levels in blood • Hyponatremia • Old age ↓ kidney function...this means lithium builds up in the blood EDUCATION • Carry ID that shows you are taking lithium CONTRADICTIONS • Pregnancy category D: Contradicted in pregnancy & breastfeeding • Renal / cardiovascular disease • Dehydrated patients Excessive diarrhea or vomiting • Receiving diuretics • Sodium depletion • Hypersensitivity to tartrazine • Educate on signs & symptoms of toxicity • Educate and stress importance of taking medication regularly • Serum lithium levels should be checked every 1-2 months • Do not operate heavy machinery or drive • Educate on drinking plenty of water to avoid dehydration (therefore avoiding toxicity) • Avoid starting a low salt diet Sudden ↓ in salt = ↑ in lithium 60 ANTIDEPRESSANT DRUGS SNRI’s/DNRI’s SSRI’s Serotonin / Norepinephrine & Dopamine / Norepinephrine reuptake inhibitor DRUG TABLE NURSING CONSIDERATIONS SIDE EFFECTS USES ACTION Selective serotonin reuptake inhibitor Inhibits uptake of serotonin = ↑ serotonin • Depression • Anxiety NEURO • Headache • Tremors • Difficulty sleeping 3 S’s of SSRI’s Think Smiley Serotonin • OCD • Eating disorders GI • Nausea • Urinary retention • Dry mouth / thirst • Sexual dysfunc• Constipation tion SEROTONIN SYNDROME • Serotonin syndrome • Sexual dysfunction • Stomach issues • Too much serotonin in the brain • Mental changes • Tachycardia • Tightness in muscles • Difficulty walking • ↑BP & temp Affects serotonin, norepinephrine & dopamine • Depressive episodes • Anxiety disorders • Fibromyalgia • Diabetic neuropathy pain NEURO • Headache • Dizziness • Vertigo • Photosensitivity • Agitation/tremors • Insomnia GI • Dry mouth/thirst • Dehydration • Constipation • Nausea/diarrhea • May take 4 -6 weeks to take effect Educate on the importance of compliance • Take medication in the morning • First line drug for depression/anxiety SUICIDE WARNING A client who had suicidal plans may now have the energy due to the medication to carry out the plans! • May take 4-6 weeks to take effect Educate on the importance of compliance • Do not mix with TCA’s or MAOI’s • Zyban is used for smoking cessation. Do not use it while taking bupropion for depression – it could cause overdose. GENERIC sertraline TRADE NAME Zoloft GENERIC bupropion TRADE NAME Zyban & Wellbutrin citalopram Celexa duloxetine Cymbalta escitalopram Lexapro venlafaxine Effexor XR fluoxetine Prozac milnacipran Savella vilazodone Viibryd nefazodon — SUFFIXES SUFFIXES -talopram, -oxetine, -zodone -faxine, -zodone, -nacipram 61 ANTIDEPRESSANT DRUGS Tricyclic antidepressants Monoamine oxidase inhibitor Blocks reuptake of serotonin & norepinephrine in the brain Blocks monoamine oxidase which causes ↑ in epinephrine, norepinephrine, dopamine, & serotonin, which causes stimulation of the CNS! Depression USES MAOI’s ACTION TCA’s • Depressive episodes • Bipolar disorder • OCD • Neuropathy • Enuresis Ca heart p uses patien roblems in isting c ts with pre-e xa or elde rdiac conditio rly clie ns with ca nts...give ution! Educate on the importance of compliance • WAIT 14 days after being off MAOI’s to start taking TCA’s • Amoxapine is not an antipsychotic drug but similar to these drugs, it may cause TD & NMS (D/C the drug immediately if these symptoms occur) GI • Constipation • Dry mouth • Nausea/ vomiting HYPERTENSIVE CRISIS • Headache • Stiff neck • Nausea / vomitting • Fever Seek • Dialated pupils medical h elp to blood ↓ pressu re • Can take up to 4 weeks to reach therapeutic levels Educate on the importance of compliance • Educate on the signs & symptoms of HTN crisis • Avoid foods with Tyramine • Aged cheese • Fermented meats • Chocolate • Caffeinated beverages • Sour cream & yogurt TRADE NAME — GENERIC phenelzine TRADE NAME Nardil amoxapine — tranylcypromine Parnate clomipramine Anafranil isocarboxazid Marplan protriptyline Vivactil nortriptyline Pamelor SUFFIXES DRUG TABLE GENERIC amitriptyline NURSING CONSIDERATIONS • May take 2- 3 weeks to take effect NEURO • Orthostatic hypotension • Dizziness • Blurred vision SIDE EFFECTS • Constipation • Dry mouth • Drowsiness • Blurred vision • Orthostatic hypotension • Urine retention • Cardiotoxic -triptyline, -pramine 62 ANTIANXIETY DRUGS (ANXIOLYTICS) BENZODIAZEPINES Not a fi rst-line drug fo r treatin g long-te rm psychia tric anx ie ty conditio ns RX Bipolar disorder Benzo’s are mainly prescribed for acute anxiety, sedation/muscle relaxant, seizures, & alcohol withdrawal ACTION GENERIC alprazolam TRADE NAME Xanax lorazepam Ativan diazepam Valium clonazepam Klonopin chlordiazepoxide Librium SUFFIXES Binds to cell receptors enhancing the effects of GABA -zolam & -zepam GABA (inhibitory neurotransmitter) slows/calms the activity of the nerves in the brain Antidote: FLUMAZENIL ADVERSE DRUG REACTIONS (ADR’S) • Mild drowsiness, sedation • Lightheadedness, dizziness, ataxia • Visual disturbances NURSING CONSIDERATIONS TO HELP WITH ADR’S Take at night if it makes you dizzy/drowsy Rise slowly from sitting or lying Do not drive or operate heavy machinery • Anger, restlessness • Nausea, constipation, diarrhea • Lethargy, apathy, fatigue Fluids, fiber, & exercise! Give with food to ↓ GI upset Sips of water, suck on hard candy, chewing sugar-free gum • Dry mouth SYMPTOMS OF WITHDRAWAL Withdrawals typically happen when the medication is stopped abruptly or taken for >3 months • ↑ Anxiety • Agitation • ↑ HR • Seizures/tremors • ↑ BP • Insomnia • ↑ Temp/sweating • Vomiting • ↓ Memory • Muscle aches NURSING CONSIDERATIONS • Not meant for long term therapy because ↑ risk for physical & psychological DEPENDENCE • Use of long term therapy leads to TOLERANCE Larger doses of the drug are required to achieve the desired outcome • Must be TAPERED ↓ the dosage gradually. NEVER stop the medication abruptly! CONTRAINDICATIONS & PRECAUTIONS • Pregnant, laboring & lactating women (Preg Category D) • Elderly (↑ chance of dementia) • Impaired liver or kidney function • Debilitation ACTION NONBENZODIAZEPINES Depends on the drug buspirone (Buspar) acts on serotonin receptors hydroxyzine (Vistaril) acts on the hypothalamus & brainstem reticular formation GENERIC TRADE NAME buspirone Buspar doxepin Silenor hydroxyzine Vistaril meprobamate — 63 ANTIPSYCHOTICS Most commonly used for psychosis (schizophrenia) REVIEW: Why are SGA’s better than FGA’s? SGA's work on both postive & negative symptoms, and have a lower risk of developing tardive dyskinesia (TD). FIRST GENERATION ANTIPSYCHOTICS (FGA’s) SECOND GENERATION ANTIPSYCHOTICS (SGA’s) Also called typical/conventional Also called atypical GENERIC TRADE NAME GENERIC TRADE NAME risperidone Risperdal chlorpromazine — clozapine Clozaril haloperidol Haldol quetiapine Seroquel loxapine Adasuve ziprasidone Geodon aripiprazole Abilify ACTIONS OF FGA’s ACTIONS OF SGA’s • Blocks/inhibits dopamine from being released in the brain • Acts on both serotonin & dopamine in the brain • Helps diminish positive symptoms of schizophrenia SIDE EFFECTS OF FGA’s • Helps diminish positive symptoms of schizophrenia & helps negative symptoms as well! SIDE EFFECTS OF SGA’s SIDE EFFECTS OF BOTH • Lower risk of TD, EPS & NMS • Anticholernergic effects • Higher risk of TD, EPS, & NMS • ↑ Weight • Photophobia • Orthostatic hypotension • ↑ Cholesterol • ↑ Triglyceride • Photosensitivity • ↑ Blood sugar • Sedation/lethargy TARDIVE DYSKINESIA (TD) EXTRAPYRAMIDAL SYNDROME (EPS) NEUROLEPTIC MALIGNANT SYNDROME (NMS) • Involuntary movements of the face, tongue, or limbs that may be irreversible. • Parkinson’s like symptoms • Akathesia (restlessness) • Dystonia (muscle twitching) • Combination of symptoms: EPS, high fever, & autonomic disturbance • One can recover 7-10 days after DC of medication, but it can be fatal if not treated in time • Parkinson’s disease • Comatose pt. • Liver problems • Depressed • Coronary artery disease • Bone marrow depression • Blood dyscrasias • Hyper or hypotension • Educate that it may take 6 - 10 weeks to take effect • Tell patient about adverse reactions and emphasize that adherence is very important FGA’s • Hypersensitivity NURSING CONSIDERATIONS SGA’s CONTRAINDICATIONS • Teach S&S of TD, EPDS, & NMS! • Advise the client to get up slowly • Check labs (blood sugar, LDL, triglycerides) • To decrease the risk of gaining weight, advise the patient about exercise, low-calorie diet, & monitor their weight. 64 MOTHER BABY Nurse in the making 65 ABBREVIATIONS IUP/IUFD....... Intrauterine pregnancy / intrauterine fetal demise SAB................ Spontaneous abortion TAB................. Therapeutic abortion LMP................ Last menstrual period ROM............... Rupture of membranes SROM............. Spontaneous rupture of membranes AROM............ Artificial rupture of membranes PROM............. Prolonged rupture of membranes (>24 hours) PPROM.......... Preterm premature rupture of membranes SVD................ Spontaneous vaginal delivery FHR................ Fetal heart rate EFM................ Electronic fetal monitoring US................... Ultrasound transducer (detects FHR) FSE................. Fetal scalp electrode (precise reading of FHR) IUPC............... Intrauterine pressure catheter (strength of contractions) LTV................. Long term variability SVE................. Sterile vaginal exam MLE................ Midline episiotomy NST................ Non-stress test CST................. Contraction stress test BPP................. Biophysical profile VBAC.............. Vaginal birth after cesarean AFI.................. Amniotic fluid index BUFA.............. Baby up for adoption NPNC............. No prenatal care PTL................. Preterm labor BOA................ Born on arrival BTL................. Bilateral tubal ligation D&C / D&E.... Dilation & curettage / dilation & evacuation LPNC.............. Late prenatal care TIUP............... Term intrauterine pregnancy VMI / VFI....... Viable male infant / viable female infant EDB................ Estimated date of birth EDC................ Estimated date of confinement EDD................ Estimated date of delivery PREGNANCY DURATION 40 weeks gestational age The number of completed weeks counting from the 1st day of the last normal menstrual cycle (LMP). 38 weeks fetal age This refers to the age of the developing baby, counting from the estimated date of conception. The fetal age is usually 2 weeks less than the gestational age. TRIMESTERS First Trimester 0 – 13 WEEKS Second Trimester 14 – 26 WEEKS Third Trimester 27 – 40 WEEKS PRENATAL TERMS Gravida / Gravidity Preterm A woman who is pregnant / the number of pregnancies Nulligravida Primigravida Multigravida Never been pregnant Pregnant for the first time A woman who has had 2+ pregnancies Parity The number of pregnancies that have reach viability (20 weeks of gestation) whether the fetus was born alive or not Nullipara Primipara Multipara 0 Zero pregnancies beyond viability (20 weeks) 1 One pregnancy that has reached viability (20 weeks) 2+ Two or more pregnancies that have reached viability (20 weeks) Pregnancies that have reached 20 weeks but ended before 37 weeks Term Pregnancies that have lasted between week 37 and week 42 Early Term: 37 – 38 6/7 Full Term: 39 – 40 6/7 Late Term: 41 – 41 6/7 Postdate/Postterm A pregnancy that goes beyond 42 weeks 66 GTPAL An acronym used to assess pregnancy outcomes G T P GRAVITY The number of pregnancies TERM BIRTHS The number born at term PRE-TERM BIRTHS The number of pregnancies delivered beginning with the 20th - 36 6/7th weeks of gestation • Includes the present pregnancy • Includes miscarriages / abortions • Twins / triplets count as one • > 37th week of gestation • Includes alive or stillborn • Twins / triplets count as one • Includes alive or stillborn • Twins / triplets count as one A ABORTIONS / MISCARRIAGES The number of pregnancies delivered before 20 weeks gestation L LIVING CHILDREN The number of current living children • Counts with gravidity • Twins / triplets count as one • Twin / triplets count individually ANSWER KEY Q#1 is (D) 3-2-0-1-2 Q#2 is (C) 4-2-1-0-4 PRACTICE QUESTION 1 You are admitting a patient to the mother-baby unit. Two hours ago she delivered a boy on her due date. She gives her obstetric history as follows: she has a three-year-old daughter who was delivered a week past her due date and last year she had a miscarriage at 8 weeks gestation. How would you note this history using the GTPAL system? A. 2-2-1-0-2 B. 3-2-1-0-1 C. 3-2-1-0-2 D. 3-2-0-1-2 PRACTICE QUESTION 2 A prenatal client’s obstetric history indicates that she has been pregnant 3 times previously and that all her children from previous pregnancies are living. One was born at 39 weeks gestation, twins were born at 34 weeks gestation, & another child was born at 38 weeks gestation. She is currently 38 weeks pregnant. What is her gravidity & parity using the GTPAL system? A. 4-1-3-0-4 B. 4-1-2-0-3 C. 4-2-1-0-4 D. 4-2-2-0-4 67 PREGNANCY SIGNS & SYMPTOMS PRESUMPTIVE SUBJECTIVE P Period Absent (Amenorrhea) R Really tired E Enlarged breasts S Sore breasts U Urination increased (urinary frequency) M Movement perceived (quickening) E Emesis & nausea PROBABLE OBJECTIVE Think “Mom” These are changes felt by the women that are subjective. Can be associated with other things. NOT a definite diagnosis for pregnancy! Why is quickening not a positive sign? Quickening can be difficult to distinguish from peristalsis or gas so it can not be a positive sign. Pregnancy signs that the Think “Doctor” nurse or doctor can observe P Positive (+) pregnancy test (high levels of the hormone: hCG) R Returning of the fetus when uterus is pushed w/ fingers (ballottement) O Objective Why is a positive pregnancy test not a positive sign? B Braxton hicks contractions A A softened cervix (Goodell's sign) B Bluish color of the vulva, vagina, or cervix (Chadwick's sign) L Lower uterine segment soft (Hegar's sign) E Enlarged uterus High levels of hCG can be associate with other conditions such as certain medications or hydatidiform mole (molar pregnancy). POSITIVE OBJECTIVE F Fetal movement palpated by a doctor or nurse E Electronic device detects heart tones q T The delivery of the baby U Ultrasound detects baby S Seeing visible movements Think “Baby” Can only be attributed to a fetus Definite diagnosis for pregnancy! 68 PREGNANCY PHYSIOLOGY HORMONES Prolactin: Allows for breast milk production Estrogen: Growth of fetal organs & maternal tissues Progesterone & Relaxin: Relaxes smooth muscles hCG: Produced by placenta, prevents menstruation Oxytocin: Stimulates contractions at the start of labor MUSCULOSKELETAL • Lordosis: center of gravity shifts forward leading to inward curve of spine • Low back pain • Carpal tunnel syndrome • Calf cramps RESPIRATORY • ↑ Basal metabolic rate (BMR) • ↑ O2 needs • Respiratory alkalosis (MILD) PITUITARY • ↓ FSH/LH due to ↑ Progesterone • ↑ Prolactin • ↑ Oxytocin CARDIOVASCULAR • ↑ Cardiac output (↑ Heart rate + ↑ stroke volume) • Blood pressure stays the same or a slight decrease • ↑ in plasma volume • Enlarges (May develop systolic murmurs) THYROID • ↑ Thyroxine • May have moderate enlargement of the thyroid gland (goiter) • ↑ Metabolism & ↑ appetite q RENAL • ↑ GFR from ↑ plasma volume • Smooth muscle relaxation of the uterus = ↑ risk of UTI’s! • ↑ Urgency, frequency & nocturia • EDEMA!! GASTROINTESTINAL • Pyrosis ↑ Progesterone = LOS to relax = ↑ heartburn • Constipation & hemorrhoids ↑ Progesterone = ↓ gut motility • Pica Non-food cravings such as ice, clay, and laundry starch SKIN • Striae Stretch marks (abdomen, breasts, hips, etc) • Chloasma Mask of pregnancy Brownish hyperpigmentation of the skin • Linea Nigra “Pregnancy line” dark line that develops across your belly during pregnancy • Montgomery glands / Tubercles Small rough / nodular / pimple-like appearance of the areola (nipple) HEMATOLOGICAL FIBRINOGEN Non-pregnant levels: 200-400 mg/dL Pregnant levels: up to 600 mg/dL Pregnant women are HYPERCOAGULABLE (increased risk for DVT's) • ↑ White blood cells • ↓ Platelets RBC VOLUME PLASMA VOLUME ANEMIA ANEMIA Plasma volume is greater than the amount of red blood cell (RBC) = hemodilution = physiological anemia 69 NAEGELE'S RULE → Used for estimating the expected date of delivery (EDD) based on LMP (last menstrual period) REMEMBER: → How many days are in each month? 30 days hath September, April, June & November. All the rest have 31, except February alone (28 days) EXAMPLE Date of Last Menstrual Period – 3 Calendar Months + 7 Days + 1 Year 1st day of last period: Minus 3 calendar months: Plus 7 days: Plus 1 year: September 2, 2015 June 2, 2015 June 9, 2015 June 9, 2016 (EDD) FACTS ABOUT NAEGELE'S RULE q Bases calculation on a woman who has a 28-day cycle (most women vary) q The typical gestation period is 280 days (40 weeks) q First-time mothers usually have a slightly longer gestation period WHAT TO AVOID DURING PREGNANCY TERATOGENIC DRUGS REMEMBER THE ! MNEMONIC TERA-TOWAS T Thalidomide E Epileptic medications (valproic acid, phenytoin) R Retinoid (vit A) A Ace inhibitors, ARBS T Third element (lithium) O Oral contraceptives TORCH INFECTIONS TORCH infections are a group of infections that cause fetal abnormalities. Pregnant women should avoid these infections! REMEMBER THE ! MNEMONIC TORCH T Toxoplasmosis Parv O Virus-B19 (fifth disease) W Warfarin (coumadin) R Rubella A Alcohol C Cytomegalovirus S Sulfonamides & sulfones H Herpes simplex virus 70 STAGES OF LABOR STAGE 1 LATENT (EARLY) INTERVENTIONS Longest Stage CERVIX DILATES FROM 0-10 CM q Cervix dilates: 1- 3 cm q Intensity: Mild q Contractions: 15 - 30 mins ACTIVE q Promote comfort - Warm shower, massage, or epidural q Offer fluids & ice chips q Provide a quiet environment q Encourage voiding every 1 - 2 hours q Encourage participation in care & keep informed q Instruct partner in effleurage (light stroking of the abdomen) q Encourage effective breathing patterns & rest between contractions q Cervix dilates: 4 - 7 cm q Intensity: Moderate q Contractions: 3 -5 min (30-60 sec in duration) REMEMBER THE ! MNEMONIC TRANSITION q Cervix dilates: 8 - 10 cm q Intensity: Strong q Contractions: Every 2-3 min (60-90 sec in duration) STAGE 2 STAGE 3 THE BABY IS DELIVERED >30 MIN = RETAINED PLACENTA THE PLACENTA IS DELIVERED → Starts when cervix is fully dilated & effaced The PLACENTA is expelled (5 - 30 min after birth) → Ends after the baby is delivered SIGNS OF A PLACENTA DELIVERY !!! PUSHING q Provide praise & encouragement to the mother q Maintain privacy & encourage rest between contractions q Encourage effective breathing patterns & rest between contractions q Monitor for signs of birth (perineal bulging or visualization of fetal head) STAGE 4 INTERVENTIONS q Monitor uterine contractions & mothers vital signs RECOVERY! DELIVERY MECHANICS q Gush of blood "Shiny Schultz" Side of baby delivered 1st q Uterus changes from oval to globular shape "Dirty Duncan" Side of mother delivered 1st q Lengthening umbilical cord q Provide ice chips & ointment for dry lips INTERVENTIONS Labor Actively Transitioning q Assessing mothers vital signs q Uterine status (fundal rubs every 15 minutes) q Provide warmth to the mother q Promote parental-neonatal attachment q Examine placenta & verify it's intact - Should have 2 arteries & 1 vein q FIRM A A V q Midline RECOVERY: first 1-4 hours after delivery of the placenta q Soft q Assessing the fundus q Boggy q Continue to monitor vital signs & temperature for infection q Displaced q Administer IV fluids q Monitor lochia discharge (lochia may be moderate in amount & red). q Monitor for respiratory depression, vomiting, & aspiration if general anesthesia was used q Great time to watch for complications such as bleeding (postpartum hemorrhage) TIP Looks like smiley face! 2 "A" for Arteries 1 "V" for Vein 71 TRUE VS. FALSE LABOR CONTRACTIONS FALSE LABOR • Irregular • Stops with walking / position change • Felt in the back or the abdomen above the umbilicus • Often stops with comfort measures TRUE LABOR • Occur regularly - Stronger - Longer - Closer together • More intense with walking • Felt in lower back -> radiating to the lower portion of the abdomen • Continue despite the use of comfort measures CERVIX • May be soft • NO significant change in.... - Effacement - Dilation • No bloody show • In posterior position (baby's head facing mom's front of belly) • Progressive change - Softening - Effacement - Dilation signaled by the appearance of bloody show - Moves to an increasingly anterior position (baby's head facing mom's back) FETUS • Presenting parts become engaged in the pelvis • Presenting part is usually not engaged in the pelvis • Increased ease of breathing (more room to breathe) • Presenting part presses downward & compresses the bladder = urinary frequency SIGNS OF LABOR LABOR Moving the fetus, placenta, & the membranes out of the uterus through the birth canal Signs of Preceding Labor • Lightening • Increased vaginal discharge (bloody show) • Return of urinary frequency • Cervical ripening • Rupture of membranes "water breaking" • Persistent backache • Stronger Braxton Hicks contractions • Days preceding labor - Surge of energy - Weight loss (1- 3.5 pounds) from a fluid shift 72 FETAL HEART TONES fetal heart rate Cause: q From head compression Intervention: q Continue to monitor q No intervention needed mom's contractions NORMAL! EARLY DECELERATIONS fetal heart rate mom's contractions NON-REASSURING LATE DECELERATIONS mom's contractions fetal heart rate VARIABLE DECELERATIONS NON-REASSURING Normal fetal heart rate 120 - 160 BPM "Mirror" image of mom's contractions (They don't technically come early ) Literally comes late after mom's contraction Cause: q Uteroplacental insufficiency Intervention: q D/C oxytocin q Position change q Oxygen (nonrebreather) q Hydration (IV fluids) q Elevate legs to correct the hypotension *Variable: Looks "V" shaped Cause: q Cord compression Intervention: q D/C Oxytocin q Amnioinfusion q Position change q Breathing techniques q Oxygen (nonrebreather) Side-lying or knee chest will relieve pressure on cord 73 PREECLAMPSIA OVERVIEW 20 WEEKS CHRONIC HTN: 2nd Trimester GESTATIONAL HTN: HTN after 20 weeks without systemic features SIGNS & SYMPTOMS PATHOLOGY "PRE" eclampsia E Edema Triad Signs Rising BP SYSTOLIC >140 OR PREECLAMPSIA: HTN after 20 weeks gestation with systemic features Before pregnancy or before 20 weeks! P Proteinuria 3rd Trimester HYPERTENS IO T IS A H q Visual disturbances Hypertension may be abbreviated "HTN" Pathology isn't completely known q HX of preeclampsia in previous PLACENTA is the root cause q Family history of preeclampsia pregnancies q 1st pregnancy q Obesity AMA (advanced maternal age) q Very young (<18) or very old (>35) q Medical conditions q Systemic vasoconstriction & endothelial dysfunction q RUQ or epigastric pain DIASTOLIC > 90 RISK FACTORS q Defective spiral artery remodeling q Severe headache N? 1st Trimester W Overview of Hypertensive disorders during pregnancy (Chronic HTN, renal disease, diabetes, autoimmune disease) q ↓ Urine output q Hyperreflexia ECLAMPSIA q Rapid weight gain ROME HELLP SYND (seizures activity or a coma) Variant of preeclampsia Life-threatening complication Immediate care: • Side-lying • Padded side rails with pillows/blankets H Hemolysis • O2 EL Elevated liver enzymes • Suction if needed • Do not restrain LP Low platelet count • Do not leave MAGNESIUM SULFATE TOXICITY! RX given to prevent seizures during & after labor. *Remember: magnesium acts like a depressant THERAPEUTIC RANGE: 4 – 7 mg/dL *Mag is excreted in urine • RR <12 ↓UOP → ↑Mag levels • ↓ DTR's • UOP <30 mL/hr • EKG Changes ANTIDOTE: calcium gluconate *because magnesium sulfate can cause respiratory depression 74 VEAL CHOP A tool to help interpret fetal strips V E A L Variability → Early Decelerations → Accelerations → Late Decelerations → C H O P Cord Compression Head Compression OK (normal fetal oxygenation) Placental Insufficiency ASSESSMENT OF UTERINE CONTRACTIONS Duration Frequency Intensity Resting Tone BEGINNING of the contraction to the END of that same contraction • Lasts 45 - 80 seconds • Should not exceed 90 seconds Number of contractions from the BEGINNING of one contraction to the BEGINNING of the next • 2 - 5 contractions every 20 minutes • Should not be more FREQUENT then every 2 minutes Only measured through external monitoring Strength of a contraction at its PEAK • 25 - 50 mm Hg • Should not exceed 80 mm HG Only measured through external monitoring Can be palpated • Average: 10 mm HG TENSION in the uterine muscle between contractions • Should not exceed 20 mm HG (relaxation of the uterus = Can be palpated fetal oxygenation between contractions) Mild - nose Moderate - chin Strong - forehead Soft = good Firm = not resting enough 75 LABOR & BIRTH PROCESSES 5 P's 5 factors that affect the process of labor & birth PASSENGER PASSAGEWAY POSITION POWERS PSYCHOLOGY Fetus & Placenta The Birth Canal Position of the Mother Contractions Emotional Response PASSENGER Fetus & Placenta SIZE OF THE FETAL HEAD FETAL PRESENTATION FONTANELS • Space between the bones of the skull allows for molding • Anterior (larger) - Diamond-shaped - Ossifies in 12-18 months • Posterior - Triangle shaped - Closes 8 - 12 weeks Refers to the part of the fetus that enters the pelvic inlet first through the birth canal during labor ANTERIOR Moston CEPHALIC Comm • Head first • Presenting part: Occipital (back of head/skull) BREECH • Buttocks, feet, or both first • Presenting part: Sacrum MOLDING • Change in the shape of the fetal skull to "mold" & fit through the birth canal POSTERIOR SHOULDER • Shoulders first • Presenting part: Scapula FETAL LIE Relation of the long axis (spine) of the fetus to the long axis (spine) of the mother LONGITUDINAL OR VERTICAL • The long axis of the fetus is parallel with the long axis of the mother • Longitudinal: cephalic or breech TRANSVERSE, HORIZONTAL, OR OBLIQUE • Long axis of the fetus is at a right angle to the long axis of the mother • Transverse: vaginal birth CANNOT occur in this position • Oblique: usually converts to a longitudinal or transverse lie during labor CONTINUED → 76 LABOR & BIRTH PROCESSES PASSENGER CONTINUED FETAL ATTITUDE FETAL POSITION GENERAL FLEXION • Back of the fetus is rounded so that the chin is flexed on the chest, thighs are flexed on the abdomen, legs are flexed at the knees BIPARIETAL DIAMETER • 9.25 cm at term, the largest transverse diameter and an important indicator of fetal head size FETAL STATION • Where the baby's presenting part is located in the pelvis • Presenting part? - Head, foot, butt (closest to exit of uterus) • Measured in centimeters (cm) - Find the ischial spine = zero - Above the ischial spine is (-) - Below the ischial spine is (+) +4 / +5 = Birth is about to happen - Documented -5, -4, -3, -2, -1, 0, +1, +2, +3, +4, +5 ENGAGEMENT • Fetal station zero = baby is "engaged" • Presenting parts have entered down into the pelvis SUBOCCIPITOBREGMATIC DIAMETER inlet & is at the ischial spine line (0) • Most critical & smallest of the • When does this happen? anteroposterior diameters - First-time moms: 38 weeks G N I N E Already had babies: LIGHT is this? t a can happen when h W drops" baby " e th n labor starts Whe other's em pelvis into th PASSAGEWAY The Birth Canal: Rigid bony pelvis, soft tissue of cervix, pelvic floor, vagina & introitus TYPES OF PELVIS GYNECOID • Classic female type • Most common ANDROID • Resembling the male pelvis ANTHROPOID • Oval-shaped • Wider anteroposterior diameter PLATYPELLOID • The flat pelvis • Least common SOFT TISSUE LOWER UTERINE SEGMENT • Stretchy CERVIX • Effaces (thins) & dilates (opens) • After fetus descends into the vagina, the cervix is drawn upward and over the first portion PELVIC FLOOR MUSCLES • Helps the fetus rotate anteriorly VAGINA INTROITUS • External opening of the vagina 77 LABOR & BIRTH PROCESSES POSITION Position of the mother during Moston Comm UPRIGHT POSITION Sitting on a birthing stool or cushion LITHOTOMY POSITION Supine position with buttocks on the table "ALL FOURS" POSITION On all fours: putting your weight on your hands & feet LATERAL POSITION Laying on a side POWERS Frequent changes in position helps with: • Relieving fatigue • Increasing comfort • Improving circulation Contractions: Primary & Secondary PRIMARY POWERS SECONDARY POWERS Involuntary uterine contractions Signals the beginning of labor Does not affect cervical dilation but helps with expulsion of infant once the cervix is fully dilated • Voluntary bearing-down efforts by the women once the cervix has dilated DILATION • Dilation of the cervix is the enlargement or widening of the cervical opening & canal once labor has begun • Cervix: closed → full dilation (10 cm) • Pressure from amniotic fluid can also apply force to dilate • Shortening & thinning of the cervix during the first stage of labor 2 -3 cm long 1 cm thick • Laboring women start to feel an involuntary urge to push & she uses secondary powers to aid in the expulsion of the fetus PSYCHOLOGY EFFACEMENT • Cervix normally: • When the presenting part reaches the pelvic floor, the contractions change in character & become expulsive. Degre e of EFFAC E M ENT is EXP RESSE D in % (0-100 %) • The cervix is "pulled back / thinned out" by a shortening of the uterine muscles FERGUSON REFLEX • When the stretch receptors release oxytocin, it triggers the maternal urge to bear down Emotional Response Anxiety can increase pain perception & the need for more medications (analgesia & anesthesia) THINGS TO CONSIDER: SOCIAL SUPPORT PAST EXPERIENCE KNOWLEDGE 78 NEWBORN ASSESSMENT APGAR SCORE Activity (Muscle tone) Pulse Grimace (Reflex irritability) Appearance O POINTS 1 POINT 2 POINTS Absent Flexed arms & legs Active 0 < 100 > 100 Floppy (Skin color) Respiration No breathing VITAL SIGNS Slow & irregular Assess for a full minute! Si Head & chest circumference s tres Dis Respiratory Rate: 30 - 60 BREATHS /MIN *Irregular pattern, abdominal breathers Heart Rate: 110 - 160 BPM Can be 180 if crying Can be 100 if sleeping Take apical pulse for 1 full min Temperature (Axillary): Respirator s of y 97.7 - 99.5 F gn 36.5 - 37.5 C Retra Blood Pressure: ctions Nasa Not done routinely l Flari ng Systolic 60 – 80 mm Hg Grunt Diastolic 40 – 50 mm Hg ing MAP # of weeks gestation or higher GENERAL CHARACTERISTICS 1ST PRIORIT Y Pink all over Vigorous cry 2ND PRIORI TY Dry with a blanket = WARMTH or place in warme r. CIRCULATORY SYSTEM • Blood flow from umbilical vessels & placenta stop at birth • Acrocyanosis: Blueness of hands & feet (normal during the first 24 hours of life) • Closure of q Ductus arteriosus q Foramen ovale q Ductus venosus • Transient murmurs are normal HEAD Caput Succedaneum: • Edema (collection of fluid) • Crosses the suture lines (like a baseball cap) Cephalohematoma: • Birth trauma (collection of blood) • Does not cross the suture lines • Molding: abnormal head shape that results from pressure (normal) • Fontanelles: Bulging = Increased ICP or hydrocephalus Fontane lles may be bulgin when the Sunken = Dehydration g newb or is lying UMBILICAL CORD A A V Should have 2 arteries & 1 vein Length & weight Expected Length Head circumference 44 - 55 cm 32 - 39 cm 17 - 22 in 14 - 15 inches *measure above eyebrows Expected Weight 2,500 - 400 g Chest circumference 5 lb, 8 oz - 8 lb, 14 oz 30 - 36 cm 12 - 14 inches *measure above nipple line = AIRWAY Suction w ith bulb s yringe / d *Newbor e ns are ob ligatory n ep suction ose brea thers Prompt Minimal response to response to stimulation stimulation Pink body, Blue / pale Blue extremities all over (acrocyanosis) (Effort) INITIAL GOALS: ↓ TEMP orns cr down. Th y, vomits, is is norm al. Should be dry, no odor, & no drainage HEAT LOSS DUE TO: ↓ A P G A R 7 - 10 supportive care 4 - 6 moderate depression < 4 aggressive resuscitation Evaporation: Moisture from skin & lungs Convection: Body heat to cooler air Conduction: Body heat to a cooler surface in direct contact Radiation: Body heat to a cooler object nearby 79 PEDIATRIC MILESTONES Nurse in the making 80 PEDIATRIC MILESTONES INFANT BIRTH - 12 MONTHS GROSS MOTOR FINE MOTOR 1 MONTH • Head lag • Rounded back while sitting • Lifts and turns head to the side in prone position 2 MONTHS • Raises head & chest • Head control improving 3 MONTHS • Raises head 45 degrees in prone • Tiny head lag in pull-to-sit 4 MONTHS • Lifts head & looks around • Rolls from prone to supine • Head leads body when pulled to sit 5 MONTHS • Rolls from supine to prone & back again • Sits with back upright when supported 6 MONTHS • Tripod sit • Releases objects in hand to take another 7 MONTHS • Sits alone with some use of hands for support • Transfers objects from one hand to the other 8 MONTHS • Sits unsupported • Gross pincer grasp (rakes) 9 MONTHS • Crawls with abdomen off the floor • Bangs objects together 10 MONTHS • Pull to stand • Able to cruise on objects (furniture) • Fine pincer grasp • Puts objects into containers & takes them out • Fists mostly clenched • Involuntary hand movements • Makes verbal noise (coos) • Holds hand in front of face with hands open FUN TIP! Rolls on the floor rhymes with four! • Bats at objects • Babbling (copies noises) • Grasps rattle FUN TIP! You grasp something with five fingers 11 MONTHS 12 MONTHS LANGUAGE • Babbles (nonspecific) • Offers objects to others & releases them • Walks independently • Sits down from standing position without assistance RECEPTIVE LANGUAGE • Understands common words independent of context • Follows a one-step gestured command • Feeds self finger-foods • Draws simple marks on paper • Turns pages in a book EXPRESSIVE LANGUAGE • First word (example: “mama”) • Uses a finger to point to things • Imitates: gestures & vocal • Receptive Language • Expressive Language • Signs of Delay SIGNS OF DELAY • After independent walking for several months - Persistent tiptoe walking - Failure to develop a mature walking 81 PEDIATRIC MILESTONES TODDLER GROSS MOTOR 15 MONTHS • Walks independently 18 MONTHS • Climbs stairs • Kicks a ball • Pulls toys • Able to stand on tiptoes RECEPTIVE LANGUAGE EXPRESSIVE LANGUAGE 30 MONTHS FUN TIP! Think: terrible twos! • Uses index finger to point • Uses their hands a lot for: reaching, grabbing, releasing, stacking blocks • Full pincer grasp developed • Removes shoes and socks • Turns book pages • Stacks four cubes SIGNS OF DELAY 24 MONTHS • Climbs on & off furniture • Feeds self finger foods FINE MOTOR 1-3 YEARS • Builds tower of 6-7 cubes • Right/left-handed • Scribbles, paints, & imitates strokes • Turns doorknobs • Puts round pegs into holes • Understands 100-150 words • Understands “no” • Follows commands without gestures • Says: “what’s this?” • Listens to simple stories • Repeats words • Vocab: 15-20 words • Vocab: 40-50 words • Babbles sentences • Uses names of familiar objects • Sentences of 2-3 words (ex. “want cookie") • Understands 200 words • Looks at adults when communicating • Points to named body parts/pictures in books • Follows a series of 2 independent commands • Says: “my” & “mine” • Vocab:150-300 words • Use descriptive words: hungry, hot, cold • Persistent tiptoe walking • Not walking • Does not develop a mature walking pattern • Not speaking 15 words • Does not understand the function of common household items • Does not: use two-word sentences, imitate actions, or follow basic instructions • Cannot push a toy with wheels 82 PEDIATRIC MILESTONES PRESCHOOL 3-6 YEARS G ROS S MOTOR FI NE MOTOR • Climbs well and runs easily • Pedals tricycle • Walks up & down stairs with alternating feet • Bends over without falling • Throws ball overhead • Kicks ball forward • Can bounce a ball back • Hops on one foot • Alternating feet going up & down steps • May be able to: • Skip • Swim • Skate • Climb • Swing • Undresses self • Copies circles • Tower of 9-10 • Holds a pencil • Screws and unscrews lids • Turns book pages one at a time • Uses scissors • Copies capital letter • Draws circles, squares, & traces a cross or diamond • Draws a person with 2-4 body parts • Laces shoes • Can draw a person and some letters • May dress/undress themselves • Can use a fork, spoon, & knife • Mostly cares for own toileting needs • Understands most sentences • Speaks in complete sentences • Understands physical relation (in, on, under) • Tells a story • Most of the child’s speech can be understood • Follows a 3-part command • Half of the conversation understood by outside family COMMUNICATION • Says: “why?” • 75% of speech understood by outside observers • Stays on topic in conversation • Knows the name of familiar animals • 3 or 4-word sentences • Knows at least one color • Talks about past • Vocab: 1,000 words • Says their name, age, & gender • Uses pronouns and plurals • Participates in long & detailed conversations • Talks about past, future, and imaginary events • Answers questions that use “why” and “when” • Can count to 10 • Can count a few numbers • Recalls part of a story • Vocab: 1,500 words • Difficulty with stairs • Falls a lot while walking • Can’t build a 4+ block tower • Extreme difficulty separating from parents • No make-believe play • Can't copy a circle • No short paragraphs • Doesn’t understand simple instructions • Unclear speech & drooling • Little interest in other kids • Explains how an item is used • Uses language to engage in make-believe Why? SIGNS OF D ELAY 5 YEARS 4 YEARS 3 YEARS • Says name & address • Speech should be completely intelligible, even if the child has articulation difficulties • Speech is generally grammatical correct • Vocab: 2,000 words • Can't jump in place or ride a tricycle • Can’t stack 4 blocks • Can’t throw a ball overhead • Does not grasp crayon with thumb and fingers • Difficulty with scribbling • Can’t copy a circle • Doesn’t say 3+ word sentences • Can’t use the words “me” & “you” • Ignores other children or doesn’t show interest in interactive games • Still clings or cries if parents leave • Sad often • Little interest in playing with other kids • Unable to separate from their parents • Is extremely aggressive, fearful, passive, or timid. • Easy distorted (can't concentrate for 5 minutes) • Can not do ADL’s by themselves (brush teeth, undress, wash & dry hands, etc) • Rarely engages in fantasy play 83 PEDIATRIC MILESTONES PHYSIOLOGICAL CHANGES Early Adolescence Middle Adolescence Late Adolescence 10-13 YEARS 14-16 YEARS 17-20 YEARS MAL E • Pubic hair spread laterally, begins to curl, pigmentation increases • Growth & enlargement of testes & lengthening of the penis • Lengthy look due to extremities growing faster than the trunk • Pubic hair becomes more coarse in texture & takes on adult distribution • Testes, scrotum, & penis continue to grow • Mature pubic hair distribution & coarseness • Breast enlargement disappears • The skin around the scrotum darkens • Adult size & shape of testes, scrotum, and penis • Glands penis develops • Scrotum skin darkening • May experience breast enlargement FEMA LE • First menstrual period (average age is 12 years) • Breasts bud and areola continue to enlarge (no separation of the breasts) • Pubic hair begins to curl & spread over the mons pubis • Pubic hair becomes coarse in texture • Amount of hair increases • Mature pubic hair distribution and coarseness • Areola & papilla separate from the contour of the breasts to form a secondary mound 84 MED-SURG RENAL/URINARY SYSTEM Nurse in the making 85 2YHUYLHZ2I7KH.LGQH\V )XQFWLRQV $bFLGEDVHEDODQFH 6WUXFWXUH :DWHUEDODQFH (OHFWURO\WHEDODQFH 7R[LQUHPRYDO %ORRGSUHVVXUHFRQWURO (U\WKURSRLHWLQ 9LWDPLQ' PHWDEROLVP *ORPHUXODU )LOWUDWLRQ 7XEXODU 5HDEVRUSWLRQ 7XEXODU 6HFUHWLRQ %ORRGIORZVLQWRWKH NLGQH\VP/PLQ )LOWHUVZDWHU HOHFWURO\WHV VPDOO PROHFXOHVLQWRWKH JORPHUXOXV /DUJH PROHFXOHVVWD\LQWKH EORRGVWUHDP )OXLGPRYHV IURPUHQDO WXEXOHVLQWRWKH FDSLOODULHV7KH\ UHDEVRUEIOXLG LQWRWKHYHQRXV FLUFXODWLRQ )OXLGPRYHV IURPWKH FDSLOODULHVLQWR WKHUHQDO WXEXOHVWRJHW HOLPLQDWHGH[F UHWHG 8ULQH ([FUHWLRQ 86 7(50672.12: '\VXULD3DLQIXOZKLOHXULQDWLQJ 1RFWXULD([FHVVLYHXULQDWLRQDWQLJKW +HPDWXULD%ORRG\XULQH )UHTXHQF\9RLGLQJPRUHWKDQHYHU\KRXUV 8UJHQF\6WURQJGHVLUHWRYRLG ,QFRQWLQHQFH,QYROXQWDU\YRLGLQJ (QXUHVLV,QYROXQWDU\YRLGLQJGXULQJVOHHS 3URWHLQXULD$EQRUPDODPRXQWVRISURWHLQLQWKHXULQH 2OLJXULD8ULQHRXWSXWP/GD\ $QXULD8ULQHRXWSXWP/GD\ 0LFWXULWLRQ9RLGLQJ /DE9DOXHV5HODWHGWR7KH.LGQH\V *ORPHUXODU)LOWUDWLRQEORRGIORZ WKURXJKWKHNLGQH\V ILOWUDWLRQ RFFXUV %ORRG8UHD1LWURJHQ1RUPDOZDVWH SURGXFWUHVXOWLQJIURPWKHEUHDNGRZQ RISURWHLQV /HYHOVFDQLQGLFDWHD SUREOHP EHWR[LFLQWKHERG\ (QGSURGXFWRIPXVFOH PHWDEROLVP$EHWWHULQGLFDWRU RINLGQH\IXQFWLRQWKDn%81 0HDVXUHVWKHNLGQH\ V DELOLW\WRH[FUHWHRU FRQVHUYHZDWHU 902P/PLQ PJG/ PJG/ 87 $FXWH*ORPHUXORQHSKULWLV 6,*16 6<037206 +HPDWXULD $]RWHPLD ([FHVVLYHQLWURJHQRXV ZDVWHLQWKHEORRG %81 &UHDWLQH 0DODLVH +HDGDFKH 3$7+2/2*< $QDFXWHLQIODPPDWRU\ UHDFWLRQLQWKHJORPHUXODU FDSLOODULHV $QWLERGLHVJHWORGJHGLQ WKHJORPHUXOL 3URWHLQXULD +\SRDOEXPLQHPLD 6FDUULQJ *)5 2OLJXULD (GHPD 0DLQFDXVH5HFHQWJURXS$ EHWDKHPRO\WLFVWUHSWRFRFFDO LQIHFWLRQ *)5 %ORRG3UHVVXUH 8ULQHVSHFLILFJUDYLW\ 'LHWb0RGLILFDWLRQV ,17(59(17,216 )OXLGUHVWULFWLRQ 6RGLXPUHVWULFWLRQ 3URWHLQ 3URYLGHDORWRIFDUERK\GUDWHV &DUERK\GUDWHV SURYLGHHQHUJ\ VWRSWKH EUHDNGRZQRI SURWHLQ 0RQLWRU 'DLO\LQWDNH RXWSXW 'DLO\ZHLJKW )L[WKHFDXVH VWUHS %HGUHVW $ZHLJKWJDLQRINJ LVHTXDOWRP/ RIUHWDLQHGIOXLG 'LXUHWLFV $QWLK\SHUWHQVLYHPHGLFDWLRQV 88 1HSKURWLF6\QGURPH 3$7+2/2*< (GHPD +\SHUOLSLGHPLD 'DPDJHWRPHPEUDQH 3URWHLQXULD &ODVVLF 6\PSWRPV ,QIODPPDWRU\UHVSRQVHLQ WKHJORPHUXOXV 6,*16 6<037206 /RVVRISURWHLQ $OEXPLQ &DXVHVV\QWKHVLVRI OLSRSURWHLQ +\SRDOEXPLQHPLD )OXLGVKLIW +\SHUOLSLGHPLD 3RVVLEOHEORRGFORWV WKURPERVLV ! JGD\ VHYHUH SURWHLQXULD *HQHUDOL]HGHGHPD ,17(59(17,216 'LHW0RGLILFDWLRQV &KROHVWHURO VDWXUDWHGIDWV 6RGLXPGLHW +LJKELRORJLFYDOXH +%9 0RGHUDWHSURWHLQLQWDNH 0HGLFDWLRQV 0HDW )LVK 3RXOWU\ 0LON (JJV 6R\ 'LXUHWLFV 6WDWLQV 3UHGQLVRQHWR LQIODPPDWLRQ $QWLQHRSODVWLFDJHQW ,PPXQRVXSSUHVVDQW 5HSRUWDQ\VLJQVRILQIHFWLRQ ,QIHFWLRQLVDPDMRUFRQFHUQ IRUWKLVSW 5HSRUWWKLQJVVXFKDV UHVSLUDWRU\LQIHFWLRQV 89 $FXWH.LGQH\ ,QMXU\ $., $FXWH.LGQH\,QMXU\ 6XGGHQUHQDOGDPDJH 3URORQJHG ,VFKHPLD YROXPHSHUIXVLRQWR WKHNLGQH\Vb +HPRUUKDJH 0\RJORELQXULD *,ORVVHV +HPRJORELQXULD YRPLWLQJGLDUUKHD 5KDEGRP\RO\VLV 1HSKURWR[LFDJHQWV RULPSDLUHG&DUGLDF ,QIHFWLRQV RXWSXW 9DVRGLODWLRQ 2EVWUXFWLRQLQWKHXULQDU\WUDFWb 6WRQHV %ORRGFORWV %HQLJQSURVWDWLFK\SHUSODVLD %3+ 7XPRUV 3KDVHV 6LJQV 6\PSWRPV 2OLJXULD 7ULJJHULQJHYHQW FHOOXODULQMXU\ 8ULQH2XWSXWP/KUV 'LDO\VLVPD\EHQHHGHG +\SHUNDOHPLD +HPDWXULD HU\WKURSRLHWLQ $QHPLD SURGXFWLRQ &DXVHRI$.,LVFRUUHFWHG *UDGXDO LQXULQDU\RXWSXW LQ.LGQH\IXQFWLRQ 0D\WDNHXSWRPRQWKV 0HGLFDWLRQV 6SHFLILFJUDYLW\ 0HWDEROLFDFLGRVLV 3KRVSKRUXV &DOFLXP ,QWHUYHQWLRQV 'LXUHWLFV 7UHDWK\SHUNDOHPLD ,9*OXFRVH ,QVXOLQ SRO\VW\UHQHVXOIRQDWH .D\H[DODWH 'LHW0RGLILFDWLRQV FDUERK\GUDWHV IDWV SURWHLQGLHW $YRLGIRRGVKLJKLQSKRVSKDWH $YRLGIRRGVKLJKLQSRWDVVLXP 90 &KURQLF.LGQH\'LVHDVH &.' 3URJUHVVLYH LUUHYHUVLEOH ORVVRINLGQH\IXQFWLRQ 67$*(6 6,*16 6<037206 6WDJHVDUHEDVHGRQWKH *)5UDWH $V&.'ZRUVHQV*)5 ,QWKHHQGVWDJHVRI&.'DOPRVWHYHU\ ERG\V\VWHPLVQHJDWLYLW\DIIHFWHG $ % /HWKDUJ\ $OWHU/2& &RQIXVLRQ 6HL]XUHV +\SHUWHQVLRQ )OXLGYROXPHH[FHVV +HDUWIDLOXUH $QRUH[LD 1DXVHDYRPLWLQJ 8UHPLFIHWRUb DPPRQLDEUHDWK 0HWDOOLFWDVWH ,PSDLUHGLPPXQH LQIODPPDWRU\UHVSRQVH 75($70(17 'LDO\VLV .LGQH\WUDQVSODQW $QHPLD HU\WKURSRLHWLQ 5LVNIRUEOHHGLQJ 3URORQJHGEOHHGLQJWLPH $PHQRUUKHD (UHFWLOHG\VIXQFWLRQ /LELGR 8UHPLFIURVW 3UXULWXV 91 +HPRGLDO\VLV 3HULWRQHDO'LDO\VLV 7KHGLDO\]HU DUWLILFLDONLGQH\ 'LDO\VDWHLVLQIXVHGLQWRWKHSHULWRQHDO FDYLW\E\JUDYLW\ %ULQJVEORRGWRWKHGLDO\]HU &ORVHWKHFODPSRQWKHLQIXVLRQOLQH )LOWHUVRXWWR[LQVZDVWHSURGXFWV 'LDO\VDWHGZHOOVIRUDVHWDPRXQWRIWLPH GZHOOWLPH %ULQJVFOHDQEORRGEDFNWRWKHERG\ 7KHGUDLQDJHWXEHLVXQFODPSHG ),678/$ *5$)7 -RLQLQJDQ ,QVHUWLQJV\QWKHWLF DUWHU\WRDYHLQ JUDIWPDWHULDOEHWZHHQ &DQWDNHXSWR DQDUWHU\DQGYHLQ ZHHNVWR &DQWDNHPRQWKV KHDO EHIRUHLWFDQPDWXUH %RWKUHTXLUHVXUJHU\ ;&RPSUHVVLRQ ;%ORRGGUDZV (YDOXDWLRQRI ;%ORRGSUHVVXUHUHDGLQJV 3DWHQF\ ;7LJKWFORWKLQJ )HHOWKHWKULOO ;&DUU\LQJEDJV +HDUWKHEUXLW ;6OHHSLQJRQWKDWDUP )OXLGGUDLQVIURPWKHSHULWRQHDOFDYLW\ E\JUDYLW\ $QHZFRQWDLQHURI'LDO\VDWHLVLQIXVHG DVVRRQDVGUDLQDJHLVFRPSOHWH 5(3($7 3(5,721($/ &$7+(7(5 3HUIRUPHGDWWKHEHGVLGHRULQWKH RSHUDWLQJURRP &ORXG\GUDLQDJHPD\LQGLFDWHLQIHFWLRQ 92 8ULQDU\7UDFW,QIHFWLRQ \ 3\HORQHSKULWLV &\VWLWLV 8UHWKULWLV 6LJQV 6\PSWRPV &KLOOV IHYHU /HXNRF\WRVLV %DFWHULXULD 3\XULD )ODQNSDLQ 1DXVHD YRPLWLQJ +HDGDFKH 0DODLVH 3DLQIXOXULQDWLRQ '\VXULD (OGHUO\SW V %XUQLQJRQXULQDWLRQ PD\VKRZ GLIIHUHQW )UHTXHQF\ XUJHQF\ V\PSWRPV 1RFWXULD ,QFRQWLQHQFH &RQIXVLRQ +HPDWXULD /HWKDUJ\ 1HZ ,QFRQWLQHQFH 7UHDWPHQW +\GUDWLRQ $QWLELRWLFV 3KHQD]RS\ULGLQH ŷIOXVKLQJŸRXWWKH XULQDU\WUDFW $QDOJHVLFWR SDLQ 0D\WXUQXULQH RUDQJH 93 5HQDO&DOFXOL 1HSKUROLWKLDVLVbVWRQHVLQWKH.LGQH\V 8UHWHUROLWKLDVLVbVWRQHVLQWKH8UHWHU 3$7+2/2*< 6WRQHVbFDQEHPDGHXSRI 0RVW &RPPRQ 6,*16 6<037206 3DLQLQWKH FRVWRYHUWHEUDOUHJLRQ 5,6.)$&7256 0DOHV 8ULQDU\VWDVLV +\SHUSDUDWK\URLGLVP +\SHUXULFHPLD JRXW 'HK\GUDWLRQ 'LVFRPIRUW +HPDWXULD 3\XULD 1DXVHD YRPLWLQJ ,17(59(17,216 0HGLFDWLRQV 16$,'V 2SLRLGVDQDOJHVLFV +RWEDWKV 0RLVWKHDWRQWKHLQIODPHGDUHD 'LHW )/8,'6 3URFHGXUHV $LGVLQIOXVKLQJ RXWWKHVWRQH ([WUDFRUSRUHDOVKRFNZDYHOLWKRWULSV\ (6:/ (QGRXURORJLF SHUFXWDQHRXV VWRQHUHPRYDO &UXVKHVWKHVWRQH 6WUDLQWKHXULQH DIWHU VHQGVWRQHV IRUDQDO\VLV 94 MED-SURG CARDIAC SYSTEM Nurse in the making 95 )/2:2)%/22'7+528*+7+(+($57 5,*+76,'( 6XSHULRUΔQIHULRU 9HQD&DYD 5LJKW$WULXP 7ULFXVSLG 5LJKW9HQWULFOH 3XOPRQLF9DOYH 3XOPRQDU\$UWHU\ /()76,'( 3XOPRQDU\9HLQ /HIW$WULXP %LFXSVLG0LWUDO /HIW9HQWULFOH $RUWLF9DOYH $RUWD 96 & $ 5 ' , $ & 7 ( 5 0 6 $PRXQWRIEORRGUHWXUQWRWKHULJKW VLGHRIWKHKHDUW 3UHVVXUHLQWKH$RUWDWKDWWKHOHIW YHQWULFOHKDVWRSXPSDJDLQVW WKH UHVLVWDQFHLWPXVWRYHUFRPH $PRXQWRIEORRGSXPSHGRXWRIWKH YHQWULFOHVZLWKHDFKEHDW &DUGLDF2XWSXW +HDUW5DWH[6WURNH9ROXPH &2 +5;69 97 /()76,'(' +($57)$,/85( ß B7 Ê ß B7 6<672/,&+) ',$672/,&+) :HDNHQHGKHDUWPXVFOH 6WLII QRQFRPSOLDQW KHDUWPXVFOH 7KHYHQWULFOHGRHVQRW ),//SURSHUO\ 7KHYHQWULFOHGRHVQRW (-(&7SURSHUO\ '7 îæ ßîæ h Ê '7 (-(&7,21)5$&7,21 () 9ROXPHRIEORRGH[SHOOHG ZLWKHYHU\FRQWUDFWLRQ h Ê ' îß 7 Êß 98 /()76,'(' +($57)$,/85( \VSQHD DOHV FUDFNOHV UWKRSQHD HDNQHVVIDWLJXH 2WKHU6 6 823 +\SRWHQVLRQ 6*DOORS RFWXUQDOSDUR[\VPDOG\VSQHD QFUHDVHG+5 DJJLQJFRXJK IURWK\EORRGWLQJHGVSXWXP DLQLQJZHLJKW OE VDGD\ 5,*+76,'(' +($57)$,/85( ZHOOLQJRIWKHOHJV KDQGV HLJKWJDLQ GHPD SLWWLQJ 2WKHU6 6 +HSDWRPHJDO\ 6SOHQRPHJDO\ $QRUH[LD DUJHQHFNYHLQV -9' HWKDUJ\IDWLJXH UUHJXODUKHDUWUDWH RFWXULD LUWK $VFLWHV 99 +($57)$,/85( %W\SH1DWULXUHWLF3HSWLGH 6HFUHWHGZKHQWKHUHLV SUHVVXUHLQWKH YHQWULFOH (QODUJHGKHDUW /RRNVDWHMHFWLRQ IUDFWLRQEDFNIORZ YDOYHSUREOHPV SXOPRQDU\LQILOWUDWHV ()LV LQPRVW W\SHVRI+) %13 LQ+) 0RQLWRU 6WULFW, 2 V 'DLO\ZHLJKWV (GHPD 6DPHWLPH 6DPHVFDOH 6DPHFORWKHV 'LHW0RGLILFDWLRQV )OXLGUHVWULFWLRQV 6RGLXP )DW 6SUHDGIOXLGVRXW GXULQJWKHGD\ 6XFNRQKDUGFDQG\ WR WKLUVW &KROHVWHURO %DODQFHSHULRGVRIDFWLYLW\ UHVW 5HSRUW6 6RIIOXLGUHWHQWLRQ (GHPD :HLJKWJDLQ (OHYDWH+2% 6HPL)RZOHU VSRVLWLRQ 100 /223 /223'LXUHWLF IXURVHPLGH EXPHWDQLGH WRUVHPLGH %XPH[ 'HPDGH[ /DVL[ ,QKLELW +\SHUWHQVLRQ +\SRNDOHPLD UHDEVRUSWLRQRI +HDUWIDLOXUH +\SRWHQVLRQ 1$ &O $FWVRQVLWHV UHDEVRUSWLRQ 2EWDLQEDVHOLQHYLWDO VLJQV $GPIXURVHPLGH 5HQDOGLVHDVH +\SRQDWUHPLD 6/2:/< UDSLGDGPFDQ (GHPD +\SHUJO\FHPLD FDXVHSHUPDQHQWKHDULQJ 3XOPRQDU\ 3KRWRVHQVLWLYW\ HGHPD ORVV 5HSODFH.LIP(T/ 'HK\GUDWLRQ 7+,$=,'('LXUHWLF K\GURFKORURWKLD]LGH FKORURWKLD]LGH 0LFUR]LGH 'LXULO ,QKLELW UHDEVRUSWLRQ RI1$ &O ([FUHWLRQRI 1D&O +2 PHWK\FORWKLD]LGH PHWK\FORWKLD]LGH PHWK\FORWKLD]LGH +\SHUWHQVLRQ +\SRNDOHPLD 2EWDLQEDVHOLQH +HDUWIDLOXUH +\SRWHQVLRQ YLWDOVLJQV 5HQDOGLVHDVH &LUUKRVLV (GHPD &RUWLFRVWHURLGV +\SRQDWUHPLD /LELGR +\SHUJO\FHPLD 3KRWRVHQVLWLYLW\ *LYHZPHDOVWR *,XSVHW 5HSODFH.LI P(T/ $YRLGJLYLQJWR (VWURJHQ 'HK\GUDWLRQ SW VZLWKJRXW 7KHUDS\ $]RWHPLD 0RQLWRUUHQDO IXQFWLRQ 101 26027,&'LXUHWLF PDQQLWRO 2VPLWURO WKHWKLFNQHVV RIWKHILOWUDWHVR ZDWHUFDQ WEH 7[RI FHUHEUDO HGHPD UHDEVRUEHG ([FUHWLRQRI1D &O (GHPD 2QO\DGPLQLVWHUHG,9 %OXUUHGYLVLRQ 0D\FU\VWDOL]H FKHFN 1DXVHDYRPLWLQJ ,QWUDRFXODU 3UHVVXUH GLDUUKHD VROXWLRQEHIRUHDGP 3HUIRUPQHXUR DVVHVVPHQW /2& LI 8ULQDU\UHWHQWLRQ XVLQJIRUFHUHEUDO ,23 HGHPD .6SDULQJ'LXUHWLF VSLURQRODFWRQH $OGDFWRQH +\SHUNDOHPLD WRQH F D O R Q 6SLUR J . Q L U D 6S 7+,1. $QWDJRQL]HV +\SHUWHQVLRQ DOGRVWHURQH (GHPD 'LDUUKHD LQSRWDVVLXP +\SRNDOHPLD *DVWULWLV $YRLGVDOWVXEVWLWXWHV 'URZVLQHVV SRWDVVLXPVXSSOHPHQWV ZKLFK UHDEVRUSWLRQ RI1D +\SHUDOGRVWHURQLVP &URVVVH[KRUPRQDO WKHUDS\ *\QHFRPDVWLD ([FUHWLRQRI 1D +2 127. (UHFWLOHG\VIXQFWLRQ 6SLURQRODFWRQH LQKLELWV WHVWRVWHURQH $YRLGHDWLQJIRRGVKLJK 0RQLWRU.OHYHOV (GXFDWH J\QHFRPDVWLDLV XVXDOO\UHYHUVLEOH DIWHUWKHUDS\KDV VWRSSHG 102 &2521$5<9$6&8/$5 ',625'(56 'DPDJHLQWKHKHDUW V PDMRU EORRGYHVVHOV PDMRUEORRGYHVVHOV 5,6.)$&7256 'LDEHWHV +\SHUWHQVLRQ 6PRNLQJ 2EHVLW\ 3K\VLFDOLQDFWLYLW\ +LJKFKROHVWHURO 0HWDEROLF6\QGURPH $JH *HQJHU 5DFH )DPLO\KLVWRU\ 6,*16 6<037206 ,QDGHTXDWHEORRGVXSSO\WR WKHKHDUW 2WRWKHKHDUW 35(9(17,21 75($70(17 0DQDJHPHQWRIK\SHUWHQVLRQ 0DQDJHPHQWRI'LDEHWHV +'/+DSS\&KROHVWHURO /'/%DGFKROHVWHURO 6PRNLQJFHVVDWLRQ 'LHW ([HUFLVH &KHVWSDLQWKDWLV FDXVHGE\ P\RFDUGLDOLVFKHPLD /LSLGORZHULQJPHGLFDWLRQV6WDWLQV +'/JRDO +HDUWKHDOWK\GLHW :HHNO\([HUFLVH*RDOV !PJG/ 3K\VLFDODFWLYLW\ 0RGHUDWHPLQ /'/JRDO PJG/ 6PRNLQJFHVVDWLRQ 9LJRURXVPLQ 6WUHVVPDQDJHPHQW +\SHUWHQVLRQPDQDJHPHQW 'LDEHWHVPDQDJHPHQW &RURQDU\VWHQWDQJLRSODVW\ &RURQDU\$UWHU\%\SDVV*UDIW &$%* 103 $1*,1$ 3(&725,6 &KHVWSDLQWKDWLVFDXVHGE\ P\RFDUGLDOLVFKHPLD 7<3(62)$1*,1$ 3UHGLFWDEOH 3UHLQIDUFWLRQ 2FFXUVZLWK H[HUWLRQ P\RFDUGLDO GHPDQGIRUR[\JHQ 2FFXUV DWUHVW PRUH IUHTXHQWO\ &RURQDU\DUWHU\ YDVRVSDVP 3DLQDWUHVWZLWK UHYHUVLEOH67 HOHYDWLRQ 0$1,)(67$7,216 &KHVWSDLQ KHDY\ VHQVDWLRQ PD\UDGLDWHWR QHFNMDZRUVKRXOGHUV 8QXVXDOIDWLJXH :HDNQHVV 6KRUWQHVVRIEUHDWK 3DOORU 'LDSKRUHVLV ,17(59(17,216 5HSHUIXVLRQ3URFHGXUHV 3&, &$%* 3HUFXWDQHRXV &RURQDU\ ,QWHUYHQWLRQV &RURQDU\DUWHU\ E\SDVVJUDIW '58*7+(5$3< 1LWUDWHV 9DVRGLODWRUV LVFKHPLD SDLQ 8VXDOO\DGPLQLVWHUHGVXEOLQJXDOO\ &DOFLXP&KDQQHO%ORFNHUV 5HOD[HVEORRGYHVVHOV R[\JHQVXSSO\WRWKHKHDUW ZRUNORDGRIKHDUW %HWD%ORFNHUV P\RFDUGLDOR[\JHQ FRQVXPSWLRQ $QWLSODWHOHW$QWLFRDJXODQW 3UHYHQWVSODWHOHW DJJUHJDWLRQ WKURPERVLV 104 0<2&$5',$/ ,1)$5&7,21 3DUWRIWKHP\RFDUGLXPLV SHUPDQHQWO\GHVWUR\HG,QIDUFWLRQ PHDQVGHDWK %ORRGIORZLQDFRURQDU\ 6XGGHQFKHVWSDLQWKDW DUWHU\ SURORQJHG FRQWLQXHVGHVSLWHUHVW R[\JHQ LQIDUFWLRQ GHDWK PHGLFDWLRQV :RPHQSUHVHQWZLWKGLIIHUHQW V\PSWRPVWKDQPHQ )DWLJXH 6KRXOGHUEODGHGLVFRPIRUW 6KRUWQHVVRIEUHDWK 67(0, 1RQ67(0, (&*HYLGHQFHRIDFXWH0,RQ (OHYDWHGFDUGLDFELRPDUNHUV FRQWLJXRXVOHDGV 1RGHILQLWH(&*FKDQJHV :RUVWW\SHRI0,EHFDXVHWKH PRVWGDPDJHRFFXUV 67( OHYD WLRQ 105 & $ 5 ' , $ & % , 2 0 $ 5 . ( 5 6 752321,1 WURSRQLQ,QJP/ ! &5 QJP ,7, &$ / / ,1&5($6( 3($. )HZKRXUV &DQUHPDLQHOHYDWHGIRUDV ORQJDVZHHNV &.0% ,1&5($6( )HZKRXUV 0<2*/2%,1 ,1&5($6( +RXUV QJP/ 3($. +RXUV QJP/ 3($. +RXUV 106 MED-SURG ENDOCRINE SYSTEM Nurse in the making 107 (1'2&5,1(6<67(0 )81&7,216 0DLQWHQDQFH UHJXODWLRQ (QHUJ\PHWDEROLVP 5HVSRQVHWR VWUHVV LQMXU\ 5HSURGXFWLRQ *URZWK GHYHORSPHQW )OXLGHOHFWURO\WH DFLGEDVHEDODQFH (QGRFULQH*ODQGV +<327+$/$086 3$1&5($6 3,78,7$5< $'5(1$/ 7+<52,' 29$5,(6 3$5$7+<52,' 7(67(6 108 ',$%(7(6 7<3( 7\SH'LDEHWHV 1RLQVXOLQSURGXFWLRQ 7\SH'LDEHWHV 3DWKRORJ\ 8VXDOO\GLDJQRVHGLQFKLOGKRRG &DXVHGE\DQDXWRLPPXQHUHVSRQVH 7KHFHOOVDUHVWDUYHGRIJOXFRVHVLQFHWKHUHLVQR LQVXOLQWREULQJLWLQWRWKHFHOOV 7KHFHOOVEUHDNGRZQSURWHLQDQGIDWLQWRHQHUJ\ DFLGRVLV FDXVLQJNHWRQHVWREXLOGXS DFLGRVLV 'RHVQRWSURGXFHHQRXJKLQVXOLQRU SURGXFHVEDGLQVXOLQWKDWGRHVQRW ZRUNSURSHUO\ 2QVHWXVXDOO\DVDQDGXOW 6LJQV 6\PSWRPV 3 V 3RO\XULD ([FHVVLYHSHHLQJ 3RO\GLSVLD([FHVVLYHWKLUVW 3RO\SKDJLD([FHVVLYHKXQJHU 2QVHW$%5837 7UHDWPHQW ,QVXOLQRQO\b ,QVXOLQRQO\RUDOK\SRJO\FHPLF DJHQWVZLOOQRWZRUNIRUWKLVSW &RPSOLFDWLRQV 'LDEHWLF.HWRDFLGRVLV '.$ 2QVHW$%5837 3DWKR 6LJQV 6\PSWRPV 1RWHQRXJKLQVXOLQ %ORRGVXJDUEHFRPHV 9(5<KLJK &HOOVEUHDNGRZQSURWHLQ IDWLQWRHQHUJ\ .HWRQHVEXLOGXS $FLGRVLV .HWRVLV DFLGRVLV +\SHUJO\FHPLD 'HK\GUDWLRQ .XVVPDXOUHVSLUDWLRQ WU\LQJ WREORZRII&2 $FLGEUHDWKIUXLW\EUHDWK 7UHDWPHQW ,9,168/,1 )OXLGUHSODFHPHQW &RUUHFWLRQRIHOHFWURO\WHLPEDODQFHV 2QVHW*5$'8$/ 'LHW H[HUFLVH 2UDOK\SRJO\FHPLDDJHQWV ([DPSOH0HWIRUPLQ 3RVVLEO\,QVXOLQ +\SHURVPRODUK\SHUJO\FHPLFVWDWH ++6 2QVHW*5$'8$/ 3DWKR 6LJQV 6\PSWRPV 12DFLGRVLVSUHVHQW 6LPSO\KLJKDPRXQWV RIJOXFRVHLQWKHEORRG +\SHUJO\FHPLD 7UHDWPHQW )OXLGUHSODFHPHQW &RUUHFWLRQRIHOHFWURO\WHLPEDODQFHV 3RVVLEOH,QVXOLQDGPLQLVWUDWLRQ 109 ',$%(7(61856,1*&$5( +\SRJO\FHPLD +\SHUJO\FHPLD æ Ê Ø ñ Òæ[ 9 Êæ Ê æ Ê æ9 ß î9 Ê æ[ ò æÊ Òæ[ ææî Ù 3RO\XULD &RRO FODPP\VNLQ 3RO\GLSVLD 'LDSKRUHVLV 3RO\SKDJLD 3DOSLWDWLRQV +RW GU\VNLQ )DWLJXH ZHDNQHVV 'U\PRXWK GHK\GUDWLRQ &RQIXVLRQ )UXLW\EUHDWK +HDGDFKH 'HHSUDSLGEUHDWKV DLUKXQJHU 6KDNLQHVV 1XPEQHVV WLQJOLQJ ,QDELOLW\WRDURXVHIURPVOHHS 6ORZZRXQGKHDOLQJ 9LVLRQFKDQJHV ;; $GPLQLVWHU,QVXOLQDVQHHGHG 5HVWULFWH[HUFLVHZKHQEORRG JOXFRVHLV!PJG/ *LYHDQRWKHU JUDPVRI 5HFKHFNEORRG JOXFRVHLQPLQ FDUERK\GUDWHVLI QHHGHG 2UDOLQWDNHRI JUDPV RIFDUERK\GUDWHV 7HVWXULQHIRUNHWRQHV 8QFRQVFLRXVSDWLHQWV 'LDEHWLF'LHW Êî Ê Ê ß ß î ßÊ Ê Ê î $GPLQLVWHUJOXFDJRQ VXEFXWRU,0 &RPSOH[FDUERK\GUDWHV 6DWXUDWHGIDWV )LEHUULFKIRRGV 7UDQVIDWV +HDUWKHDOWK\ILVK &KROHVWHURO *RRGIDWV 6RGLXP 6XJDUIUHHIOXLGV 5HSHDWLQ PLQLIVWLOO XQFRQVFLRXV 3ODFHFOLHQWLQD 1RWLI\KHDOWK ODWHUDOSRVLWLRQ FDUHSURYLGHU $FXWH&DUH6HWWLQJ $GPLQLVWHUGH[WURVHLI,9 DFFHVVLVDYDLODEOH 110 ,168/,17<3(6 5$3,' 6+257 ,17(5 0(',$7( /21* +80$/2* /,6352 $63$57 1292LOG */8/,6,1( $3,'5$ 5(*8/$5 216(7 PLQ 3($. PLQKUV '85$7,21 KUV 216(7 PLQ 3($. KUV '85$7,21 KUV 13+ 13++808/,11 12VOLIN13+ 216(7 KUV 3($. KUV '85$7,21 KUV */$5*,1( /$1786 '(7(0,5 /(9(0,5 216(7 KRXUV 3($. 1RQH '85$7,21 KUV $GPLQLVWUDWLRQ 0XVWEHJLYHQ6XE&XWRU,9 5HPRYHDOODLUEXEEOHV 5RWDWHVLWHLQFKIURPSUHYLRXVVLWH &RPPRQVLWHVEDFNRIDUPVWKLJKV DEGRPHQ DWOHDVWLQFKDZD\IURP WKHEHOO\EXWWRQ &RPSOLFDWLRQV +\SRJO\FHPLD :HLJKWJDLQ ,QVXOLQLVDJURZWKKRUPRQH /LSRDWURSK\ ORVVRIVXEFXWIDW 111 7+<52,'',625'(56 6,*16 6<037206 +LQW7K\URLGKRUPRQHJLYH\RX(1(5*< +<3(57+<52,',60 +<327+<52,',60 7RRPXFK(1(5*< 1RWHQRXJK(1(5*< 1HUYRXV 1RHQHUJ\ ,UULWDEOH )DWLJXH $WWHQWLRQVSDQ 1RH[SUHVVLRQV ,QFUHDVHGDSSHWLWH :HLJKWJDLQ :HLJKWORVV &ROG +RW $PHQRUUKHD ([RSKWKDOPRV ([RSKWKDOPRV (QODUJHGWK\URLG ,QFUHDVHG %ORRGSUHVVXUH 3XOVH $QWL7K\URLG0HGLFDWLRQV 75($70(17 0HWKLPD]ROHRU378 ,RGLQH&RPSRXQGV 5DGLRDFWLYH,RGLQH7KHUDS\ 7K\URLGHFWRP\ 6OXUUHG 7K\URLG0HGLFDWLRQV /HYRWK\UR[LQH 3WZLOOEHRQ WKLVIRUHYHU 7+<52,'67250 $FXWHOLIHWKUHDWHQLQJHPHUJHQF\ZLWK XQFRQWUROODEOHK\SHUWK\URLGLVP 6LJQV 6\PSWRPV 7HPS 7DFK\FDUGLD +\SHUWHQVLRQ 1DXVHDYRPLWLQJ GLDUUKHD $JLWDWLRQDQ[LHW\ 'HOLULXPVHL]XUHV RUFRPD ,QWHUYHQWLRQV 3DWHQWDLUZD\ 1RQ6DOLF\ODWH DQWLS\UHWLFV $QWLWK\URLG PHGLFDWLRQV &RROLQJEODQNHW 112 3$5$7+<52,' */$1'',625'(56 +<3(53$5$7+<52,',60 3URGXFHVWKHKRUPRQHSDUDWK\URLG KRUPRQH 37+ ZKLFKFRQWUROVWKH OHYHOVRIFDOFLXPLQWKHEORRG +<323$5$7+<52,',60 &DQRFFXUDIWHUDWK\URLGHFWRP\GXHWR DFFLGHQWDOUHPRYDORIWKHSDUDWK\URLG 6,*16 6<037206 &DOFLXP 3KRVSKRUXV 3KRVSKRUXV )DWLJXH PXVFOHZHDNQHVV 1XPEQHVV WLQJOLQJ 6NHOHWDOSDLQ 0XVFOHFUDPSV 3DWKRORJLFDOIUDFWXUHVIURPERQH 7HWDQ\ GHIRUPLWLHV +\SRWHQVLRQ .LGQH\VWRQHV FDOFLXP :HLJKWORVVDQRUH[LD &RQVWLSDWLRQ +\SHUWHQVLRQ &DUGLDFG\VUK\WKPLDV 3DUDWK\URLGHFWRP\ 5HPRYDORIPRUHWKDQRQH 75($70(17 &DOFLXP JODQG $Q[LHW\LUULWDELOLW\ GHSUHVVLRQ 3RVLWLYH7URXVVHDXŶV&DUSDOVSDVP FDXVHGE\LQIODWLQJDEORRGSUHVVXUH FXII &KYRVWHNŶVVLJQV&RQWUDFWLRQRIIDFLDO PXVFOHVZOLJKWWDSRYHUWKHIDFLDO QHUYH ,9&DOFLXP 3KRVSKRUXVELQGLQJGUXJV ',(7 &DOFLXP 3KRVSKRUXV $GPLQLVWHU 3KRVSKDWHV&DOFLWRQLQ ,9RU RUDOELVSKRVSKRQDWHV ',(7 ILEHU PRGHUDWHFDOFLXP 113 6,*16 6<037206 $'5(1$/&257(; ',625'(56 &86+,1*6 $'',6216 'LVRUGHURIWKHDGUHQDOFRUWH[ 7RRPDQ\VWHURLGV 'LVRUGHURIWKHDGUHQDOFRUWH[ 1RWHQRXJKVWHURLGV 0XVFOHZDVWLQJ )DWLJXH 0RRQIDFH 1DXVHDYRPLWLQJGLDUUKHD %XIIDORKXPS $QRUH[LD 7UXQFDOREHVLW\ZWKLQH[WUHPLWLHV +\SRWHQVLRQ 6XSUDFODYLFXODUIDWSDGV &RQIXVLRQ :HLJKWJDLQ 1$ + . +LUVXWLVP PDVFXOLQH +\SHUSLJPHQWDWLRQRIWKHVNLQ FKDUDFWHULVWLFV 9LWLOLJRZKLWHDUHDVRI *OXFRVH 1$ . &$ +\SHUWHQVLRQ $GUHQDOHFWRP\ 75($70(17 2QHRQWKHWRSRIHDFKNLGQH\ $GUHQDOFRUWH[KRUPRQHV *OXFRFRUWLFRLGV 5HWDLQV1$ + 0LQHUDORFRUWLFRLGV /RVHV. 6H[KRUPRQHV 5HTXLUHVOLIHORQJ GHSLJPHQWDWLRQ $GGLVRQLDQ&ULVLV 6LJQV 6\PSWRPV 3URIRXQGIDWLJXH 'HK\GUDWLRQVKRFN 5HQDOIDLOXUH 9DVFXODUFROODSVH +\SRQDWUHPLD +\SHUNDOHPLD JOXFRFRUWLFRLGUHSODFHPHQW $YRLGLQIHFWLRQ $GPJOXFRFRUWLFRLGDQGRU $GPFKHPRWKHUDSHXWLFDJHQWVLI PLQHUDORFRUWLFRLG DGUHQDOWXPRULVSUHVHQW 'LHWKLJKLQSURWHLQ FDUEV 114 $'5(1$/0('8//$ ',625'(5 2QHRQWKHWRSRIHDFKNLGQH\ $GUHQDOPHGXOODKRUPRQHV (SLQHSKULQH )LJKWRUIOLJKW 1RUHSLQHSKULQH UHVSRQVH 6,*16 6<037206 3+(2&+5202&<720$ %ORRGSUHVVXUH +HDUWUDWH 3DOSLWDWLRQV 7UHPRUV )OXVKLQJGLDSKRUHWLF +HDGDFKH 3DLQLQWKHFKHVWRUDEGRPHQ +\SHUJO\FHPLD 75($70(17 $GUHQDOHFWRP\ LIDWXPRULVSUHVHQW 7HOOWKHSWQRWWRVPRNHGULQNFDIIHLQHRU FKDQJHSRVLWLRQVXGGHQO\ $GPDQWLK\SHUWHQVLYHV 3URPRWHUHVW FDOPHQYLURQPHQW 'LHWKLJKLQFDORULHVYLWDPLQV PLQHUDOV 115 1 '' 33 ,, 77 88 ,, 77 $$ 55 << ** // $$ 1 '' ,, 66 22 55 '' (( 55 66 6,*16 6<037206 6,$'+ $QWLGLXUHWLF+RUPRQH $'+ UHJXODWHV EDODQFHVWKHDPRXQW RIZDWHULQ\RXUEORRG ',$%(7(6,16,3,'86 /RZXULQDU\RXWSXWRIFRQFHQWUDWHG ([FUHWHVODUJHDPRXQWVRIGLOXWHGXULQH XULQH 3RO\GLSVLD )OXLGYROXPHRYHUORDG 'HK\GUDWLRQ :HLJKWJDLQZLWKRXWHGHPD 'HFUHDVHGVNLQWXUJRU +\SHUWHQVLRQ 'U\PXFRXVPHPEUDQHV 7DFK\FDUGLD 0XVFOHSDLQ ZHDNQHVV 1DXVHD YRPLWLQJ +HDGDFKH +\SRQDWUHPLD 3RVWXUDOK\SRWHQVLRQ 7DFK\FDUGLD 75($70(17 /RZXULQDU\VSHFLILFJUDYLW\ ,PSOHPHQWVHL]XUHSUHFDXWLRQV $GHTXDWHIOXLGV (OHYDWH+2%WRSURPRWHYHQRXVUHWXUQ ,9K\SRWRQLFVDOLQH 5HVWULFWIOXLGLQWDNH 9DVRSUHVVLQRUGHVPRSUHVVLQDFHWDWH $GPORRSGLXUHWLFV 0RQLWRU $GPYDVRSUHVVLQDQWDJRQLVWV ,QWDNH RXWSXW :HLJKW 116 MED-SURG RESPIRATORY DISORDERS Nurse in the making 117 &KURQLF2EVWUXFWLYH3XOPRQDU\'LVHDVH &23' 5,6.)$&7256 3$7+2/2*< &KURQLFDLUIORZOLPLWDWLRQ 8PEUHOODWHUP (PSK\VHPDRU&KURQLF%URQFKLWLV 6PRNLQJ 2FFXSDWLRQH[SRVXUH ,QIHFWLRQ $LUSROOXWLRQ *HQHWLFDEQRUPDOLWLHV 'HILFLHQF\RIDOSKDDQWLWU\SVLQ 3URWHFWVWKHOLQLQJRIWKHOXQJV 6,*16 6<037206 7KLQ 4XLHWFKHVW 6HYHUHG\VSQHD +\SHULQIODWLRQRIWKHOXQJV EDUUHOFKHVW 'LVWHQVLRQ GHVWUXFWLRQRIDLUVSDFHV ZDOOVRIWKHDOYHROL 2YHUZHLJKW &\DQRWLF EOXH 3HULSKHUDOHGHPD 5KRQFKL ZKHH]LQJ &KURQLFFRXJK 'LVWHQVLRQ GHVWUXFWLRQRIDLUVSDFHV ZDOOVRIWKHDOYHROL ',$*1267,& $UWHULDOEORRGJDVHV $%*V &KHVW;UD\ 3XOPRQDU\)XQFWLRQ7HVW6SLURPHWU\ 2EVWUXFWLYHOXQJGLVHDVH )(9)9&UDWLRRIOHVVWKDQ )(9 )9& )RUFHGH[SLUDWRU\ )RUFHGYLWDO FDSDFLW\ YROXPH 118 &KURQLF2EVWUXFWLYH3XOPRQDU\'LVHDVH &23' 0$1$*E0(17 /LIHVW\OH0RGLILFDWLRQV 6PRNLQJFHVVDWLRQ 'LHW0RGLILFDWLRQV 'HWHUPLQHUHDGLQHVV 'HYHORSDSODQ 'LVFXVVQLFRWLQHUHSODFHPHQW 3URPRWHQXWULWLRQ ,QFUHDVHFDORULHV 6PDOOIUHTXHQWPHDOV 3W VZLWK&23'DUHXVLQJ$//WKHLUHQHUJ\WR EUHDWKHEXUQLQJDORWRIFDORULHV 3KDUPDFRORJLF7KHUDS\ VPDOOPHDOV %URQFKRGLODWRUV SHUGD\ &RUWLFRVWHURLGV 1LFRWLQHUHSODFHPHQW %XSURSLRQ DQWLGHSUHVVDQW 9DFFLQDWLRQV 2[\JHQ7KHUDS\ ,QIOXHQ]D SQHXPRFRFFDOYDFFLQH WKHLQFLGHQFHRISQHXPRQLD $GPGXULQJH[DFHUEDWLRQV $GPZKHQ2VDWXUDWLRQLVRU VKRZLQJVLJQVRIUHVSLUDWRU\GLVWUHVV 6XUJHU\ $GPR[\JHQZLWK FDXWLRQWRSWVZLWK FKURQLFK\SHUFDSQLD HOHYDWHG3D&2OHYHOV %XOOHFWRP\ /956/XQJ9ROXPH5HGXFWLRQ6XUJHU\ /XQJWUDQVSODQW 119 $67+0$ ,QIODPHGQDUURZ VZROOHQDLUZD\ &/$66,),&$7,216 6,*16 6<037206 '\VSQHD VKRUWQHVVRIEUHDWK 0,/' ,17(50,77(17 0,/' 3(56,67(17 DZHHN !DZHHN 1RW'DLO\ 02'(5$7( 3(56,67(17 6(9(5( 3(56,67(17 'DLO\ H[DFHUEDWLRQV ;DZHHN &RQWLQXDOO\ IUHTXHQW H[DFHUEDWLRQV &KHVWWLJKWQHVV $Q[LHW\ :KHH]LQJ 0XFXVSURGXFWLRQ 8VHRIDFFHVVRU\PXVFOHV ',$*1267,& 3XOPRDU\IXQFWLRQWHVW 3)7V )9& )(9 &KHVW;UD\ 1856,1*&$5( $VVHVVSW VDLUZD\ 67$786$67+0$7,&86 67$786 $67+0$7,&86 +LJK)RZOHU VSRVLWLRQ /LIHWKUHDWHQLQJDVWKPDHSLVRGH 0HGLFDOHPHUJHQF\ 2[\JHQ +\GUDWLRQ 1HEXOL]DWLRQ 6\VWHPLFFRUWLFRVWHURLG 3URYLGHIUHTXHQWUHVWSHULRGV $GPR[\JHQWKHUDS\ 0DLQWDLQDFDOPHQYLURQPHQWWR VWUHVV 0(',&$7,216 %$JRQLVWV 5$3,'5(/,() 6KRUWDFWLQJ $OEXWHURO 35(9(17$67+0$ $77$&.6 /RQJDFWLQJ 6DOPHWHURO &RUWLFRVWHURLGV $QWLFKROLQHUJLFV 3XOPRQDU\VHFUHWLRQV EURQFKRGLODWLRQ 0HWK\O[DQWKLQHV 7KHRSK\OOLQH 120 31(8021,$ 3$7+2/2*< 5,6.)$&7256 ,QIODPPDWLRQRIWKHOXQJV 3RVWRSHUDWLYH 0XFXVSURGXFWLRQ OXQJLQIHFWLRQ $VSLUDWLRQ FDXVHVDLUZD\REVWUXFWLRQ 6<037206 &KLOOV 7HPSHUDWXUH ,PPRELOLW\ ',$*1267,& &KHVW;UD\ 6KRZVSXOPRQDU\LQILOWUDWHV RUSOHXUDOHIIXVLRQV &KHVWSDLQ :KLWHEORRGFHOOV 'LIILFXOW\EUHDWKLQJ (U\WKURF\WHVHGLPHQWDWLRQUDWH 3URGXFWLYHFRXJK 5KRQFKL ZKHH]HV 'LHW 6SXWXPFXOWXUH &DQEHEDFWHULDO YLUDORUIXQJDO ,17(59(17,216 &DORULH 3URWHLQ )OXLGV 7KLQVVHFUHWLRQV 6PDOOIUHTXHQWPHDOV 0HGLFDWLRQV $QWLELRWLFV RQO\IRUEDFWHULD %URQFKRGLODWRUV &RXJKVXSSUHVVDQWV 0XFRO\WLFDJHQWV +HOSVOXQJ 6HPL)RZOHU VSRVLWLRQ H[SDQVLRQV 5HVSLUDWRU\VWDWXV 3XOVHR[LPHWU\ &RORUFRQVLVWHQF\ DPRXQWRIVSXWXP 121 MED-SURG HEMATOLOGY DISORDERS Nurse in the making 122 ,,521'(),&,(1&<$1(0,$ 521 '(),&,(1&< $1(0,$ &$86(6 3$7+2/2*< %ORRGORVVKHPRUUKDJH ,URQLVHVVHQWLDOWR KHPRJORELQLQUHGEORRG FHOOV+HPRJORELQFDUULHV R[\JHQWRWKHFHOOV 6<037206 3DOORU :HDNQHVV IDWLJXH 0LFURF\WLF VPDOO UHG EORRGFHOOV KHPRJORELQ KHPRJORELQ KHPDWRFULW KHPDWRFULW 0DODEVRUSWLRQ ,QDGHTXDWHGLHWDU\LQWDNHRILURQ ,5215,&+)22'6 ( JJ\RONV $ SULFRWV 7 RIX 32WDWRHV ) LVK / HJXPHV 2 \VWHUV 7 XQD 6 HHGV , URQIRUWLILHGFHUHDOV 5 HGPHDWV 32 XOWU\ 1XWV ,URQ $GPLQLVWHULURQ 2UDO,0RU,9 %ODFNVWRRO &RQVWLSDWLRQ *LYHEHWZHHQPHDOV &DOFLXP 9LWDPLQ& 0LON DQWDFLGV )UXLWMXLFH PXOWLYLWDPLQ /LTXLGLURQVWDLQVWKHWHHWK 7DNHZLWKDVWUDZ %UXVKWHHWKDIWHU )RXODIWHUWDVWH 123 77+520%2&<723(1,$ +520%2&<723(1,$ 3$7+2/2*< 3ODWHOHWVKHOSFORWWKHEORRG 7KH\KHOSWKHEORRGFOXPS )RUPLQJDSOXJDWWKHVLWHRIWKHLQMXU\ SODWHOHWV 7+,1.%/((',1* 6<037206 3URORQJHGEOHHGLQJWLPHIURPFXWV 3HWHFKLDH SLQSRLQWEOHHGLQJ 3XUSXUD EUXLVLQJ %OHHGLQJIURPWKHJXPV QRVH +HDY\PHQVWUXDOF\FOHV %ORRGLQVWRROXULQH ,15 37377 &$86(6 3ODWHOHWGLVRUGHUV / HXNHPLD $ QHPLD 7 UDXPD ( QODUJHGVSOHHQ / LYHUGLVHDVH ( WKDQRO DOFRKROLQGXFHG 7 R[LQV GUXJLQGXFHG 6HSVLV ,17(59(17,216 3ODWHOHWWUDQVIXVLRQ %RQHPDUURZWUDQVSODQW %/((',1*35(CAU7,216 8VHHOHFWULFUD]RUV 12$VSLULQ 8VHVPDOOQHHGOHJDXJHV 'HFUHDVHQHHGOHVWLFNV 3URWHFWIURPLQMXU\ 124 MED-SURG GASTROINTESTINAL DISORDERS Nurse in the making 125 $&87(3$1&5($7,7,6 3$7+2/2*< 5,6.)$&7256 7KHLVOHWVRI/DQJHUKDQGV VH VHFUHWH,QVXOLQ *OXFDJRQ *DOOVWRQHV $OFRKROXVH +\SHUOLSLGHPLD +\SHUSDUDWK\URLGLVP +\SHUFDOFHPLD &LJDUHWWHVPRNLQJ 7UDXPD 9LUDOLQIHFWLRQV 3HQHWUDWLQJXOFHUV .LGQH\IDLOXUH 'UXJVWR[LFLW\ 3DQFUHDWLFWLVVXHVHFUHWHGLJHVWLYH HQ]\PHVWKDWEUHDNGRZQ FDUERK\GUDWHVSURWHLQV IDWV 3DQFUHDWLWLVLVDQ$872',*(67,21RIWKH SDQFUHDVE\LWVGLJHVWLYHHQ]\PHVUHOHDVHG WRRHDUO\LQWKHSDQFUHDV 6,*16 6<037206 1DXVHD YRPLWLQJ /$%6 $P\ODVH %LOHVWDLQHG )HYHU /LSDVH -DXQGLFH :%& V 0HQWDOFRQIXVLRQ DJLWDWLRQ %UXLVLQJLQWKHIODQN %LOLUXELQ %UXLVLQJDURXQGWKHXPELOLFXV *OXFRVH *UH\7XUQHU V6LJQ &XOOHQ V6LJQ $EGRPLQDOJXDUGLQJ 3ODWHOHWV 5LJLGERDUGOLNHDEGRPHQ &D 0J ,17(59(17,216 5HVWWKHSDQFUHDV 3DLQPDQDJHPHQW ,9IOXLGV 0RQLWRU *OXFRVH %ORRGSUHVVXUH ,QWDNH RXWSXW /DERUDWRU\YDOXHV 0(',&$7,216 132 5LVNIRU K\SRYROHPLFVKRFN %87SUHYHQWIOXLG YROXPHRYHUORDG 2SLRLGDQDOJHVLFV $QWLELRWLFV 3URWRQ3XPS,QKLELWRUV 33, V 3DQFUHDWLFHQ]\PHV +\SRYROHPLD &RPS OL 3DQFUHDWLFLQIHFWLRQ FDWLR QV 7\SH'LDEHWHV0HOOLWXV 126 ,1)/$00$725<%2:(/',6($6( &52+1Ŷ6',6($6( 8/&(5$7,9(&2/,7,6 6,*16 6<037206 6,*16 6<037206 $QRUH[LD ZHLJKWORVV $QHPLD 0DOQXWULWLRQ $QRUH[LD ZHLJKWORVV $QHPLD )HYHU &UDPSLQJDIWHUPHDOV 0DODLVH $EGRPLQDOFUDPSLQJ 0XFXVOLNHGLDUUKHD VHPLVROLG $EGRPLQDOGLVWHQWLRQ 1DXVHD YRPLWLQJ %ORRG\GLDUUKHD 'HK\GUDWLRQ 9LWDPLQ.GHILFLHQF\ ,17(59(17,216 $GPIOXLGV HOHFWURO\WHVRU 132 SDUHQWHUDOQXWULWLRQ 'LHW &OHDUOLTXLGVWR ILEHU 3URWHLQ 9LWDPLQV LURQVXSSOHPHQWV $YRLGJDVIRUPLQJIRRGV $YRLGVPRNLQJ 0HGLFDWLRQV %RZHOVRXQGV O G %RZHOSHUIRUDWLRQ 3HULWRQLWLV +HPRUUKDJH 6WRRO &RORU &RQVLVWHQF\ 3UHVHQFHRIEORRG 'DLU\ :KROHZKHDWJUDLQV 1XWV )UXLWV YHJHWDEOHV $OFRKRO &DIIHLQH &RUWLFRVWHURLGV ,PPXQRVXSSUHVVDQWV $QWLGLDUUKHDOV 6DOLF\ODWHFRPSRXQGV 127 7<3(62)+(3$7,7,6 +LQWVWRUHPHPEHU WKHYLUDOW\SHVRI KHSDWLWLV $%&'( 6HURORJLFDO 7UDQVPLVVLRQ $ + % 9 +9 & + ' 9 + ( 9 +9 )HFDO2UDO )RRG ZDWHU 0DUNHUV DQWL+$9LQIHFWLRXV ,J*,PPXQH %WKLQN%RG\ )OXLGV &KLOGELUWK VH[ $QWL+%F,QIHFWLRXV $QWL+%V,PPXQHUHFRYHU\ 6DPHDV+%9 ,9GUXJXVHUV 'HSHQGVRQ% +HS'RFFXUV ZLWK+HS% :DWHUERUQH )RRG ZDWHU $QWL+&9 +'$J $QWL+'9 $QWL+(9 1XUVLQJ&DUH 6LJQV 6\PSWRPV -DXQGLFH 'DUNFRORUHGXULQH &OD\FRORUHGVWRRO 9RPLWLQJ )OXOLNHV\PSWRPV 9DFFLQH 5HVW )HYHU )DWLJXH $SSHWLWH $EGRPLQDOSDLQ 'LHW 6PDOOIUHTXHQWPHDOV &DUERK\GUDWHV &DORULHV 3URWHLQ IDW 3URSHUKDQGK\JLHQH $YRLGVH[XQWLOKHSDWLWLV DQWLERGLHVDUHQHJDWLYH 128 MED-SURG NEUROLOGICAL DISORDERS Nurse in the making 129 */$6*2:&20$6&$/( 6SRQWDQHRXV 7RVSHHFK 7R VSHHFK 7RSDLQ 7R SDLQ 1RUHVSRQVH 1R UHVSRQVH 2ULHQWHG 2ULHQWHG &RQIXVHG ,QDSSURSULDWHZRUGV ,QDSSURSULDWH ZRUGV 8QFOHDUVRXQGV 8QFOHDU VRXQGV 1RQH 2EH\ VFRPPDQG V FRPPDQG /RFDOL]HVSDLQ /RFDOL]HV SDLQ :LWKGUDZV )OH[LRQ ([WHQVLRQ 1RQH 6HYHUHLPSDLUPHQWRIQHXURORJLFIXQFWLRQFRPDRUEUDLQGHDWK 6HYHUH LPSDLUPHQW RI QHXURORJLF IXQFWLRQ FRPD RU EUDLQ GHDWK 8QFRQVFLRXVSDWLHQW 8QFRQVFLRXV SDWLHQWW )XOO\DOHUW )XOO\ DOHUW RULHQWHG RULHQWHG 130 6(,=85(6 (SLOHSV\FKURQLFVHL]XUHDFWLYLW\ 6WDWXV(SLOHSWLFXVDVHL]XUHWKDWODVWV!PLQXWHV *(1(5$/,=('6(,=85(6 3$57,$/6(,=85(6 721,&&/21,& 0<2&/21,& 6,03/(3$57,$/ 0D\EHJLQZLWKDQDXUD 6WLIIHQLQJ WRQLF DQGRU ULJLGLW\ FORQLF RIWKH PXVFOHV 6XGGHQMHUNLQJRU VWLIIHQLQJRIWKH H[WUHPLWLHV DUPV RUOHJV 6HQVRU\V\PSWRPVZLWK PRWRUV\PSWRPVDQG VWD\VDZDUH7KH\PD\ UHSRUWDQDXUD $%6(1&( $721,& &203/(;3$57,$/ 8VXDOO\ORRNVOLNH DEODQNVWDUHWKDW ODVWVVHFRQGV 6XGGHQORVVRI PXVFOHWRQH0D\ OHDGWRVXGGHQIDOOV RUGURSSLQJWKLQJV $OWHUHGEHKDYLRUDZDUHQHVV DQGORVHVFRQVFLRXVQHVVIRUD IHZVHFRQGV 0DLQWDLQDSDWHQWDLUZD\ 1RWHWKHWLPH GXUDWLRQRIWKHVHL]XUH 7XUQSDWLHQWRQWKHVLGH 3ODFHSDWLHQWOD\LQJGRZQ SURWHFWWKH KHDG $GPLQLVWHUR[\JHQ 3UHSDUHWRVXFWLRQVHFUHWLRQV /RRVHQUHVWULFWLYHFORWKLQJ 5HVWUDLQWKHSDWLHQW )RUFHWKHMDZRSHQ 3ODFHDQ\WKLQJLQWKHLU PRXWKV /HDYHWKHSDWLHQW 131 6752.( +(0255+$*,&6752.( ,6&+(0,&6752.( 7KURPERWLFRUHPEROLF 7KURPERVLV EORRGFORW (PEROLVP EORFNLQJRIDQ DUWHU\ %ORRGIORZLVFXWRII ZKLFKOHDGVWR,VFKHPLD 7UDQVLHQW,VFKHPLF $WWDFNV7,$ V 5XSWXUHGDUWHU\RUDQHXU\VP 7KHFROOHFWLRQRIEORRGLQWKH 0LQLVWURNHV 7KHVDPHSDWKRORJ\DVD VWURNHEXWQRFHUHEUDO LQIDUFWLRQRFFXUV EUDLQOHDGVWRLVFKHPLD LQFUHDVHG,&3 75($70(17 7LVVXHSODVPLQRJHQDFWLYDWRU DOWHSODVH W3$ EUHDNVGRZQWKHEORRGFORW *LYHQKRXUV DIWHULQLWLDOV\PSWRPV 'RQRWJLYHLIDFWLYH EOHHGLQJLVVXVSHFWHG 5,6.)$&7256 +\SHUWHQVLRQ $WKHURVFOHURVLV $QWLFRDJXODWLRQ WKHUDS\ 'LDEHWHV0HOOLWXV 2EHVLW\ 6WUHVV 2UDOFRQWUDFHSWLYHV )DPLO\KLVWRU\ RIVWURNHV 2OGHUDJH 0DOHJHQGHU %ODFNV +LVSDQLFV 3RRUSURJQRVLV 1HHGVFDUHIXOPRQLWRULQJLQDQ LQWHQVLYHFDUHXQLW %ORRGPD\QHHGWREHUHPRYHGWR SUHVVXUHRQWKHEUDLQ 6,*16 6<037206 ) DFHGURRSLQJ $ UPZHDNQHVV 6SHHFKGLIILFXOW\ 7 LPHWRFDOO 132 6752.( 1856,1*0$1$*(0(17 $VVLVWZLWKVDIHIHHGLQJ 'RQRWIHHGXQWLOJDJUHIOH[KDV FRPHEDFN FKDQFHVRIDVSLUDWLRQ /,48,' )22' 7KLQ 1HFWDUOLNH +RQH\OLNH 6SRRQWKLFN 3XUHHG 0HFKDQLFDOO\DOWHUHG 0HFKDQLFDOO\VRIW 5HJXODU 3RVLWLRQLQJRIWKHFOLHQW (OHYDWHKHDGRIWKHEHGWR ,&3 3ODFHDSLOORZXQGHUWKHDIIHFWHG DUPLQDQHXWUDOSRVLWLRQ $VVLVWZLWKFRPPXQLFDWLRQVNLOOV 5HPHPEHU ,IWKHVWURNHRFFXUVRQ WKHOHIWVLGHRIWKHEUDLQ WKHULJKWVLGHRIWKHERG\ ZLOOEHDIIHFWHG (QFRXUDJHSDVVLYHUDQJHRIPRWLRQ HYHU\KRXUV 3UHYHQWDWLYH'97PHDVXUHV $VVLVWZLWK$FWLYLWLHVRI'DLO\/LYLQJ $'/ V &RPSUHVVLRQVWRFNLQJV )UHTXHQWSRVLWLRQFKDQJH 0RELOL]DWLRQ )UHTXHQWUHVWSHULRGV 'UHVVWKHDIIHFWHGVLGHILUVW 6XSSRUWDIIHFWHGVLGH 133 MED-SURG BURNS Nurse in the making 134 BURNS BURNS INJURY DEPTH WHAT IS A BURN? Damage to skin integrity 1st Degree TYPES OF BURNS THERMAL SUPERFICIAL • Epidermis • Pink & painful (still has nerves) • No scarring • Blanching: present • Heals: few days most common Superficial heat Examples: liquid, steam, fire CHEMICAL 2nd Degree Burn caused by a toxic substance Can be Alkali or Acidic Examples: bleach, gasoline, paint thinner • Epidermis & dermis • Blisters, shiny, & moist • Painful • Blanching: present • Heals: 2 - 6 weeks RADIATION Sunburns (UV radiation) & cancer treatment (radiation therapy) INHALATION 3rd Degree Caused by inhaling smoke which can cause flame injury or carbon monoxide poisoning FULL THICKNESS • Epidermis, dermis, & hypodermis • May look black, yellow, red & wet • No pain/ limited pain (nerve fibers are destroyed) • Skin will not heal (need skin grafting) • Eschar: dead tissue, leathery; must be removed! FRICTION Burn caused when an object rubs off the skin Examples: road rash, scrapes, carpet burn COLD SUPERFICIAL PARTIAL THICKNESS LAYERS OF THE SKIN Skin has been overexposed to cold Example: frostbite ELECTRIC Electrical current that passes through the body causing damage within POTENTIAL COMPLICATIONS Dysrhythmias, Fracture of bones. Release of myoglobin & hemoglobin into the blood which can clog the kidneys. ↓ EPIDERMIS DERMIS HYPODERMIS subcut/fatty tissue BURN LOCATION RESPIRATORY • Face • Neck • Chest • Torso INFECTION DISABILITY • Hands • Feet • Joints • Eyes Any open area where bacteria can easily enter • Perineum • Ears • Eyes TROUBLE HEALING • Poor blood supply • Diabetes • Infection COMPARTMENT SYNDROME • In the extremities Tight skin such as eschar acting like a band around the skin cutting off blood circulation INHALATION INJURY Damage to the respiratory system! Happens mostly in a closed area SIGNS OF INHALATION INJURY Hair singed around the face, neck or torso Trouble talking Soot in the nose or mouth Confusion or anxiety CARBON MONOXIDE (CO) POISONING Carbon monoxide travels faster than oxygen, making it bind to hgb first. Now oxygen cannot bind to hgb = HYPOXIC Classic symptom: cherry red skin Treatment: 100% O2 NOTE: Oxygen saturation may appear normal 135 PHASES OF BURN MANAGEMENT E MERGENT PHASE 24 - 48 HOURS after burn Onset of Injury to the restoration of capillary permeability PATHO VITAL SIGNS ↑ Capillary permeability (leaky vessels) causing: Leads to Edema Leads to fluids volume deficit (FVD) in the intravascular space NURSING CONSIDERATIONS THINK: Hypovolemic SHOCK! ↓ Urine output (from ↓ perfusion to the kidneys) LABS • Plasma leaves the intravascular space • Albumin & sodium follows • Fluids shift to the interstitial tissue ↑ Pulse ↓ Blood pressure ↓ Cardiac output ↑ Potassium (K+) ↑ Hematocrit (HCT) ↓ White Blood Cells (WBC’s) ↑ BUN/Creatine ACUTE PHASE Capillary permeability stabilized - to wound closure PATHO Capillary permeability is restored which leads to the body diuresing (increased urine production). All the excess fluid that shifted from the interstitial tissue shifts back into the intravascular space. GOALS • Prevent infection - Systemic antibiotic therapy • Ensure proper nutrition - Needs ↑ calories - Protein & Vit C to promote healing • Alleviate pain • Wound care - Always premedicate before wound care! - Debridement or grafting • Establish IV access (preferrably 2) • Fluids (Lactated Ringer's, crystalloids) • Parkland formula • Foley catheter to monitor urinary output (UOP) - Goal: > 30 mL/hr of UOP THINK: • Decrease edema ABC's - Elevate extremities above heart level 48 - 72 HOURS after burn & until wounds have healed NURSING CONSIDERATIONS • Renal - Diuresis is happening - Foley catheter to monitor UOP • Respiratory - Possible intubation if respiratory complications occurred • Gastrointestinal - Since the client is in FVD, there is ↓ perfusion to the stomach • Paralytic ileus • Curlings ulcer - Medication to decrease chance of ulcers • H2 histamine blocking agent (↓HCl) - Monitor bowel sounds - May need NG tube for suctioning REHABILITATIVE PHASE Burn healed and the patient is functioning mentally & physically GOALS • Psychosocial • Activities of daily living (ADL’s) • Physical therapy (PT) • Occupational theory (OT) • Cosmetic corrections 136 FLUID RESUSCITATION FOR BURNS THE PARKLAND FORMULA RULE OF NINES Used to calculate the total volume of fluids (mL) that a patient needs 24 hours after experiencing a burn Apply only in 2nd & 3rd degree burns. 4 mL X TBSA (%) X Body Weight (kg) = total mL of fluid needed Give half of the solution for the FIRST 8 HOURS Give half of the solution for the NEXT 16 HOURS RULE OF NINES Quick estimate of the % of the total body surface area (TBSA) has been effected by a partial & full-thickness burn in an adult client. PART 1 PRACTICE QUESTION A 25 year old male patient who weighs 79 kg has sustained burns to the back of the right arm, posterior trunk, front of the left leg, and their anterior head and neck. Using the Rule of Nines, calculate the total body surface area percentage that is burned. Back of right arm - 4.5% Posterior trunk - 18% Front of left leg - 9% Anterior head & neck- 4.5% Answer: 36% NOTE: The formula uses TBSA (%). However, you must calculate PART 2 using 36. Not 0.36 (also written as 36%). Use the Parkland formula to calculate the total amount of Lactated Ringer's solution that will be given over the next 24 hours. Answer: 11,376 mL 4 mL X 36% X 79 kg = 11,376 mL 10,360 / 2 = 5,688 mL FIRST 8 HOURS 10,360 / 2 = 5,688 mL NEXT 16 HOURS Keep in mind: the question could ask you for mL given in the first 24 hours, the first 8 hours, etc., so read the question carefully. 137 ARTERIAL BLOOD GASES (ABG's) Nurse in the making 138 $%*,17(535(7$7,21 .12:<285 /$%9$/8(6 5 2 5(63,5$725<25$ 0(7$%2/,&352%/(0" 0 ( 81&203(16$7('3$57,$//< &203(16$7('25)8//< ,IWKHS+LVRXWRIUDQJH &2RU+&2LVLQUDQJH 8QFRPSHQVDWHG &203(16$7('" ,I&2 +&2DUH%27+RXWRIUDQJH WKH3+LVRXWRIUDQJH 3DUWLDOO\&RPSHQVDWHG ,I3+LVLQUDQJH )XOO\&RPSHQVDWHG +2:'27+(25*$16&203(16$7(" ([FUHWLQJH[FHVVDFLG ELFDUE +&2 b 25 5HWDLQLQJbK\GURJHQ ELFDUE +&2 % WK LQ Nb % DV H +RXUVGD\V WRFRPSHQVDWH +\SHUYHQWLODWLQJ &2 $ONDORVLV +\SRYHQWLODWLQJ &2 $FLGRVLV &RPSHQVDWHV )$67 &R WK LQ N D &L G 139 5 (63,5$725<$&,'26,, 6 7KHOXQJVDUH UHWDLQLQJWRR PXFK&2 7KHNLGQH\VH[FUHWH K\GURJHQ UHWDLQ ELFDUE +&2 5 (63,5$725<$/.$/26,6 7KHOXQJVDUH ORVLQJWRR PXFK&2 ' UXJV 2SLRLGV 6HGDWLYHV 7KHNLGQH\VH[FUHWH ELFDUE +&2 UHWDLQK\GURJHQ 7HPSHUDWXUH ( GHPD )OXLGLQWKHOXQJV $VSLULQWR[LFLW\ 3 QHXPRQLD ([FHVVPXFXVLQWKHOXQJV +\SHUYHQWLODWLRQ 5 HVSLUDWRU\FHQWHURIWKHEUDLQLVGDPDJHG ( PEROL 3XOPRQDU\HPEROL 6 SDVPVRIWKHEURQFKLDO $VWKPD 6 DFHODVWLFLW\GDPDJH &23' (PSK\VHPD 5HVSLUDWRU\UDWH! +HDUWUDWH 7ZLWFKLQJRIWKHIDFLDO PXVFOHVZKHQWDSSLQJ WKHIDFLDOQHUYHLQ UHVSRQVHWR K\SRFDOFHPLD &RQIXVHG WLUHG 7HWDQ\ (.*FKDQJHV &KYRVWHNVLJQ $GPLQLVWHU2 6HPL)RZOHUŵVSRVLWLRQ %ORRGSUHVVXUH 5HVSLUDWLRQUDWH +HDUWUDWH 5HVWOHVVQHVV &RQIXVLRQ +HDGDFKH 6OHHS\FRPD 7XUQFRXJK GHHSEUHDWKH 7&'% 3QHXPRQLD IOXLGVWRWKLQ 3URYLGHHPRWLRQDOVXSSRUW )L[WKHEUHDWKLQJSUREOHP VHFUHWLRQV DGPLQLVWHU (QFRXUDJHJRRGEUHDWKLQJSDWWHUQV DQWLELRWLFV 5HEUHDWKLQJLQWRDSDSHUEDJ 0RQLWRUSRWDVVLXPOHYHOV *LYHDQWLDQ[LHW\PHGLFDWLRQVRU QRUPDOPPRO/ ,I&2!WKH\PD\QHHGDQ VHGDWLYHVWR EUHDWKLQJUDWH 0RQLWRU. &DOHYHOV HQGRWUDFKHDOWXEH 140 0(7$%2/,&$&,'26,6 7RRPXFK+\GURJHQ 7RROLWWOH%LFDUE +&2 0(7$%2/,&$/.$/26,6 6 7RRPXFK%LFDUE +&2 7RROLWWOH+\GURJHQ 7KHOXQJVZLOO EORZRII&2 1RWHQRXJKLQVXOLQ IDWPHWDEROLVP H[FHVVNHWRQHV DFLG 'LDEHWLFNHWRDFLGRVLV $FXWHFKURQLFNLGQH\LQMXU\ %UHDNLQJGRZQRIIDWV H[FHVVNHWRQHV DFLG 0DOQXWULWLRQ 6HYHUHGLDUUKHD ([FHVVLYHORVVRIEDVH IURP\RXUEDVH 7RRPDQ\DQWDFLGV 7KHOXQJVZLOO UHWDLQb&2 7RRPXFK VRGLXPELFDUERQDWH %$6( 'LXUHWLFV ([FHVVYRPLWLQJ ([FHVVORVVRIK\GURFKORULF DFLG +&/ IURPWKHVWRPDFK +\SHUDOGRVWHURQLVP +\SRYHQWLODWLRQEUHDWKVSHUPLQXWH .XVVPDXO VEUHDWKLQJ +\SHUNDOHPLD 0XVFOHWZLWFKLQJ :HDNQHVV $UUK\WKPLDV %ORRGSUHVVXUH &RQIXVLRQ /RZ3RWDVVLXP . 'HHSUDSLG EUHDWKLQJ !EUHDWKV SHUPLQXWH 0HWDEROLF$FLGRVLV VHUXPSRWDVVLXP 0HWDEROLF$ONDORVLV VHUXPSRWDVVLXP '\VUK\WKPLDV 0XVFOHFUDPSVZHDNQHVV 9RPLWLQJ 7HWDQ\ 7UHPRUV (.*FKDQJHV 0RQLWRULQWDNH RXWSXW $GPLQLVWHU,9VROXWLRQWR EDVHV ,QLWLDWHVHL]XUHSUHFDXWLRQ 0RQLWRU.OHYHOV 'LDEHWLF.HWRDFLGRVLV '.$ *LYH,QVXOLQ WKLVVWRSV WKHEUHDNGRZQRIIDWV ZKLFKVWRSVNHWRQHVIURP EHLQJSURGXFHG 0RQLWRUIRUK\SRYROHPLD GXHWRSRO\XULD DFLGV .LGQH\GLVHDVH 'LDO\VLVWRUHPRYH WR[LQV 'LHW &DORULHV 3URWHLQ 0RQLWRU3RWDVVLXP &DOFLXPOHYHOV $GPLQLVWHU,9IOXLGVWRKHOSWKHNLGQH\VJHWULGRI ELFDUERQDWH 5HSODFH. *LYHDQWLHPHWLFVIRUYRPLWLQJ =RIUDQRU3KHQHUJDQ :DWFKIRUVLJQVRIUHVSLUDWRU\GLVWUHVV 141 TEMPLATES & PLANNERS Tear these pages out and make copies, as many as you need! Nurse in the making 142 151 NURSING DIAGNOSIS NURSING DIAGNOSIS SUPPORTING DATA SUPPORTING DATA GOALS GOALS PATIENT INFO MEDICAL HISTORY NURSING DIAGNOSIS SUPPORTING DATA GOALS NURSING DIAGNOSIS SUPPORTING DATA GOALS 143 144 NURSING DIAGNOSIS NURSING DIAGNOSIS SUPPORTING DATA SUPPORTING DATA GOALS GOALS PATIENT INFO MEDICAL HISTORY NURSING DIAGNOSIS SUPPORTING DATA GOALS NURSING DIAGNOSIS SUPPORTING DATA GOALS 145 146 Course Tracker COURSE: SUBMITTED ASSIGNMENT/PROJECT DUE DATE GRADE 147 Test / Quiz Tracker COURSE: TEST DATE CHAPTERS/TOPICS COVERED GRADE PASSED? YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO 148 Course Tracker COURSE: SUBMITTED ASSIGNMENT/PROJECT DUE DATE GRADE 149 Test / Quiz Tracker COURSE: TEST DATE CHAPTERS/TOPICS COVERED GRADE PASSED? YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO 150 Course Tracker COURSE: SUBMITTED ASSIGNMENT/PROJECT DUE DATE GRADE 151 Test / Quiz Tracker COURSE: TEST DATE CHAPTERS/TOPICS COVERED GRADE PASSED? YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO 152 Course Tracker COURSE: SUBMITTED ASSIGNMENT/PROJECT DUE DATE GRADE 153 Test / Quiz Tracker COURSE: TEST DATE CHAPTERS/TOPICS COVERED GRADE PASSED? YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO Course Tracker COURSE: SUBMITTED ASSIGNMENT/PROJECT DUE DATE GRADE Test / Quiz Tracker COURSE: TEST DATE CHAPTERS/TOPICS COVERED GRADE PASSED? YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO MONDAY: TO DO LIST WEEKLY Planner TUESDAY: WEDNESDAY: THURSDAY: NOTES FRIDAY: SATURDAY: TESTS / EXAMS SUNDAY: SELF-CARE q PROJETS / ASSIGNSMENTS MONTHLY MONTH: Planner YEAR: NURSEINTHEMAKING LLC MONDAY PRIORITIES TUESDAY MONTH: THURSDAY FRIDAY 4 PM 3 PM 2 PM 1 PM 12 PM 11 AM 10 AM 9 AM 8 AM 7 AM 6 AM 5 PM 4 PM 3 PM 2 PM 1 PM 12 PM 11 AM 10 AM 9 AM 8 AM 7 AM 6 AM 6 PM 5 PM 4 PM 3 PM 2 PM 1 PM 12 PM 11 AM 10 AM 9 AM 8 AM 7 AM 6 AM 7 PM 6 PM 5 PM 4 PM 3 PM 2 PM 1 PM 12 PM 11 AM 10 AM 9 AM 8 AM 7 AM 6 AM 7 PM 6 PM 5 PM 4 PM 3 PM 2 PM 1 PM 12 PM 11 AM 10 AM 9 AM 8 AM 7 AM 6 AM 7 PM 6 PM 5 PM 4 PM 3 PM 2 PM 1 PM 12 PM 11 AM 10 AM 9 AM 8 AM 7 AM 6 AM 7 PM 6 PM 5 PM 4 PM 3 PM 2 PM 1 PM 12 PM 11 AM 10 AM 9 AM 8 AM 7 AM 6 AM PRIORITIES 5 PM 6 PM 7 PM PRIORITIES 6 PM 7 PM PRIORITIES WEDNESDAY Planner SUNDAY PRIORITIES HOURLY PRIORITIES 7 PM 8 PM SATURDAY PRIORITIES GOOD PRODUCTIVITY METER 8 PM PRODUCTIVITY METER GOOD BAD 8 PM GREAT! 8 PM PRODUCTIVITY METER GOOD BAD 8 PM GREAT! 8 PM PRODUCTIVITY METER GOOD BAD 8 PM GREAT! 9 PM PRODUCTIVITY METER GOOD BAD 9 PM GREAT! 9 PM PRODUCTIVITY METER GOOD BAD 9 PM GREAT! 9 PM PRODUCTIVITY METER GOOD BAD 9 PM GREAT! 9 PM BAD GREAT! NURSEINTHEMAKING LLC PATHOLOGY DISEASE SIGNS & SYMPTOMS RISK FACTORS COMPLICATIONS DIAGNOSIS TREATMENT Dear future nurse, :) You may be stressed, you may feel tired, and you may want to give up. Nursing school is hard, there's no doubt about it. Everyone cries, everyone has meltdowns, and there will be moments you don't feel qualified for the task at hand. But take heart, the challenge only makes you stronger. Put in the work, show up on time, and find an amazing study group. You got this! – Kristine Tuttle, BSN, RN By purchasing this study guide, you agree to the following terms and conditions: you agree that this ebook and all other media produced by NurseInTheMaking LLC are simply guides and should not be used over and above your course material and teacher instruction in nursing school. When details contained within these guides and other media differ, you will defer to your nursing school’s faculty/staff instruction. These guides and other media created by NurseInTheMaking LLC are not intended to be used as medical advice or clinical practice; they are for educational use only. You also agree to not distribute or share these materials under any circumstances; they are for personal use only. © 2020 NurseInTheMaking LLC. All content is property of NurseInTheMaking LLC and www.anurseinthemaking.com. Replication and distribution of this PDWHULDOLVSURKLELWHGE\ODZ$OOGLJLWDOSURGXFWV 3')ŵOHVHERRNVUHVRXUFHVDQGDOORQOLQHFRQWHQW DUHVXEMHFWWRFRS\ULJKWSURWHFWLRQ(DFKSURGXFWVROG is licensed to an individual user and customers are not allowed to distribute, copy, share, or transfer the products to any other individual or entity. 171 Nurse in the making WWW.ANURSEINTHEMAKING.COM