API 510 Course /HVVRQ3ODQ (Calculations– InternalandExternalInspectionIntervals) I. &RUURVLRQ5DWHVDQG,QVSHFWLRQ,QWHUYDOV Able to calculate; D 0HWDO/RVV LQFOXGLQJFRUURVLRQDYHUDJLQJ $3,3DUD E &RUURVLRQ5DWHV $3,3DUD F 5HPDLQLQJ&RUURVLRQ$OORZDQFH $3,3DUD G 5HPDLQLQJ6HUYLFH/LIH $3,3DUD H ,QVSHFWLRQ,QWHUYDO $3,6HFWLRQ NOTE: These calculations can be open and/or closed book exams. II. Joint Efficiencies Determine; D :HOG-RLQW&DWHJRULHV $60( 6HFWLRQ9,,,8: E 7\SHRIUDGLRJUDSK\ IXOOVSRWRUQRQH SHUIRUPHGEDVLVWKHQDPHSODWHPDUNLQJV 5757HWF 8: F -RLQWHIILFLHQF\E\UHDGLQJ7DEOH8: G -RLQWHIILFLHQF\IRUVHDPOHVVKHDGVDQGYHVVHOV6HFWLRQVSHU8: G DQG H -RLQWHIILFLHQF\IRUZHOGHGSLSHDQGWXELQJSHU8: H 127( 'HWHUPLQLQJMRLQWHIILFLHQF\PD\EHSDUWRIWKHLQWHUQDOSUHVVXUHSUREOHPVLQFHMRLQWHIILFLHQF\(LVXVHGLQWKHIRUPXODVIRUGHWHUPLQLQJUHTXLUHG WKLFNQHVVRU9HVVHO3DUW0$:3 2 +RZWR6ROYH0$7+HTXDWLRQV" +RZ7R%UHDN0$7+4XHVWLRQV" :KDWDQVZHUGR,QHHG" :KDWZLOO,1(('WRVROYHHTXDWLRQ" :KDWLV.12:1" :KDWLV81.12:1" +RZGR,JHWWKH81.12:1¶V" 3 API510Ͳ Calculations ShortTermCorrosionRate LongTermCorrosionRate tprevious Ͳ tactual CRST = #ofyearsbetweentprevious &tactual Remaining Life tactual RL = Section7,par 7.1.1 tinitial Ͳ tactual CRLT = #ofyearsbetweentprevious &tactual InternalInspectionInterval ,QWHUYDO= Ͳ trequired /HVVHU RIòRI5/RU \HDUV CorrosionͲRate ExternalInspectionInterval RequiredThickness W= Minimum Thickness 35 > 6( 3 @ ,QWHUYDO= /HVVHU RI\HDUVRU,QWHUQDO,QWHUYDO InternalorOnstream Interval Ͳ Lesserof10yrs or½Remaininglife WP = WF Ͳ ifremaininglifeislessthan4yrs,fulllife upto2years Ͳ Remaininglifeis2yearsorless,interval isFULLLIFE &RUURVLRQ5DWH&DOFXODWLRQV &RUURVLRQUDWHHTXDWLRQV ShortTermCorrosionRate CRST = tprevious Ͳ tactual_LAST #ofyearsbetweentprevious &tactual_LAST LongTermCorrosionRate tinitial Ͳ tactual_LAST CRLT = #ofyearsbetweentInitial &tactual_LAST Variables forThicknessCalcs WLQLWLDO WDFWXDO DFWXDO RU/$67 WKLFNQHVVPHDVXUHG WSUHYLRXV WKLFNQHVVUHFRUGHGGXULQJSUHYLRXVLQVSHFWLRQV WUHTXLUHG WKLFNQHVVUHTXLUHGIRULQWHUQDOSUHVVXUHDVFDOFXODWHGE\GHVLJQ IRUPXODV EHIRUHFRUURVLRQDOORZDQFHDQGPDQXIDFWXUHU WROHUDQFHVDUHDGGHG <HDUV <HDUVEHWZHHQWKLFNQHVVUHDGLQJV WKLFNQHVVDWLQLWLDOLQVWDOODWLRQ RUEHJLQQLQJRIDQHZFRUURVLRQ UDWHHQYLURQPHQW 127( /7DQG67FRUURVLRQUDWHVPXVWEHFRPSDUHGWRVHHZKLFKUDWHUHVXOWVLQVKRUWHVWUHPDLQLQJOLIH 5 8QLIRUP&RUURVLRQ 6 8QLIRUP&RUURVLRQ 7 3LWWLQJ&RUURVLRQ 8 3LWWLQJ&RUURVLRQ 9 3LWWLQJ&RUURVLRQ 10 &RUURVLRQ5DWH&DOFXODWLRQV Section7,par 7.1.1 6KRUWWHUPFRUURVLRQUDWH CorrosionͲrate = tprevious Ͳ tlast #ofyearsbetweentprevious&tlast /RQJWHUPFRUURVLRQUDWH /RQJ7HUP = &RUURVLRQUDWH tinitial Ͳ tlast #ofyearsbetweentinitial &tlast 11 &RUURVLRQ5DWH&DOFXODWLRQV 3UDFWLFH4XHVWLRQ Section7,par 7.1.1 $YHVVHOKDVEHHQLQVHUYLFHIRU\HDUV7KHRULJLQDOVKHOOWKLFNQHVVZDV´DQG)XOO57ZDV SHUIRUPHGGXULQJIDEULFDWLRQ7KHUHTXLUHGWKLFNQHVVLV´ /DVWPHDVXUHGWKLFNQHVVWDNHQ\HDUV DJRLQGLFDWHGDUHPDLQLQJWKLFNQHVVRI´:KDWLV6KRUW7HUPFRUURVLRQUDWH" 12 &RUURVLRQ5DWH&DOFXODWLRQV Section7,par 7.1.1 3UDFWLFH4XHVWLRQ $YHVVHOKDVEHHQLQVHUYLFHIRU\HDUV7KHRULJLQDOVKHOOWKLFNQHVVZDV´DQG)XOO57ZDV SHUIRUPHGGXULQJIDEULFDWLRQ7KHUHTXLUHGWKLFNQHVVLV´ /DVWPHDVXUHGWKLFNQHVVWDNHQ\HDUV DJRLQGLFDWHGDUHPDLQLQJWKLFNQHVVRI´:KDWLV6KRUW7HUPFRUURVLRQUDWH" &DOFXODWH6KRUWWHUPFRUURVLRQUDWH :KDWLV.QRZQ" CorrosionͲrate = tprevious Ͳ tlast tprevious = 0.875 #ofyearsbetweentprevious&tlast tlast = 0.865 = 0.875 Ͳ 0.865 5 = 0.002 inch/yr +RZPDQ\\HDUVEHWZHHQUHDGLQJV" 3UHYLRXVUHDGLQJLVWKH25,*,1$/WKLFNQHVV LH =(52\HDUVRIVHUYLFH /DVWUHDGLQJWDNHQDIWHU\HDUVRIVHUYLFH ± 13 &RUURVLRQ5DWH&DOFXODWLRQV 3UDFWLFH4XHVWLRQ $YHVVHOKDVEHHQLQVHUYLFHIRU\HDUVDQGWKHFXUUHQWWKLFNQHVVRIWKHVKHOOLV´,QVSHFWLRQ UHFRUGVLQGLFDWHGDQRULJLQDOWKLFNQHVVRI´:KDWLVFRUURVLRQUDWH" 14 &RUURVLRQ5DWH&DOFXODWLRQV 3UDFWLFH4XHVWLRQ $YHVVHOZDVSODFHGLQVHUYLFHLQ,QLWLDOWKLFNQHVVPHDVXUHPHQWWDNHQEHIRUHWKHYHVVHOZDV SODFHGLQWRVHUYLFHLQGLFDWHGDVKHOOWKLFNQHVVRILQFK PP 7KLFNQHVVPHDVXUHPHQWV WDNHQLQLQGLFDWHGDVKHOOWKLFNQHVVLQFK PP 7KHUHTXLUHGWKLFNQHVVRIWKHVKHOOLV LQFK PP 7KHPRVWUHFHQWWKLFNQHVVPHDVXUHPHQWIRUWKHVKHOOZDVWDNHQLQDQG LQGLFDWHGDUHPDLQLQJWKLFNQHVVRILQFK PP :KDWLVFRUURVLRQUDWH" &RUURVLRQ5DWH&DOFXODWLRQV 3UDFWLFH4XHVWLRQ ,QVSHFWLRQUHFRUGVFRQWDLQWKHIROORZLQJLQIRUPDWLRQIRUDSDUWLFXODUFRQGLWLRQ PRQLWRULQJORFDWLRQ Thickness LQFK PP LQFK PP LQFK PP Yearsofservice 1HZ &XUUHQW :KDWLVWKHFRUURVLRQUDWHIRUWKLVFRQGLWLRQPRQLWRULQJORFDWLRQ" &RUURVLRQ5DWH&DOFXODWLRQV ³5HPDLQLQJ&RUURVLRQ$OORZDQFH´ 3UDFWLFH4XHVWLRQ $IWHU\HDUVRIEHLQJLQVHUYLFHDYHVVHOLVLQVSHFWHGDQGWKHWKLQQHVWVKHOOVHFWLRQLVIRXQGWREH LQFK PP ,IWKHRULJLQDOWKLFNQHVVZDVDQGWKHUHTXLUHGWKLFNQHVVLVLQFK PP ZKDWWKLFNQHVVRIPDWHULDOLVDYDLODEOHIRUFRUURVLRQDOORZDQFH" &RUURVLRQ5DWH&DOFXODWLRQV 3UDFWLFH4XHVWLRQ $YHVVHOZDVSODFHGLQVHUYLFHLQ,QLWLDOWKLFNQHVVPHDVXUHPHQWWDNHQEHIRUHWKHYHVVHOZDV SODFHGLQWRVHUYLFHLQGLFDWHGDVKHOOWKLFNQHVVRILQFK PP 7KLFNQHVVPHDVXUHPHQWV WDNHQLQLQGLFDWHGDVKHOOWKLFNQHVVLQFK PP 7KHUHTXLUHGWKLFNQHVVRIWKHVKHOOLV LQFK PP 7KHPRVWUHFHQWWKLFNQHVVPHDVXUHPHQWIRUWKHVKHOOZDVWDNHQLQDQG LQGLFDWHGDUHPDLQLQJWKLFNQHVVRILQFK PP :KDWLVFRUURVLRQUDWH" &RUURVLRQUDWH'HWHUPLQDWLRQ Determined by SHORT term or Long Term Calculations (API 510, par 7.1.1.2) Newly installed or Change in Service (API 510, par 7.1.2) 1. 2. 3. 4. Calculated from data of vessels in similar service. Estimated from Owner-User experience Published Data On-stream determination after 1000 hrs of service. May have different corrosion-rates for large vessels with multiple zones. (API 510, par 6.5.3) 19 :KDWFRGHSURYLGHVJXLGDQFHIRUPDWHULDOYHULILFDWLRQ 30, " :KDWFRGHSURYLGHVJXLGDQFHIRULQVSHFWLRQWHVWLQJDQGPDLQWHQDQFHRI UHOLHIYDOYHV" 7KHUPDOIDWLJXHLVVXVSHFWHGZKHQWHPSHUDWXUHVZLQJVH[FHHG :KDWPDWHULDOVDUHDIIHFWHGE\PHFKDQLFDOIDWLJXH" Mechanicalfatigueiscausedby; Whatmaterialdoesnothaveanendurancelimit? 3HU$60(6HFWLRQ9,,,ZKHQLVZHOGLQJQRWUHFRPPHQGHG" :KHQLVLWUHFRPPHQGHGWRZDUPWKHEDVHPHWDOWRR)" &8,7HPSHUDWXUH5DQJHIRU&DUERQ6WHHO 6WDQGDUGWHPSHUDWXUHUDQJHIRUD37H[DP 7HPSHUDWXUHZKHUH&RROLQJ:DWHUFRUURVLRQVWDUWVWRVLJQLILFDQWO\ LQFUHDVH 7HPSHUDWXUHZKHUH&KORULGH6&&EHFRPHVDFRQFHUQ &8,7HPSHUDWXUH5DQJHIRU6WDLQOHVV6WHHO 7HPSHUDWXUHWKDWVSHFLDOSURFHGXUHVDUHQHHGHGIRU87 WKLFNQHVVUHDGLQJV 7KHUPDOIDWLJXHPD\EHVXVSHFWHGLIWKHWHPSHUDWXUHVZLQJV :KDWLVWKHPLQLPXPSUHKHDWWHPSHUDWXUHIRUXVLQJSUHKHDWLQ OLHXRI3:+7 :KDWLVWKHPLQLPXPSUHKHDWWHPSHUDWXUHZKHQSHUIRUPLQJDORFDO 3:+7LQOLHXRIDIXOOHQFLUFOHPHQW3:+7 $WZKDWWHPSHUDWXUHGRHV6XOILGDWLRQEHJLQRQ&DUERQ6WHHO PDWHULDOV" 5HPDLQLQJ/LIH&DOFXODWLRQV 5HPDLQLQJ/LIHHTXDWLRQ Section7,par 7.2.1 Remaining Life RL = tactual_Last Ͳ trequired CorrosionͲRate Variables forRemainingLifeCalcs WDFWXDO WUHTXLUHG DFWXDO RU/$67 WKLFNQHVVPHDVXUHG WKLFNQHVVUHTXLUHGIRULQWHUQDOSUHVVXUHDVFDOFXODWHGE\GHVLJQ IRUPXODV EHIRUHFRUURVLRQDOORZDQFHDQGPDQXIDFWXUHU WROHUDQFHVDUHDGGHG F &RUURVLRQ5DWH 127( &RUURVLRQUDWHLVWKH UDWH LH6KRUWRU/RQJWHUPUDWH ZKLFKUHVXOWV LQVKRUWHVWUHPDLQLQJOLIH 24 5HPDLQLQJ/LIH&DOFXODWLRQV 3UDFWLFH4XHVWLRQ Section7,par 7.2.1 $YHVVHOKDVEHHQLQVHUYLFHIRU\HDUV7KHRULJLQDOVKHOOWKLFNQHVVZDV´DQG)XOO57ZDV SHUIRUPHGGXULQJIDEULFDWLRQ7KHUHTXLUHGWKLFNQHVVLV´&XUUHQWPHDVXUHGWKLFNQHVVLQGLFDWHV DUHPDLQLQJWKLFNQHVVRI´:KDWLV5HPDLQLQJOLIH" 25 5HPDLQLQJ/LIH&DOFXODWLRQV Section7,par 7.2.1 3UDFWLFH4XHVWLRQ $YHVVHOKDVEHHQLQVHUYLFHIRU\HDUV7KHRULJLQDOVKHOOWKLFNQHVVZDV´DQG)XOO57ZDV SHUIRUPHGGXULQJIDEULFDWLRQ7KHUHTXLUHGWKLFNQHVVLV´&XUUHQWPHDVXUHGWKLFNQHVVLQGLFDWHV DUHPDLQLQJWKLFNQHVVRI´:KDWLV5HPDLQLQJOLIH" /RRNLQJDWWKHIRUPXODIRU³5HPDLQLQJ/LIH´ZKDWLV81.2:1" 5HPDLQLQJ/LIH = Ͳ trequired tlast CorrosionͲrate :KDWLV.QRZQ" tprevious 0.625 tlast 0.600 8QNQRZQ" CorrosionͲrate = ????? Sincethe“CORROSIONͲRATEisunknown,the1st Stepistodeterminethe CorrosionͲrate. 26 5HPDLQLQJ/LIH&DOFXODWLRQV 3UDFWLFH4XHVWLRQ $YHVVHOKDVEHHQLQVHUYLFHIRU\HDUV7KHRULJLQDOVKHOOWKLFNQHVVZDV´DQG)XOO57ZDV SHUIRUPHGGXULQJIDEULFDWLRQ7KHUHTXLUHGWKLFNQHVVLV´&XUUHQWPHDVXUHGWKLFNQHVVLQGLFDWHV DUHPDLQLQJWKLFNQHVVRI´:KDWLV5HPDLQLQJOLIH" Ͳ trequired tlast CorrosionͲrate 5HPDLQLQJ/LIH = :KDWLV.QRZQ" 6WHS± &DOFXODWHWKH&25526,215$7( &RUURVLRQUDWH = = tprevious Ͳ tlast #ofyearsbetweentprevious&tlast tprevious 0.625 tlast 0.600 0.625 Ͳ 0.600 8 RI\HDUVEHWZHHQ 3UHYLRXVDQG/DVW \HDUV = 0.003 27 5HPDLQLQJ/LIH&DOFXODWLRQV 3UDFWLFH4XHVWLRQ 6WHS± &DOFXODWHWKH5(0$,1,1*/,)( 5HPDLQLQJ/LIH = tlast Ͳ trequired :KDWLV.QRZQ" CorrosionͲrate trequired = 0.575 = = 0.600 Ͳ 0.575 0.003 8 yrs tlast = 0.600 CorrosionͲrate = 0.003 28 5HPDLQLQJ/LIH&DOFXODWLRQV 3UDFWLFH4XHVWLRQ $YHVVHOKDVDVLQJOHFRUURVLRQUDWHRI´SHU\HDU PP\U 7KHUHTXLUHGWKLFNQHVVIRUWKH VKHOODQGKHDGVLVLQFK PP 7KHDFWXDOWKLFNQHVVRIWKHKHDGLVLQFKDQGVKHOOLV LQFK:KDWLVWKHUHPDLQLQJOLIHRIWKHYHVVHO" 29 5HPDLQLQJ/LIH&DOFXODWLRQV 3UDFWLFH4XHVWLRQ $YHVVHOZDVSODFHGLQVHUYLFHLQ,QLWLDOWKLFNQHVVPHDVXUHPHQWWDNHQEHIRUHWKHYHVVHOZDV SODFHGLQWRVHUYLFHLQGLFDWHGDVKHOOWKLFNQHVVRILQFK PP 7KLFNQHVVPHDVXUHPHQWV WDNHQLQLQGLFDWHGDVKHOOWKLFNQHVVLQFK PP 7KHUHTXLUHGWKLFNQHVVRIWKHVKHOOLV LQFK PP 7KHPRVWUHFHQWWKLFNQHVVPHDVXUHPHQWIRUWKHVKHOOZDVWDNHQLQDQG LQGLFDWHGDUHPDLQLQJWKLFNQHVVRILQFK PP :KDWLVUHPDLQLQJOLIH" ,QVSHFWLRQ,QWHUYDOVDQG1H[W,QVSHFWLRQ'DWH ,QWHUQDO,QVSHFWLRQ,QWHUYDOV(API 510 par 6.5.1.1) Section6,par 6.5.1v Internal or on-stream inspections shall not exceed one half the remaining life of the vessel or 10 years, whichever is less. Whenever the remaining life is less than four years, the inspection interval may be the full remaining life up to a maximum of two years. ([WHUQDO,QVSHFWLRQ,QWHUYDOV(API 510 par 6.5.1.1) Interval not exceed the lesser of 5 years or the internal/on-stream interval.. ThicknessInspectionIntervals Should be part of the inspection plan, but no interval requirements mentioned in API510 (API 510 par 5.5.1) CUIInspectionIntervals Section5,par 5.5.1 Should be part of the inspection plan, but no interval requirements mentioned in API510 (API 510 par 5.5.1) “SHALL” be considered for insulated vessels in “intermittent” service or operates between; 10oF and 350oF for carbon steel and alloy steels 140oF and 400oF for austenitic stainless steels 31 ,QWHUQDO,QVSHFWLRQ,QWHUYDO 3UDFWLFH4XHVWLRQ Section6,par 6.5.1v $YHVVHOKDVEHHQLQVHUYLFHIRU\HDUV7KHRULJLQDOVKHOOWKLFNQHVVZDV´DQG)XOO57ZDV SHUIRUPHGGXULQJIDEULFDWLRQ7KHUHTXLUHGWKLFNQHVVLV´&XUUHQWPHDVXUHGWKLFNQHVVLQGLFDWHV DUHPDLQLQJWKLFNQHVVRI´:KDWLV,QWHUQDO,QVSHFWLRQ,QWHUYDO" 32 ,QWHUQDO,QVSHFWLRQ,QWHUYDO 3UDFWLFH4XHVWLRQ $YHVVHOKDVEHHQLQVHUYLFHIRU\HDUV7KHRULJLQDOVKHOOWKLFNQHVVZDV´DQG)XOO57ZDV SHUIRUPHGGXULQJIDEULFDWLRQ7KHUHTXLUHGWKLFNQHVVLV´&XUUHQWPHDVXUHGWKLFNQHVVLQGLFDWHV DUHPDLQLQJWKLFNQHVVRI´:KDWLV,QWHUQDO,QVSHFWLRQ,QWHUYDO" :KDWLV.QRZQ" ,QWHUQDO,QVSHFWLRQ,QWHUQDO OHVVHURIò5/RU\HDUV 5HPDLQLQJ/LIH = Ͳ trequired tlast CorrosionͲrate tprevious 0.625 tlast 0.600 Section7,par 7.2.1 8QNQRZQ" CorrosionͲrate = ????? Sincethe“CORROSIONͲRATEisunknown,the1st Stepistodeterminethe CorrosionͲrate. 33 ,QWHUQDO,QVSHFWLRQ,QWHUYDO 3UDFWLFH4XHVWLRQ $YHVVHOKDVEHHQLQVHUYLFHIRU\HDUV7KHRULJLQDOVKHOOWKLFNQHVVZDV´DQG)XOO57ZDV SHUIRUPHGGXULQJIDEULFDWLRQ7KHUHTXLUHGWKLFNQHVVLV´&XUUHQWPHDVXUHGWKLFNQHVVLQGLFDWHV DUHPDLQLQJWKLFNQHVVRI´:KDWLV5HPDLQLQJOLIH" Ͳ trequired tlast CorrosionͲrate 5HPDLQLQJ/LIH = $Q\8QNQRZQV" 'RQ¶WNQRZWKH&RUURVLRQUDWH :KDWLV.QRZQ" 6WHS± &DOFXODWHWKH&25526,215$7( &RUURVLRQUDWH = = tprevious Ͳ tlast #ofyearsbetweentprevious&tlast tprevious 0.625 tlast 0.600 0.625 Ͳ 0.600 = 0.003 8 Section7,par 7.1.1 RI\HDUVEHWZHHQ 3UHYLRXVDQG/DVW \HDUV 34 ,QWHUQDO,QVSHFWLRQ,QWHUYDO 3UDFWLFH4XHVWLRQ Section7,par 7.2.1 6WHS± &DOFXODWHWKH5(0$,1,1*/,)( 5HPDLQLQJ/LIH = tlast Ͳ trequired :KDWLV.QRZQ" CorrosionͲrate trequired = 0.575 = = 0.600 Ͳ 0.575 0.003 8 yrs tlast = 0.600 CorrosionͲrate = 0.003 35 ,QWHUQDO,QVSHFWLRQ,QWHUYDO 3UDFWLFH4XHVWLRQ 6WHS± &DOFXODWHWKH,QVSHFWLRQ,QWHUYDO ,QVSHFWLRQLQWHUYDO OHVVHURI5/RU\HDUV OHVVHURIò \HDUV RU\HDUV OHVVHU\HDUVRU\HDUV \HDUV InternalInspectionInterval=4years 36 ,QWHUQDO,QVSHFWLRQ,QWHUYDO 3UDFWLFH4XHVWLRQ $YHVVHOKDVDVLQJOHFRUURVLRQUDWHRI´SHU\HDU PP\U 7KHUHTXLUHGWKLFNQHVVIRUWKH VKHOODQGKHDGVLVLQFK PP 7KHDFWXDOWKLFNQHVVRIWKHKHDGLVLQFKDQGVKHOOLV LQFK:KDWLVWKHQH[WRQVWUHDPLQVSHFWLRQLQWHUYDO" 37 ([WHUQDO,QVSHFWLRQ,QWHUYDO 3UDFWLFH4XHVWLRQ Section6,par 6.4.1 $YHVVHOZLWKDUHTXLUHGWKLFNQHVVRI´WKDWRSHUDWHVDWR)DWSVLJZDVSODFHGLQVHUYLFHLQ-XO\ 7KLFNQHVVUHDGLQJVWDNHQSULRUWRSODFLQJWKLVYHVVHOLQVHUYLFHLQGLFDWHGDWKLFNQHVVRI´ 7KLFNQHVVGDWDWDNHQ-XO\LQGLFDWHGDWKLFNQHVVRI´:KDWVKRXOGWKHH[WHUQDOLQVSHFWLRQ LQWHUYDOEH" HEAD BANGER Whatisthetemperaturerangethattemperembrittlementoccurs inlowalloysteels? :KHQVKRXOGDFRUURVLRQVSHFLDOLVWEHFRQVXOWHGZKLOH GHYHORSLQJDQLQVSHFWLRQSODQ" $WZKDWWHPSHUDWXUHGRHV6XOILGDWLRQEHJLQRQLURQEDVHGVWHHOV" :KDWLVWKHPD[LPXPWHPSHUDWXUHIRUWDNLQJ87WKLFNQHVV PHDVXUHPHQWV" :KDWLVWKH3:+7WHPSHUDWXUHIRUFDUERQVWHHO" :KDWLVWKHPLQLPXPEDVHPHWDOWHPSHUDWXUHZKHQ K\GURWHVWLQJ YHVVHOVWKLFN" :KDWLVWKHPLQLPXPEDVHPHWDOWHPSHUDWXUHZKHQ K\GURWHVWLQJ YHVVHOV WKLFN" :KDWLVWKHPD[LPXPWHPSHUDWXUHIRUSHUIRUPLQJPDJQHWLF SDUWLFOHLQVSHFWLRQ"" 'HVLJQSUHVVXUHIRUYHVVHOZLWKLQWKHVFRSHRI$60(6HFWLRQ9,,, LV" :KDWLVWKHGHVLJQSUHVVXUHRIQRQILUHGERLOHUVWKDWUHTXLUHV )8//57" :KDWLVWKHPLQLPXPUDQJHIRUDSUHVVXUHJDXJHGXULQJDSUHVVXUH WHVW" :KDWLVWKHSUHIHUUHGUDQJHIRUDSUHVVXUHJDXJHGXULQJD SUHVVXUHWHVW" 1H[W,QVSHFWLRQ $3,3DUDDQG Nextinspectiondate =Lastinspectiondate+ interval $TXHVWLRQUHTXLULQJ\RXWRFDOFXODWH³QH[WLQVSHFWLRQGDWH´PD\EH FRPSOH[RUVLPSOH 6LPSOHTXHVWLRQZRXOGRQO\UHTXLUH\RXWRGHWHUPLQHLQVSHFWLRQLQWHUYDODQG WKHQQH[WGDWH &RPSOH[TXHVWLRQZRXOGUHTXLUH\RXWRFDOFXODWHFRUURVLRQUDWHUHPDLQLQJOLIH LQVSHFWLRQLQWHUYDOWKHQQH[WLQVSHFWLRQGDWH 42 1H[W,QVSHFWLRQ $3,3DUDDQG Practicefor“Simple”calculation 3UDFWLFH4XHVWLRQ $YHVVHOWKDWKDVDUHPDLQLQJOLIHFDOFXODWHGIURPWKHWKLFNQHVVGDWD WDNHQ0DUFK7KHUHPDLQLQJOLIHRIWKHYHVVHOLV\HDUV:KDW LV³QH[W([WHUQDOLQVSHFWLRQGDWH´" 43 1H[W,QVSHFWLRQ $3,3DUDDQG 3UDFWLFH4XHVWLRQ :KDWLVWKH1H[W,QWHUQDO,QVSHFWLRQGDWH ZLWKWKHIROORZLQJ LQIRUPDWLRQ" Remaining Life(yr) March2000 March 1995 16 .324 .356 44 (YDOXDWLRQRI3LWWLQJ $3,3DUD Widely scattered pits can be ignored, if; Section7,par 7.4.3 Rule#1 Remaining Thickness below pit is greater than ½ the Required Thickness Vessel Thickness = 2.0” Depth of Pit = 1.06” Corrosion Allowance = 0.250 Retirement Thickness = 1.75” 45 (YDOXDWLRQRI3LWWLQJ $3,3DUD Widely scattered pits can be ignored, if; Section7,par 7.4.3 Rule#2 Areaofthepittingbelowthe corrosionallowancehasan arealessthan7in2withinan 8”diametercircle. 46 (YDOXDWLRQRI3LWWLQJ $3,3DUD Widely scattered pits can be ignored, if; Section7,par 7.4.3 Rule#3 Sumofthelengthofpitswithinany8”line,mustbelessthan2” 47 (YDOXDWLRQRI3LWWLQJ 3UDFWLFH4XHVWLRQ Section7,par 7.4.3 $UHFHQWLQVSHFWLRQGLVFRYHUHGLVRODWHGSLWWLQJLQWKHYHVVHOZDOO0LQLPXPUHTXLUHGZDOO WKLFNQHVVLV´&XUUHQWWKLFNQHVVRIWKHYHVVHOLV´ :KDWLVWKHPLQLPXP DOORZHGUHPDLQLQJWKLFNQHVVDOORZHGDWWKHGHHSHVWSLW" 48 (YDOXDWLRQRI3LWWLQJ Section7,par 7.4.3 3UDFWLFH4XHVWLRQ $UHFHQWLQVSHFWLRQGLVFRYHUHGLVRODWHGSLWWLQJLQWKHYHVVHOZDOO0LQLPXPUHTXLUHGZDOO WKLFNQHVVLV´&XUUHQWWKLFNQHVVRIWKHYHVVHOLV´ :KDWLVWKHPLQLPXP DOORZHGUHPDLQLQJWKLFNQHVVDOORZHGDWWKHGHHSHVWSLW" “Minimum allowed remaining thickness below the pit is ½ the required thickness”, Therefore, the minimum thickness allowed at the deepest pit is; ( ½ required thickness = 1.250”/2 = 0.625”) Corrosionallowance Required Thickness Remainingthickness belowpit ½ ofRequired Thickness 49 (YDOXDWLRQRI3LWWLQJ 3UDFWLFH4XHVWLRQ Section7,par 7.4.3 'XULQJDUHFHQWLQWHUQDOLQVSHFWLRQRID´,'YHVVHOZLWK´ZDOOWKLFNQHVVWKUHH LVRODWHGSLWVZHUHGLVFRYHUHG7KHSLWVDUHZLWKLQD´GLDPHWHUFLUFOHZLWKWKHVXPRI WKHLUGLPHQVLRQVDORQJDVWUDLJKWOLQHLV´9HVVHOKDVDUHTXLUHGWKLFNQHVVLV´ DQGFRUURVLRQDOORZDQFHRI´'LPHQVLRQVRIWKHSLWVDUHDVIROORZV 3LW± ´[´[´GHHS 3LW ´[[´GHHS 3LW ´[´[´GHHS :KLFKRIWKHIROORZLQJLVWUXH" a. b. c. d. Pitscanbeignored Pitsareunacceptablebasedonsumofthepitdimensionsalonga8”straightline. Pitsareunacceptableduetototalareaofpittingwithinan8”diametercircle. Pitsareunacceptableduetoinsufficientremainingthicknessbelowthedeepestpit. (YDOXDWLRQRI3LWWLQJ 3UDFWLFH4XHVWLRQ Section7,par 7.4.3 'XULQJDUHFHQWLQWHUQDOLQVSHFWLRQRID´,'YHVVHOZLWK´ZDOOWKLFNQHVVWKUHH LVRODWHGSLWVZHUHGLVFRYHUHG7KHSLWVDUHZLWKLQD´GLDPHWHUFLUFOH/HQJWKRIWKHSLWV GLPHQVLRQVDORQJDVWUDLJKWOLQHLV´´DQG´9HVVHOKDVDUHTXLUHG WKLFNQHVVLV´DQGFRUURVLRQDOORZDQFHRI´&DQWKHVHSLWVEHLJQRUHG",IQRW ZK\QRW"'LPHQVLRQVRIWKHSLWVDUHDVIROORZV 3LW± ´[´[´GHHS 3LW ´[[´GHHS 3LW ´[´[´GHHS HEAD BANGER 3HU$3,ZKDWLVDOWHUDWLRQ" ,VWKHUHSODFHPHQWRIDQH[LVWLQJQR]]OHDQ$/7(5$7,21" ,VWKHLQVWDOODWLRQRIDQHZUHLQIRUFHGQR]]OHOHVVWKDQRUHTXDOVL]HDVDQH[LVWLQJ UHLQIRUFHGQR]]OHDQ$/7(5$7,21" ,VWKHLQVWDOODWLRQRIDQR]]OHZLWKRXWDUHSDG DQ$/7(5$7,21" :KDWLVWKHGHILQLWLRQRID5(3$,5" $3,SDJHVLLLDQG 53 $3,LVUHVWULFWHGWRZKDWNLQGRIHTXLSPHQW" :KDWLQGXVWULHVZDV$3,GHYHORSHGIRU" ,IWKHUHLVDFRQIOLFWEHWZHHQ$60(6HFWLRQ9,,,DQG$3,ZKLFKFRGHVKDOO WDNHSUHFHGHQFH" 3HU$3,DQRZQHUXVHUPXVWHPSOR\RUKDYHDFFHVVWR 54 3HU$3,ZKDWW\SHRIRUJDQL]DWLRQFDQEHDQG $XWKRUL]HG,QVSHFWLRQ$JHQF\" $3,LVUHFRJQL]HGE\$3,WRGRZKDW" $3,LVUHFRJQL]HGE\$3,WRGRZKDW" 55 :KDWLVWKHVFRSHRI$3," :KDWLVWKHVFRSHRI$3," :KDWLVWKHVFRSHRI$3," :KDWLVWKHVFRSHRI$3," :KDWLVWKHVFRSHRI$3," 56 :KDWLVWKHVFRSHRI$60(6HFWLRQ,;" :KDWLVWKHVFRSHRI$60(9" :KDWLVWKHVFRSHRI$60(9,,," :KDWGRHVDS+RILQGLFDWH" pHScale StrongAlkalinity WeakAlkalinity Neutral WeakAcidity StrongAcidity Acidity Basic/Akalinity / Caustic 57 :KDWGRHVDS+RILQGLFDWH" :KDWGRHVDS+RILQGLFDWH" pHScale StrongAlkalinity Neutral WeakAlkalinity WeakAcidity StrongAcidity Acidity Basic/Akalinity / Caustic 58 ,QVSHFWLRQ3ODQV Section5,par 5.1 A. Inspection plan must be established for all pressure vessels and pressure-relieving devices. B. Inspection plan developed by inspector or engineer. C. Corrosion-specialist must be consulted for inspection plan for vessels operating above 750oF. D. Inspection plan shall be evaluated based on present or possible types of damage mechanisms. E. Methods and extent of NDE shall be evaluated to assure they can adequately identify the damage mechanism and severity of damage. 59 ,QVSHFWLRQ3ODQV Section5,par 5.1 F. Examinations must be scheduled at intervals that consider; A. Type of damage B. Rate of damage C. Tolerance of equipment to the damage D. Probability of the NDE methods to detect the damage E. Maximum intervals as defined in API 510 G. Minimum Contents of Inspection Plan A. Type of inspection needed B. Next inspection date for each type inspection (internal, external, etc) C. Describe inspection and NDE techniques D. Describe extent and locations of inspection and NDE E. Describe the cleaning requirements F. Describe the requirements of any needed pressure test G. Describe any required repairs 60 7\SHVRI,QVSHFWLRQ Section5 A. General Inspections should be conducted in accordance with the inspection plan Prior to performing an inspection, the inspector should be familiar with; Thorough understanding of the inspection plan Operating conditions since the last inspection (API 572 par 9.1) Applicable damage mechanisms Prior history New inspection intervals shall be established if operating temp increases, operating pressure increases or process fluid changes. (API 510 par. 6.2.2) 61 7\SHVRI,QVSHFWLRQ % ,QWHUQDO,QVSHFWLRQ Interval is lesser of ½ remaining life or 10 years. If remaining life is LESS than 4 years, interval can be the full remaining life up to max of 2 years. (API 510 par 6.5.1.1). SHALL be conducted by the inspector (API 510 par 5.5.2.1) Primary reason for internal inspection is to find damage that cannot be found by external CML’s (API 510 par 5.5.2.1) Internal inspection performed inside the vessel (API 510 par 5.5.2.1) Internals may need to be removed to facilitate the internal inspection. Likely will not need to remove 100% of the internals. (API 510 par 5.5.2.2) Inspector should consult with Corrosion Specialist to determine if it is necessary to remove any linings and/or deposits (API 510 par 5.5.2.3) Vessels in non-continuous service, the interval is based on number of years of actual service, instead of calendar years, provided the vessel when idled is separated from process stream & not exposed to corrosive streams. 62 7\SHVRI,QVSHFWLRQ $3,SDUSDJH C. On-stream Inspection Interval same as INTERNAL inspection. Should be conducted by either an inspector or examiner. (API 510 par 5.5.3.1) On-stream inspections performed by examiners shall be authorized/approved by the inspector (API 510 par 5.5.3.1) Inside of vessel inspected from outside vessel. (API 510 par 5.5.3.2) 63 7\SHVRI,QVSHFWLRQ $3,SDUSDJH D. External Inspection Performed by inspector or qualified others (qualified with appropriate training). (API 510 par 5.5.4.1.1) Interval is lesser of 5 years or the internal interval. External inspections check; (API 510 par 5.5.4.1.2) Condition of Outside surface of vessel Condition of Insulation system Condition of Coating system Condition of Supports For leaks Hot spots Vibration damage Allowance for expansion Bulging, misalignment, distortion, etc Conditions discovered by others, must be reported to inspector. (API 510 par 5.5.4.1.3) 64 7\SHVRI,QVSHFWLRQ $3,SDUSDJH E. Thickness Inspection Performed by inspector or examiner. (API 510 par 5.5.5.1) No required interval. Inspector should consult with corrosion-specialist when short term corrosion-rate changes significantly. (API 510 par 5.5.5.3) Owner-user is responsible for assuring individuals taking thickness readings are trained and qualified (API 510 par 5.5.5.4) 7\SHVRI,QVSHFWLRQ $3,SDUSDJH F. CUI Inspection Performed by inspector or other qualified personnel (i.e. same as external) Shall be considered for; (API 510 par 5.5.6.1) Carbon steel and low alloy operating between 10oF and 350oF. Stainless steel operating between 140oF and 400oF. Usually causes localized corrosion damage (API 510 par 5.5.6.2) Susceptible locations include; (API 510 par 5.5.6.2) Insulation or stiffening rings Nozzles and manways Structural penetrations (ladder clips, pipe supports, etc) Damage insulation Insulation with failed caulking Top and bottom heads CUI inspection may require some or all insulation (API 510 par 5.5.6.3) Insulation may not need to be removed if; (API 510 par 5.5.6.3) Insulation is in good condition and there is no reason to suspect damage behind the insulation; CUI inspection can be performed with UT from ID of vessel. 66 :HOG-RLQW&DWHJRULHV $60(9,,,8: D E WeldJointCATERGORY isthe”location”ofa“joint”inapressurevessel SubͲSectionB, UW,General, UWͲ3 Category A: Alllongitudinalweldsinshellandnozzles Allweldsinheads,HemiͲheadtoshellweldjoint Category B: Allcircumferentialweldsinshellandnozzles Headtoshelljoint(otherthanHemispherical.) Category C and D are flange welds and nozzle attachment welds respectively Longitudinal welds (Category A) are more critical than Circumferential welds (Category B) because they are under double stress. This the reason why in different part of ASME code we have stringent rules in category A joint compared to category B joint. 67 :HOG-RLQW7\SHV SubͲSectionB, UW,Design, UWͲ12 Weld Joint Types 7\SH± 'RXEOHZHOGHGEXWWMRLQWV 7\SH± 6LQJOHZHOGHGZLWKEDFNLQJ 7\SH 6LQJOHZHOGHGZLWKRXWEDFNLQJ 68 :HOG-RLQW7\SHV SubͲSectionB, UW,Design, UWͲ12 Weld Joint Types 7\SH± 'RXEOH)XOO)LOOHW/DS-RLQW 7\SH± 6LQJOH)XOO)LOOHW/DS-RLQW ZLWKSOXJZHOG 7\SH 6LQJOH)XOO)LOOHW/DS-RLQW ZLWKRXWSOXJZHOG 69 5DGLRJUDSK\ TypeofRadiography SubͲSectionB, UW,Design, UWͲ11 SubͲSectionC, CCS,Design, UCSͲ57 Full– asrequiredbytheCode(seeUWͲ11(a)),andUCS57 Spot– CategoryBandCweldsthatarenotrequiredtobe radiographedbyUWͲ11(a)(5)(b). None CodeRequiredRT(UWͲ11(a)andUWͲ11(b) BasedonService,ThicknessorWeldingProcess UserSpecifiedRT Theusercanestablishthetypeofjointanddegreeofexaminationwhen therulesofCodedoesnotrequireradiography(seeUWͲ12) 70 5DGLRJUDSK\ SubͲSectionB, UW,Design, UWͲ11a FULLRT– RequiredbyCODE FULLRT Allbuttweldsinshell&headsinlethalservice Allbuttweldsinshell&headswiththickness>11/2orperUCSͲ57 Allbuttweldsinshell&headsofunfiredboilerswith; Pressureexceeding50psigorthickness>11/2orperUCS57 Buttweldsinnozzles>10NPSor>11/8”thickness Category“A”and“D”weldsinshellsandheads,wherejoint efficiencyisbasedonTableUWͲ12 ButtweldsmadeusingElectroͲgas&ElectroͲslagprocess SpotRT CategoryBandCbuttweldsintersectingCatAweldsinshellsandheads CategoryBandCbuttweldsconnectingseamlessheadsorshells 127(&DWHJRU\ $ %ZHOGVPXVWEH7\SHRU7\SHZHOGV VHH7DEOH8: 71 5DGLRJUDSK\ When and where is there a code requirement for full radiography? SubͲSectionB, UW,Design, UWͲ11 Item 1: Allbuttweldsinvesselsusedtocontainalethalsubstance(UWͲ11(a)).Lethalsubstanceshavespecific definitionsinASMECodeinUWͲ2anditistheresponsibilityoftheendusertodetermineiftheyordered avesselthatcontainslethalsubstances. Item 2: All butt welds in vessels in which the nominal thickness exceeds specified values (UWͲ11(a). You can find these values in subsection C, in UCSͲ57. For example, this value for PͲNo.1 in UCSͲ57 is 1 ¼ inch. Nozzles larger than 10 NPS or thickness greater than 1 1/8”. SubͲSectionC, Item 3: All butt welds in an unfired steam boiler with design pressure > 50 psi (UWͲ11(a)). UCS,Design, UCSͲ57 Item 4: All category A and D butt welds in vessel when “Full Radiography” optionally selected from table UWͲ 12(column (a) in this table is selected); and categories B and C which intersect Category A shall meet the spot radiography requirement (UWͲ11(a) (5) (b)). The point is this: items 1, 2 and 3 are similar, but item 4 is completely different. In items 1, 2 and 3 it is mandated by code; to do full radiography in all butt welds in vessel so it means it is mandatory for designer to select column (a) in UWͲ12 table. But in item 4, there is no mandating rule. A manufacturer with its own decision has chosen to use column (a) in table UWͲ12 for full radiography. 72 5DGLRJUDSK\ $60(6HF9,,,8: 7KHUH LV D FRQFHVVLRQ RU ERQXV WR PDQXIDFWXUHUV IRU FDWHJRULHV % DQG & :KDW LV FRQFHSW EHKLQG WKLV FRQFHVVLRQ RU ERQXV LQ SUHVVXUH YHVVHO 57 WHVW" a. Items 1, 2 and 3 from the previous slide; RT is related to the type of welds and services. b. Pressure vessels in these items are critical from a safety point of view, one contains a lethal substance, the other one has a high thickness, which implicates high pressure, and the last one is an unfired steam boiler c. Item 4 has no criticality like the other items have. d. But you should note all 4 items have been categorized in full radiography clause( UͲ11(a)), so to differentiate item 1, 2 and 3 from item 4, the RT symbols are used in Code (UGͲ116). 73 5DGLRJUDSK\ SubͲSection A,UG,Design, UGͲ116 RT1: Items1,2and3,(E=1),AllbuttweldsͲfulllengthradiography RT2: Item4(E=1),CategoryAandDbuttweldsfulllengthradiography andcategoryBandCbuttweldsspotRadiography RT3: (E=0.85),Spotradiographybuttwelds RT4: (E=0.7),Partial/Noradiography You need to consider the hemispherical head joint to shell as category A, but ellipsoidal and torispherical head joint to shell as category B; Do you know why? Why ASME considered the stringent rule for pressure vessel RT test in hemispherical head joint? It is because this joint is more critical, because the thickness obtained from the formula for hemispherical head approximately would be half of the shell thickness; It means if the shell thickness is 1 inch, the hemispherical head thickness would be 0.5 inch. 74 5DGLRJUDSK\ SubͲSectionB, UW,Design, UWͲ11 SpotRT– RequiredbyCODE B and C welds that are not required to be radiographed by UW11(a)(5)(b) Type 1 and Type 2 butt welds that are not required to be radiographed by UW-11(a). RTMarkings RT 1 and RT 2 - FULL Radiography RT 3 - Spot Radiography RT 4 - Combo Radiography SubͲSection A,UG,Design, UGͲ116 RTmarkingsarelocatedonNameplate 75 HEAD BANGER :KDWLVWKHPD[LPXPUDQJHIRUDSUHVVXUHJDXJHGXULQJD SUHVVXUHWHVW" :KDWLVWKHPD[LPXPOHQJWKRIDFUDFN,3RU,QFRPSOHWHIXVLRQ WKDWLVDOORZHGLQZHOGVIRUDQHZYHVVHO" :KDWLVWKHUHTXLUHGVPRRWKQHVVIRUWKHVHDWLQJVXUIDFHRIDUHOLHI GHYLFH" :KDWLVWKHPD[LPXPPLOOWROHUDQFHIRUIODWSODWH" :KDWLVWKHPD[LPXPDOORZHGVL]HRIRSHQGLVFRQWLQXLWLHVLQDEHQG WHVWVSHFLPHQ" :KDWLVWKHPLQLPXPGLVWDQFHEH\RQGWKHDUHDWREHH[DPLQHG WKDWPXVWEHFOHDQHGZKHQSHUIRUPLQJD07H[DPLQDWLRQ" :KDWLVWKHPLQLPXPGLVWDQFHEH\RQGWKHDUHDWREHH[DPLQHG WKDWPXVWEHFOHDQHGZKHQSHUIRUPLQJD37H[DPLQDWLRQ" :KDWLVWKHPLQLPXPUDGLXVRIDQLQVHUWSDWFK" $WZKDWWKLFNQHVVGRHVFDUERQVWHHOUHTXLUH3:+7" $WZKDWWKLFNQHVVRIYHVVHOVKHOOLV57UHTXLUHG" :KDWLVWKHPD[LPXPOHQJWKRISLWVDOORZHGLQDVWUDLJKWOLQH" +RZIDUEH\RQGWKHZHOGPXVWWKHSUHKHDWWHPSHUDWXUHEH PDLQWDLQHGZKHQSHUIRUPLQJSUHKHDWLQOLHXRI3:+7" :KDWLVWKHPLQLPXPVL]HRIDVSRWUDGLRJUDSK" :KDWLVWKHPLQLPXPOHQJWKRIUDGLRJUDSKZKHQTXDOLI\LQJD ZHOGHU" :KDWLVWKHPLQLPXPOHQJWKRIUDGLRJUDSKZKHQTXDOLI\LQJD ZHOGLQJRSHUDWRUZLWKDWHVWFRXSRQ" :KDWYHVVHOLQVLGHGLDPHWHULVH[FOXGHGIURP$60(6HFWLRQ9,,," :KDWLVWKHUHFRPPHQGHGGHSWKWRGLJDWVRLOWRDLULQWHUIDFHV" :KDWLVWKHPD[LPXPDUHDRISLWVDOORZHGLQDQGLDPHWHU FLUFOH" -RLQW(IILFLHQF\ SubͲSectionB, UW,Design, TableUWͲ12 Joint Efficiency is based on; :HOG-RLQW7\SH 7\SHV :HOG&DWHJRU\ $%&'EXWPDLQO\RQ$ % 5DGLRJUDSK\ 575757DQG57 9HVVHOVZLWKORQJLWXGLQDOVHDPVRUVHDPOHVV 80 5DGLRJUDSK\ -RLQW(IILFLHQF\ SubͲSection A,UG,Design, UGͲ116 RTͲ1 E=1 RTͲ2 E=1 E=1 RTͲ3 E=0.85 RTͲ4 E=0.70 E=1 E=0.85 81 -RLQW(IILFLHQF\ JointEfficiencybasedonRadiography RTͲ1– FullRTperUWͲ11(a),exceptUW(a)(5) UseColumn“a”ofTableUWͲ12 ForSeamlessheads&shellsE=1 SubͲSection A,UG,Design, UGͲ116 SubͲSectionB, UW,Design, TableUWͲ12 RTͲ2Ͳ FullRTperUWͲ11(a)(5) UseColumn“a”ofTableUWͲ12 ForseamlessheadsandshellsE=1 RTͲ3Ͳ SpotradiographyperUWͲ11(b) UseColumn“b”ofTableUWͲ12 Forseamlessheads&shellsE=1 RTͲ4Ͳ CombinationofRTͲ1,RTͲ2andRTͲ3 NoRTͲ noradiographyatall UseColumn“c”ofTableUWͲ12 ForseamlessshellsandheadsE=0.85 RTStamping 82 $60(6HF9,,,8: -RLQW(IILFLHQF\ RT1 or RT2 RT3 RT4 SubͲSectionB, UW,Design, TableUWͲ12 NOTE:ForWeldtypes3,4,5,and6,RTcannotbeusedtoincreasethejointefficiency. 83 -RLQW(IILFLHQF\ Joint Efficiency For Seamless Parts WeldType Spot RT NoRT 1 1.0 0.85 2 1.0 0.85 3 0.85 0.85 4 0.85 0.85 5 0.85 0.85 6 0.85 0.85 SubͲSectionB, UW,Design, ParUWͲ 11(a)(5)(a)&(b) SubͲSectionB, UW,Design,Par UWͲ12d 84 -RLQW(IILFLHQF\ $60(6HF9,,,8: G 3UDFWLFH4XHVWLRQ ApressurevesselshellwithTYPE1longitudinalseamsandcircumferentialweldsthat aresinglefullfilletlapjointswithoutplugwelds.ThevesselisstampedNoRT.What isthejointefficiencyfor; Vessel shell ? A seamless head _________? SubͲSectionB,UW, Design,ParUWͲ 11(a)(5)(a)&(b)and TableUWͲ12 SubͲSectionB, UW,Design,Par UWͲ12d 85 -RLQW(IILFLHQF\ $60(6HF9,,,8: G 3UDFWLFH4XHVWLRQ $SUHVVXUHYHVVHOZLWKEXWWZHOGVWKDWDUHGRXEOHZHOGHG7KHYHVVHOLVVWDPSHG 57:KDWLVWKHMRLQWHIILFLHQF\IRU $ZHOGHGVKHOOBBBBBBBBBB" $VHDPOHVVKHDGBBBBBBBBB" SubͲSectionB,UW, Design,ParUWͲ 11(a)(5)(a)&(b)and TableUWͲ12 SubͲSectionB, UW,Design,Par UWͲ12d 86 -RLQW(IILFLHQF\ $60(6HF9,,,8: G 3UDFWLFH4XHVWLRQ $SUHVVXUHYHVVHOZLWKEXWWZHOGVWKDWDUHGRXEOHZHOGHG7KHYHVVHOLVVWDPSHG 57:KDWLVWKHMRLQWHIILFLHQF\IRU $ZHOGHGVKHOOBBBBBBBBBB" $VHDPOHVVKHDGBBBBBBBBB" SubͲSectionB,UW, Design,ParUWͲ 11(a)(5)(a)&(b)and TableUWͲ12 SubͲSectionB, UW,Design,Par UWͲ12d 87 -RLQW(IILFLHQF\ $60(6HF9,,,8: G 3UDFWLFH4XHVWLRQ $SUHVVXUHYHVVHOZLWKEXWWZHOGVWKDWDUHGRXEOHZHOGHG7KHYHVVHOLVVWDPSHG 57:KDWLVWKHMRLQWHIILFLHQF\IRU $ZHOGHGVKHOOBBBBBBBBBB" $VHDPOHVVKHDGBBBBBBBBB" SubͲSectionB,UW, Design,ParUWͲ 11(a)(5)(a)&(b)and TableUWͲ12 SubͲSectionB, UW,Design,Par UWͲ12d 88 -RLQW(IILFLHQF\ $60(6HF9,,,8: G 3UDFWLFH4XHVWLRQ $SUHVVXUHYHVVHOZLWKGoublefullfilletlapjointweOGV $ZHOGHGVKHOOBBBBBBBBBB" $VHDPOHVVKHDGBBBBBBBBB" SubͲSectionB,UW, Design,ParUWͲ 11(a)(5)(a)&(b)and TableUWͲ12 SubͲSectionB, UW,Design,Par UWͲ12d 89 -RLQW(IILFLHQF\ $60(6HF9,,,8: G 3UDFWLFH4XHVWLRQ $SUHVVXUHYHVVHOZLWKEXWWZHOGVZKLFKDUHVLQJOHZHOGHGZLWKEDFNLQJVWULSV 9HVVHOLVVWDPSHG57 $ZHOGHGVKHOOBBBBBBBBBB" $VHDPOHVVKHDGBBBBBBBBB" SubͲSectionB,UW, Design,ParUWͲ 11(a)(5)(a)&(b)and TableUWͲ12 SubͲSectionB, UW,Design,Par UWͲ12d 90 /HVVRQ3ODQ,, (Calculations– StaticHead,InternalandExternalPressure) 1 /HVVRQ3ODQ,, (Calculations– StaticHeadandInternalPressure , 6WDWLF+HDG 7KHLQVSHFWRUPXVWEHDEOHWRFRPSHQVDWHIRUWKHSUHVVXUHUHVXOWLQJIURPVWDWLFKHDG$OOVWDWLFKHDGZLOOEHEDVHGXSRQD6SHFLILF*UDYLW\RI7KHLQVSHFWRU VKRXOGEHDEOHWR D /LVWWKHVWDWLFKHDGSUHVVXUHFRQYHUVLRQIDFWRU SVLIW E .QRZWKHGLIIHUHQFHEHWZHHQYHVVHO0$:3 DQGYHVVHOSDUW0$:3 8* F &DOFXODWHVWDWLFKHDGSUHVVXUHRQDQ\YHVVHOSDUW G &DOFXODWHWRWDOSUHVVXUH 0$:3 VWDWLFKHDG RQDQ\YHVVHOSDUW H &DOFXODWHPD[LPXPYHVVHO0$:3 JLYHQYHVVHOSDUWV0$:3 DQGHOHYDWLRQV 6WDWLFKHDGFDOFXODWLRQVPD\DOVREHUHTXLUHGGXULQJWKHLQWHUQDOSUHVVXUHFDOFXODWLRQVLIVWDWLFKHDGGDWDLVJLYHQLQWKHH[DPLQDWLRQSUREOHP ,, ,17(51$/35(6685( 7KHLQVSHFWRUVKRXOGEHDEOHWRGHWHUPLQH D 7KHUHTXLUHGWKLFNQHVVRIDF\OLQGULFDOVKHOOEDVHGRQFLUFXPIHUHQWLDOVWUHVVJLYHQDSUHVVXUH 8* F E 7KHUHTXLUHGWKLFNQHVVRIDVSKHULFDOVKHOOEDVHGRQFLUFXPIHUHQWLDOVWUHVVJLYHQDSUHVVXUH 8* G F 7KHYHVVHOSDUW0$:3 IRUDF\OLQGULFDOVKHOOEDVHGRQFLUFXPIHUHQWLDOVWUHVVJLYHQDPHWDOWKLFNQHVV 8* F G 7KHUHTXLUHGWKLFNQHVVRIDKHDG HOOLSVRLGDODQGKHPLVSKHULFDO JLYHQDSUHVVXUH 8* G DQG I H 7KHYHVVHOSDUW0$:3 IRUDKHDG HOOLSVRLGDODQGKHPLVSKHULFDO JLYHQDPHWDOWKLFNQHVV 8* G DQG I I :KHWKHUDKHDG HOOLSVRLGDORUKHPLVSKHULFDO PHHWV&RGHUHTXLUHPHQWVJLYHQERWKSUHVVXUHDQGPHWDOWKLFNQHVV J 8* G DQG J 7KHLQVSHFWRUVKRXOGDOVREHDEOHWRFRPSHQVDWHIRUWKHFRUURVLRQDOORZDQFHDGGRUVXEWUDFWEDVHGRQUHTXLUHPHQWVRIWKHH[DPLQDWLRQSUREOHP7KH 6HFWLRQ9,,,$SSHQGL[ IRUPXODIRUF\OLQGHUVZKLFKLVEDVHGRQRXWVLGHGLDPHWHUFDQEHXVHG7KH$SSHQGL[IRUPXODVIRUQRQVWDQGDUGKHDGVZLOO 2 QRWEHUHTXLUHG /HVVRQ3ODQ,, (Calculations– StaticHeadandInternalPressure ,,, (;7(51$/35(6685( 7KHLQVSHFWRUVKRXOGEHDEOHWR D &DOFXODWHWKHPD[LPXPDOORZDEOHH[WHUQDOSUHVVXUHDQG E &DOFXODWHZKHWKHUDF\OLQGULFDOVKHOORUWXEHPHHWV&RGHGHVLJQIRUH[WHUQDOSUHVVXUHJLYHQDZDOOWKLFNQHVVDQGDSUHVVXUH 8* F 1RWH)DFWRUVIURPWKHH[WHUQDOSUHVVXUHFKDUWVZLOOEHJLYHQLQWKHZRUGLQJRIWKHTXHVWLRQ8VHRIWKHDFWXDOFKDUWVLVQRWUHTXLUHG 3 6WDWLF+HDG ASMESecVIII,UGͲ98 , 6WDWLF+HDG D 6WDWLFKHDGSUHVVXUHFRQYHUVLRQIDFWRU SVLIW E .QRZWKHGLIIHUHQFHEHWZHHQYHVVHO0$:3DQGYHVVHOSDUW 0$:3 8* F &DOFXODWHVWDWLFKHDGSUHVVXUHRQDQ\YHVVHOSDUW G &DOFXODWHWRWDOSUHVVXUH 0$:3VWDWLFKHDG RQDQ\YHVVHO SDUW H &DOFXODWHPD[LPXPYHVVHO0$:3JLYHQYHVVHOSDUWV0$:3 DQGHOHYDWLRQV 127(6WDWLFKHDGFDOFXODWLRQVPD\DOVREHUHTXLUHGGXULQJWKHLQWHUQDOSUHVVXUHFDOFXODWLRQV LIVWDWLFKHDGGDWDLVJLYHQLQWKHH[DPLQDWLRQSUREOHP 4 6WDWLF+HDG ASMESectionVIII SubsectionA,UG, InspectionandTesting, UGͲ98(a)(b) , 6WDWLF+HDG D 6WDWLF+HDG IRRWFROXPQRIZDWHULVHTXDOWRSVLDWWKHERWWRPRI WKHFROXPQ RIZDWHU,QRWKHUZRUGVWKHZHLJKWRIWKHZDWHU DSSOLHVDIRUFH OEV SUHVVXUH SVL 1ft 0.433psi (atbottomofthewatercolumn) 5 6WDWLF+HDG , 3DUW6WDWLF+HDG ASMESectionVIII SubsectionA,UG, InspectionandTesting, UGͲ98(a)(b) ASMESecVIII,UGͲ98 2ft WhatisMAWPofeachcomponentfora48ft tall verticalvesselwithellipsoidalheadsandaMAWP of500psig? N1 6 ft 44ft 8ft 36ft VesselMAWP=500psig VesselMAWPisthegagepressureatthe“TOP”of thevessel,includingStaticheadpressure.Reference UGͲ98(a)(b) N2 2ft 6 ft MAWPofN1=________ MAWPofN2=_________ MAWPofTophead=_________ MAWPofBtm head=_________ MAWPoftheshell=_________ 6 6WDWLF+HDG , 3DUW6WDWLF+HDG ASMESectionVIII SubsectionA,UG, InspectionandTesting, UGͲ98(a)(b) ASMESecVIII,UGͲ98 2ft WhatisMAWPofeachcomponentfora48ft tall verticalvesselwithellipsoidalheadsandaMAWP of500psig? N1 6 ft 44ft 8ft 36ft VesselMAWP=500psig VesselMAWPisthegagepressureatthe“TOP”of thevessel,includingStaticheadpressure.Reference UGͲ98(a)(b) N2 2ft 6 ft 500psig+(6x0.433)=500+2.6=502.60psig MAWPofN1=________ 500psig+(42x0.433)=500+18.19=518.19psig MAWPofN2=_________ 500psig+(2x0.433)=500+0.87=500.87psig MAWPofTophead=_________ 500psig+(48x0.433)=500+20.78=520.78psig MAWPofBtm head=_________ 500psig+(46x0.433)=500+19.92=519.92psig MAWPoftheshell=_________ 7 ASMESectionVIII SubsectionA,UG, InspectionandTesting, UGͲ98(a)(b) ASMESecVIII,UGͲ98 6WDWLF+HDG , 3DUW6WDWLF+HDG WhatisMAWPofthisvessel? Part Part MAWP Top head 510psig N1 500psig N2 495psig Shell 510psig Btm Head 507psig Static Head 0ft 2ft Pressureat Topof Vessel N1 8ft 10ft N2 42ft 48ft 50ft 8 9HVVHO0$:3YV 3DUW0$:3 ASMESectionVIII SubsectionA,UG, InspectionandTesting, UGͲ98(a)(b) , 9HVVHO 3DUW0$:3 PracticeQuestion#1 Ifthisvesselisbeinghydrostaticallytestedat200 psig,whatisthepressureatthebottomofthe vessel? 2ft 6 ft N1 66ft 8ft PracticeQuestion#2 IftheMAWPofthevesselis550psig,whatisthe MAWPofN2? 58ft N2 6 ft 2ft PracticeQuestion#3 IftheMAWPoftheshellofthevesselis564psig, whatistheMAWPofN1? Usethisvesseltoanswer thesepracticequestions 9 7RWDO3UHVVXUH ASMESectionVIII SubsectionA,UG, InspectionandTesting, UGͲ98(a)(b) , 7RWDO3UHVVXUH PracticeQuestion#4 2ft Ifavesselisbeinghydrostaticallytestedat400 psig,whatisthepressureatN2? 6 ft N1 66ft 8ft PracticeQuestion#5 58ft N2 Duringahydrotest ofavessel,ifthepressureatthe bottomofthevesselis635psig,whatisthe 2ft pressureatN1? 6 ft PracticeQuestion#6 Duringahydrotest ofavessel,ifthepressureatN2 is528psig,whatisthepressureatthetopofthe vessel? Usethisvesseltoanswer thesepracticequestions 10 NOTE:PerASMESectionVIII,UGͲ99(c.),thehydrotest pressureisthepressureatthetopofthevessel. ,QWHUQDO3UHVVXUH ASMESecVIII,UGͲ21andAppendix3(par3Ͳ2) ASMESectionVIII SubsectionA,UG, InspectionandTesting, UGͲ98(a)(b) , 'HVLJQ3UHVVXUH Designpressureisthepressureusedinthedesignofavesselcomponent togetherwithcoincidenttemperatureforthepurposeofdeterminingthe minimumpermissiblethicknessforeachcomponent.Designpressure includesstaticheadpressure. NOTE:Designpressureistheminimumpressureusedtodesignthevessel(i.e.usedtodeterminethe“required thickness”ofeachcomponent. ,, 0$:3 Maximumallowableworkingpressure(MAWP)isthemaximumpressure permissibleatthetopofthevesselinitsnormaloperatingposition.MAWPis adjustedforthedifferenceinstaticheadthatmayexistbetweenforthepart consideredandthetopofthevessel. ,,, 'HVLJQ3UHVVXUHYV 0$:3 Designpressureisthepressurefortheprocess(processpressureplus statichead).MAWPisthemaximumpressureratingforeachpart and/orvessel. 11 6KHOO0LQLPXP5HTXLUHG7KLFNQHVV ASMESecVIII,UGͲ27(c.)(1) , 7KHUHTXLUHGWKLFNQHVVRIDF\OLQGULFDOVKHOO EDVHGRQFLUFXPIHUHQWLDOVWUHVVJLYHQD SUHVVXUH 8* F Variables t=PR/(SE)Ͳ(0.6P) ASMESectionVIII SubsectionA,UG, Design,UGͲ27(c.)(1) t=requiredthickness inches P=DesignPressure psi R=InsideRadius ofshell inches S=AllowableStress psi E=JointEfficiency 12 6KHOO0LQLPXP5HTXLUHG7KLFNQHVV PracticeQuestion#7 ASMESectionVIII SubsectionA,UG, Design,UGͲ27(c.)(1) A60’tallverticalvesselhasaninsidediameterof8’anddesignedfor300psig@450deg F.Allowablestressofthematerialofconstructionis17,500psiandthejointefficiencyis 0.85.Whatistheminimumrequiredthickness? 13 6KHOO0LQLPXP5HTXLUHG7KLFNQHVV ASMESectionVIII SubsectionA,UG, Design,UGͲ27(c.)(1) PracticeQuestion#7 A60’tallverticalvesselhasaninsidediameterof8’anddesignedfor300psig@450deg F.Allowablestressofthematerialofconstructionis17,500psiandthejointefficiencyis 0.85.Whatistheminimumrequiredthickness? t PR = (SE)Ͳ(0.6P) t 300 = ( t 17500 x ( = 48 ) Ͳ ( 14400 = t 0.85 x 14875 ) 14400 Ͳ ( 180 ) 0.6 x 300 ) Variables t=requiredthickness inches P=DesignPressure psi R=InsideRadius ofshell inches S=AllowableStress psi E=JointEfficiency 14695 t = 0.980 inches 14 6KHOO0LQLPXP5HTXLUHG7KLFNQHVV PracticeQuestion#8 ASMESectionVIII SubsectionA,UG, Design,UGͲ27(c.)(1) Avesselhasaninsidediameterof60”anddesignedfor150psig@350deg F. Allowablestressofthematerialofconstructionis18,000psiandthejoint efficiencyis1.0Whatistheminimumrequiredthickness? 15 6KHOO0LQLPXP5HTXLUHG7KLFNQHVV PracticeQuestion#9 ASMESectionVIII SubsectionA,UG, Design,UGͲ27(c.)(1) Avesselhasaninsideradiusof48”anddesignedfor250psig@500deg F. Allowablestressofthematerialofconstructionis17,000psiandthejoint efficiencyis.90Whatistheminimumrequiredthickness? 16 6SKHUH0LQLPXP5HTXLUHG7KLFNQHVV ASMESectionVIII SubsectionA,UG, Design,UGͲ27(d) , 7KHUHTXLUHGWKLFNQHVVRID6SKHUHLVJLYHQE\ 8* G PR t = (2SE)Ͳ(0.2P) Variables inches t=requiredthickness P=DesignPressure psi R=InsideRadius ofshell inches psi S=AllowableStress E=JointEfficiency 17 6SKHUH0LQLPXP5HTXLUHG7KLFNQHVV PracticeQuestion#10 ASMESectionVIII SubsectionA,UG, Design,UGͲ27(d) Aspherehasaninsideradiusof12ft anddesignedfor250psig@500deg F. Allowablestressofthematerialofconstructionis17,000psiandtheweldsare singlebuttweldedwithbackingandvesselisstampedRTͲ2.Whatisthe minimumrequiredthickness? 18 6SKHUH0LQLPXP5HTXLUHG7KLFNQHVV PracticeQuestion#11 ASMESectionVIII SubsectionA,UG, Design,UGͲ27(d) AspherehasanIDof36ft anddesignedfor30psig@400deg F.Allowable stressofthematerialofconstructionis15,000psiandthejointefficiencyis0.80 Whatistheminimumrequiredthickness? 19 9HVVHO+HDGV h=1/4D ASMESectionVIII SubsectionA,UG, Design,UGͲ32(d) D=Insidediameter LongAxis Ellipsoidalheadsareknownas2to1heads.2to1comes fromthefactthatanellipsoidalheadis1/2ofaellipse.An ellipsehasalongaxisthatis2xtheshortaxis. L=insideradius Short Axis ASMESectionVIII SubsectionA,UG, Design,UGͲ32(f) D=Insidediameter 20 +HDGV0LQLPXP5HTXLUHG7KLFNQHVV MinimumRequiredThicknessofanEllipsoidalHead t = Px D 2 [( S x E ) Ͳ ( 0.2 X P )] t=minimumrequiredthickness P=DesignPressure D=InsideDiameter S=AllowableStress E=JointEfficiency MinimumRequiredThicknessofaHemisphericalHead t = P x L 2 [( S x E ) Ͳ ( 0.2 X P )] ASMESectionVIII SubsectionA,UG, Design,UGͲ32(d) ASMESectionVIII SubsectionA,UG, Design,UGͲ32(f) t=minimumrequiredthickness P=DesignPressure L=InsideRadius S=AllowableStress E=JointEfficiency 21 +HDGV0LQLPXP5HTXLUHG7KLFNQHVV PracticeQuestion#12 ASMESectionVIII SubsectionA,UG, Design,UGͲ32(d) Whatistheminimumrequiredthicknessfortheheadofa30’tallverticalvessel withellipsoidalheads,insidediameterof72”,allowablestressof16,500psi, MAWPof120psig,andweldsthataredoubleͲweldedbuttweldsandSpotRT’d? 22 +HDGV0LQLPXP5HTXLUHG7KLFNQHVV PracticeQuestion#13 ASMESectionVIII SubsectionA,UG, Design,UGͲ32(d) Whatistheminimumrequiredthicknessfortheheadofaseamlesshorizontalvessel withellipsoidalheads,insidediameterof96”,allowablestressof18,000psi,MAWP of200psig,andweldsthataredoubleͲfullfilletweldedlapjointsandRTͲ1? 23 +HDGV0LQLPXP5HTXLUHG7KLFNQHVV PracticeQuestion#14 ASMESectionVIII SubsectionA,UG, Design,UGͲ32(f) Whatistheminimumrequiredthicknessfortheheadofa30’tallverticalvessel withhemisphericalheads,insidediameterof72”,allowablestressof16,500psi, MAWPof320psig,andweldsthataredoubleͲweldedbuttweldsandSpotRT’d? 24 +HDGV0LQLPXP5HTXLUHG7KLFNQHVV PracticeQuestion#15 ASMESectionVIII SubsectionA,UG, Design,UGͲ32(f) Whatistheminimumrequiredthicknessfortheheadsofahorizontalvesselwith hemisphericalheads,insidediameterof96”,allowablestressof18,000psi,MAWPof 200psig,andweldsthataredoubleͲfullfilletweldedlapjointsandRTͲ1? 25 HEAD BANGER :KDWLVWKHPD[LPXPGLVWDQFHRQDZHOGEHWZHHQZHOGHU VVWDPS" :KDWLVWKHPLQLPXPOHQJWKRIDUDGLRJUDSKZKHQTXDOLI\LQJD ZHOGLQJRSHUDWRUZLWKDSURGXFWLRQZHOG" :KDWLVWKHPLQLPXPRYHUODSIRU3:+7ZKHQXVLQJPXOWLSOH IXUQDFHKHDWV" :KHQ632757LVEHLQJSHUIRUPHGZKDWLVWKHPD[LPXPOHQJWK RIZHOGUHSUHVHQWHGE\VSRWUDGLRJUDSKRIDYHVVHOZHOG" :KDWLVWKHPLQLPXPDOORZHGZDOOWKLFNQHVVDWDSLW" :KDWLVWKHPLQLPXPWLPHDQH[DPLQHUVKRXOGEHLQDGDUNHQHG DUHDSULRUWRXVLQJDEODFNOLJKWWRSHUIRUPD07RU37 H[DPLQDWLRQ" :KDWLVWKHWLPHUDQJHIRULQWHUSUHWLQJDOLTXLGSHQHWUDQWH[DPLQDWLRQ DIWHUDSSOLFDWLRQRIWKHGHYHORSHU" :KDWLVWKHPD[LPXPLQWHUYDOIRUFKHFNLQJWKHOLJKWLQWHQVLW\RI DEODFNOLJKW" :KDWLVWKHPLQLPXPWLPHWRZDLWIRUFKHFNLQJIRUGHOD\HG FUDFNLQJDIWHUZHOGLQJVWDLQOHVVVWHHOFODGGLQJ" :KDWLVWKHPD[LPXPLQWHUYDOWRFKHFNWKHVWUHQJWKRIDPDJQHWLF \RNHWKDWXVHVDSHUPDQHQWPDJQHW" :KDWLVWKHPD[LPXPLQWHUYDOIRUFDOLEUDWLQJDGHQVLWRPHWHU" :KDWLVWKHOHQJWKRIWLPHWKDWFDXVHVDZHOGHUFHUWLILFDWLRQWR H[SLUHLIWKHSURFHVVLVQRWXVHG" 0$:3IRU+HDGV ASMESectionVIII SubsectionA,UG, Design,UGͲ32(d) I. MAWPofEllipsoidalHeads 2 SEt P = ( D + 0.2t) t=minimumrequiredthickness D=InsideDiameter S=AllowableStress E=JointEfficiency II. MAWPofHemisphericalHeads 2Set P = ( L + 0.2t) ASMESectionVIII SubsectionA,UG, Design,UGͲ32(f) t=minimumrequiredthickness L=InsideRadius S=AllowableStress E=JointEfficiency 29 0$:3 PracticeQuestion#16 ASMESectionVIII SubsectionA,UG, Design,UGͲ32(d) Duringaninspectionofaverticalvesselthicknessmeasurementstakenonthebottomellipsoidal headwasfoundtobe0.785.Theinsidediameterofthevesselis96”,allowablestressis17,000 psi,andweldsthataredoubleweldedbuttweldjointsandthevesselisstampedRTͲ1.Whatis themaximumallowableworkingpressureforthisseamlessellipsoidalhead? 30 0$:3 ASMESectionVIII SubsectionA,UG, Design,UGͲ32(d) PracticeQuestion#16 Duringaninspectionofaverticalvesselthicknessmeasurementstakenonthebottomellipsoidal headwasfoundtobe0.785.Theinsidediameterofthevesselis96”,allowablestressis17,000 psi,andweldsthataredoubleweldedbuttweldjointsandthevesselisstampedRTͲ1.Whatis themaximumallowableworkingpressureforthisseamlessellipsoidalhead? P = P = P = 2 SEt ( D + 0.2t) 2 ( 17000 x 1 x 0.785 ) ( 96 + ( 0.2 x 0.79 ) t=0.785” D=96” S=17,000 E=1 2 x 13345 96 + 0.157 P = 26690 96.157 P = 277.57 Note: Readthequestionclosely,inthisquestionthereisnomention ifthevesselhaslongseamsornot.Therefore,assumethevessel haslongseams.YougotoTableUWͲ12andfindthejointefficiency tobe“1”for“doubleͲweldedbuttwelds”.The“seamless”head, doesnotchangethejointefficiency. 31 0$:3 PracticeQuestion#17 ASMESectionVIII SubsectionA,UG, Design,UGͲ32(f) Ahorizontalvesselwithanoutsidediameterof72”andellipsoidalheads.Shellthicknessis 0.750”andtheheadsare0.500”thick. Theallowablestressis16,000psi.Weldsaredoublefull filletlapjointsandthevesselisstampedRTͲ1.Thecorrosionallowancefortheentirevesselis 0.125”.Whatisthemaximumallowableworkingpressurefortheellipsoidalhead? 32 0$:3 PracticeQuestion#18 ASMESectionVIII SubsectionA,UG, Design,UGͲ32(f) Duringaninspectionofaverticalvesselthicknessmeasurementstakenonthebottom hemisphericalheadwasfoundtobe0.785.Theinsidediameterofthevesselis96”,allowable stressis17,000psi,andweldsthataredoubleweldedbuttweldjointsandthevesselisstamped RTͲ1.Whatisthemaximumallowableworkingpressureforthishemisphericalhead? 33 0$:3 PracticeQuestion#19 ASMESectionVIII SubsectionA,UG, Design,UGͲ32(f) Ahorizontalvesselwithanoutsidediameterof72”andhemisphericalheads.Shellthicknessis 0.750”andtheheadsare0.500”thick. Theallowablestressis16,000psi.Weldsaredoublefull filletlapjointsandthevesselisstampedRTͲ1.Thecorrosionallowancefortheentirevesselis 0.125”.WhatisthemaximumallowableworkingpressurefortheHemisphericalhead? 34 0$:3 9HVVHOLQ&RUURVLYH6HUYLFH PracticeQuestion#20 ASMESectionVIII SubsectionA,UG, Design,UGͲ27(c.)(1) API510,Section7,SubͲ par7.3.3 Duringarecentinspectionofahorizontalvesselwithaninsidediameterof72” andhemisphericalheads,shellthicknesswasrecordedas0.625”.Theallowable stressis16,000psi.Weldsaredoublefullfilletlapjointsandthevesselis stampedRTͲ1.ThecorrosionͲrateis0.006”/yr.Requiredthicknessis0.588”. Vesselisincorrosiveservice.Nextinspectionisin5years.Whatisthe maximumallowableworkingpressureforthisvessel? 35 ([WHUQDO3UHVVXUH ASMESectionVIII SubsectionA,UG, Design,UGͲ28(c.) Therearethreefactorsthatcaneffecttheresistanceof crushingdueexternalpressure. 1. Stiffeners 2. Thickness– thickermaterialsresistcrushing 3. Diameter– increasingdiameter,increasessusceptibilityofcrushing 36 ([WHUQDO3UHVVXUH&DOFXODWLRQV I. Formulaandvariables Pa = 4B [ 3 ( Do / ASMESectionVIII SubsectionA,UG, Design,UGͲ28(c.) t )] A=FactorbasedonratioofL/DoandDo/t.(GetitfromASMESecII,PartD,FigG.) B=Factorbasedon“A”FactoranddesignTemperature(GetiffromASMESecII, PartD,TablesCSͲ1orCSͲ2) Do =OutsideDiameter t=Minimumrequiredthickness “B”factorwillbegiventoyouinthequestion. 37 ([WHUQDO3UHVVXUH&DOFXODWLRQV PracticeQuestion#21 ASMESectionVIII SubsectionA,UG, Design,UGͲ28(c.) Ahorizontalvesselhasanoutsidediameterof60”.Thedistancebetween supportsis15’ft.Thewallthicknessis0.625”.MaterialofconstructionisSAͲ 516Gr70.Thisvesselhasa“B”factorof3500andisdesignedfor250psig@ 500deg F.Allowablestressis16,500.Whatisthemaximumexternalpressure forthisvessel? 38 ([WHUQDO3UHVVXUH&DOFXODWLRQV ASMESectionVIII SubsectionA,UG, Design,UGͲ28(c.) PracticeQuestion#21 Ahorizontalvesselhasanoutsidediameterof60”.Thedistancebetween supportsis15’ft.Thewallthicknessis0.625”.MaterialofconstructionisSAͲ 516Gr70.Thisvesselhasa“B”factorof3500andisdesignedfor250psig@ 500deg F.Allowablestressis16,500.Whatisthemaximumexternalpressure forthisvessel? Pa = Pa = 4B [ 3 ( Do / t )] 4 x 3500 60 / [ 3x ( B=3500 Do =60” t=0.625 0.625 ) ] 14000 Pa = Pa = 3x ( 96 48.611 psi ) 39 ([WHUQDO3UHVVXUH&DOFXODWLRQV PracticeQuestion#22 ASMESectionVIII SubsectionA,UG, Design,UGͲ28(c.) Duringanexternalinspectionofavesselwithanoutsidediameterof48” uniformcorrosiondamagewasdiscovered.Thethicknessinthisareaofshell wasfoundtobe0.425”.Thisvesselisdesignedfor35psiexternalpressureand hasaBfactorof1800.Canthisvesseloperateat35psiexternalpressureor doesitneedtobererated? 40 ([WHUQDO3UHVVXUH&DOFXODWLRQV PracticeQuestion#23 ASMESectionVIII SubsectionA,UG, Design,UGͲ28(c.) A20ft longexchangertubehasanoutsidediameterof2”andnominal thicknessof0.083”.MaterialofconstructionisSAͲ283GrDanddesign temperatureis600deg F.The“B”factorforthetubeis1500.Whatisthe maximumallowedexternalpressureforthistube? 41 /HVVRQ3ODQ,,, (Calculations– ImpactTesting,WeldSizeandNozzle Reinforcement) 1 /HVVRQ3ODQ,,, (Calculations– ImpactTesting,WeldSizeandNozzleReinforcement) I. Impact Testing A. B. Theinspectorshouldunderstandimpacttestingrequirementsandimpacttestingprocedure(UGͲ84) Theinspectorshouldbeabletodeterminetheminimummetaltemperatureofamaterialwhichisexemptfromimpacttesting(UGͲ20(f),UCSͲ66, UCSͲ68(c).) II. WELD SIZE FOR ATTACHMENT WELDS AT OPENING MustbeabletodetermineiftheweldsizemeetsCoderequirements. A. B. Convertafilletweldthroatdimensiontolegdimensionorvisaversa,usingconversionfactor(0.707); Determinetherequiredsizeofweldsatopenings(UW-16) III. Nozzle Reinforcement A. B. C. D. E. Understandthekeyconceptsofreinforcement,suchasreplacementofstrengthremovedandlimitsofreinforcement. Creditcanbetakenforextrametalinshellandnozzle Beabletocalculatetherequiredareasforreinforcementorchecktoensurethatadesignedpadislargeenough.To simplifytheproblem: Allfr =1.0 AllF=1.0 AllE=1.0 Therewillbenonozzleprojectinginsidetheshell Beabletocompensateforcorrosionallowances Weldstrengthcalculationsareexcluded 2 ,PSDFW7HVWLQJ0'07 (ASMEVIIIUGͲ20(f),UGͲ84UCSͲ66,UCSͲ68(c).) I. WhatdoesImpactTestingDetermine? II. WhatisMDMT? III. WhydoestheCodeworryaboutMDMT? IV. Whataresomefactorsthataffectbrittlenessofmaterials? V. Whatistheoppositeofbrittleness? . 3 0'07 I. ASMEVIII, 6XEVHFWLRQ$3DUW8*'HVLJQ8* 6XEVHFWLRQ&3DUW8&6/RZ7HPSHUDWXUH 2SHUDWLRQ8&6 D E 8&6 F HowdoesASMESectionVIIImanageBrittleFracture a. ByMaterialSelection(P1Group1and2Ͳ b. ProvidesamethodfordeterminingMDMT c. seeFig.UCSͲ66) ASMEVIII, 6XEVHFWLRQ&3DUW8&6/RZ7HPSHUDWXUH 2SHUDWLRQ8&6SDJHGRZQWLPHV 1. Curvesformaterialgroupings(Fig.UCSͲ66) 2. Initialimpacttestingexempttemperaturebasedonmaterial(curve letter)andthickness(TableUCSͲ66Ͳ1) 3. StressReductionRatiofactor[(tr xE)/(tnͲc)].(FigUCSͲ66.1) 4. PWHTReduction(residualstressreductionallowedwhenPWHTisperformedandisnotrequired bytheCode)see(par.UCSͲ68(c.)) Note:Thisratiowillbeprovidedonthetest. TemperaturelimitedbyUCSͲ66(b)(2)&(3)andUCSͲ68(c.) a) UCSͲ66(b)(2)– nocolderthanͲ55oF,unless ; 1) 2) Stressreductionratiois0.35orless,thentemperaturecanbe betweenͲ55oFandͲ155oF.(UCSͲ66(b)(3) PWHTperformedwhennotrequiredbyCode,temperaturecan bebelowͲ55oF.(UCSͲ68(c.) 4 0'07 PracticeQuestion#1 A horizontal vessel constructed from SA-516 Gr 65 plate (not normalized). Designed for 350 psig @ 650oF. Wall thickness is 1.5”, with a 1/16” corrosion allowance and reduction ratio is .80. Nameplate is stamped RT-1 and HT. What is the lowest possible MDMT for this vessel? 5 0'07 PracticeQuestion#1 A horizontal vessel constructed from SA-516 Gr 65 plate (not normalized). Designed for 350 psig @ 650oF. Wall thickness is 1.5”, with a 1/16” corrosion allowance and reduction ratio is .80. Nameplate is stamped RT-1 and HT. What is the lowest possible MDMT for this vessel? ASMEVIII, Step1:FindmaterialCurveLetter; Curveletteris“B”fromFig.UCSͲ66 6XEVHFWLRQ&3DUW8&6/RZ7HPSHUDWXUH 2SHUDWLRQ8&6SDJHGRZQWLPHV ASMEVIII, 6XEVHFWLRQ&3DUW8&6/RZ7HPSHUDWXUH Step2:InitialMDMT; 2SHUDWLRQ8&6SDJHGRZQWLPHV 51oF fromTableUCSͲ66 ASMEVIII, Step3:MDMTreduction(stressratioreduction); 6XEVHFWLRQ&3DUW8&6/RZ7HPSHUDWXUH 20oF reductionallowed,therefore 2SHUDWLRQ8&6SDJHGRZQWLPHV ReducedMDMT=51oFͲ 20oF=+31oF (fromFig.UCSͲ66.1) Step4:PWHTreduction(notallowed) PWHTreductionisnotallowedbecausePWHTwasrequired byCode(i.e.nameplatestamped“HT”)seePar.UCSͲ68(c.) ASMEVIII, LowestMDMT=+31oF 6XEVHFWLRQ&3DUW8&6/RZ7HPSHUDWXUH 2SHUDWLRQ8&6SDJHGRZQWLPHV 6 0'07 (ASMEVIIIUGͲ20(f),UGͲ84UCSͲ66,UCSͲ68(c).) PracticeQuestion#2 A horizontal vessel constructed from SA-516 Gr 50N plate. Designed for 300 psig @ 600oF. Wall thickness is 0.25”, with a 1/32” corrosion allowance and reduction ratio is .80. Nameplate is stamped RT-1. Vessel was PWHT’d. What is the lowest possible MDMT for this vessel? 7 0'07 (ASMEVIIIUGͲ20(f),UGͲ84UCSͲ66,UCSͲ68(c).) PracticeQuestion#3 AhorizontalvesselconstructedfromSAͲ178GrAplate.Designedfor200 psig@500oF.Wallthicknessis0.500”,witha1/8”corrosionallowance andreductionratiois.80.VesselwasPWHT’d.NameplateisstampedRTͲ 2.WhatisthelowestpossibleMDMTforthisvessel? 0'07 (ASMEVIIIUGͲ20(f),UGͲ84UCSͲ66,UCSͲ68(c).) PracticeQuestion#4 A horizontal vessel constructed from SA-516 Gr 60 plate. Designed for 200 psig @ 500oF. Wall thickness is 0.750”, with a 1/8” corrosion allowance and reduction ratio is .88. Nameplate is stamped RT-2 and vessel was PWHT’d for environment cracking. What is the lowest possible MDMT for this vessel? &KDUS\,PSDFWV CharpyImpactTest ASMEVIII, 6XEVHFWLRQ$3DUW8*)DEULFDWLRQ8* EachSpecimenshallconsistofthreespecimensASMEVIIIUGͲ84 Specimenthicknessis0.394”Fig.UGͲ84 10 &KDUS\,PSDFWV CharpyImpactTest ASMEVIII, 6XEVHFWLRQ$3DUW8*)DEULFDWLRQ8* SDJHGRZQWLPHV (a)Interpolationbetweenyieldstrengthsshownispermitted. (b)Theminimumimpactenergyforonespecimenshallnotbelessthan2Ш3oftheaverageenergyrequired forthreespecimens.Theaverageimpactenergyvalueofthethreespecimensmayberoundedtothe nearestftͲlb. 11 &KDUS\,PSDFWV ASMEVIII, 6XEVHFWLRQ$3DUW8*)DEULFDWLRQ8* SDJHGRZQWLPHV PracticeQuestion#5 Whatistherequiredaverageandminimumcharpy impactvaluesforamaterialwith50ksi MSYSandis1.0thick? 12 &KDUS\,PSDFWV (ASMEVIIIUGͲ84 ANSWER: Average=15ft lbs Min.Value=2/3x15=10ft lbs 50Ksi 15ft lbs 1.0thickness 13 &KDUS\,PSDFWV (ASMEVIIIUGͲ84 PracticeQuestion#6 Whatistherequiredaverageandminimumcharpy impactvaluesforamaterialwith55ksi MSYSandis2.0thick? 14 &KDUS\,PSDFWV (ASMEVIIIUGͲ84 PracticeQuestion#7 Duringimpacttestingofa1½”thickmaterialwithaMSYSof45,000psi,theimpact testingvaluesforthespecimenswere17,12,and11?Aretheresultsoftheseimpact testsacceptable? 15 )LOOHW:HOGV ASMEVIII, 6XEVHFWLRQ%3DUW8:'HVLJQ8: E DQGSDJHGRZQRQFHIRU)LJ8: Filletweldsizeisnormallydescribedbythe“leg”size. Calculatingfilletweldsize; Throatsize=0.707xlegsize Legsize=throatsize/0.707 PerFig.UWͲ16.1; Throatsize=½tmin or Throatsize=tc or Throat Leg Leg Throatsize=tw 16 )LOOHW:HOGV ASMEVIII, 6XEVHFWLRQ%3DUW8:'HVLJQ8: E DQGSDJHGRZQRQFHIRU)LJ8: Calculatingthesizeoffilletwelds; Throat Leg PracticeQuestion#5 Anequallegfilletweldhasathroatof0.375”. Whatislegsizeforthisfilletweld? Leg Legsize=throatsize/0.707 =0.375/0.707 = 0.530” PracticeQuestion#6 Afilletweldwithalegsizeof0.250”. Whatisthroatsizeforthisfilletweld? PracticeQuestion#7 A45o filletweldhasalegsizeof0.125”. Whatisthroatsizeforthisfilletweld? 17 )LOOHW:HOG6L]H ASMEVIII, 6XEVHFWLRQ%3DUW8:'HVLJQ8: E DQGSDJHGRZQRQFHIRU)LJ8: Perpar.UWͲ16(b); Filletweldsize,mustbeconvertedfromthroatsize(½tmin ortc)tolegsize. tmin =lesserof¾”ormembersjoined Assume,therepadis0.375”thick,thevessel shellis0.500”thickandthenozzleis0.432”. Whatistherequiredfilletweldsizeattaching therepadtothevesselshell? tn d t Step1: Gotothesketch(UWͲ16.1(aͲ1). 1/2tmin Step2: Calculatethroatsize(½tmin) tc te aͲ1 ½tmin =½x(less =½x(lesserof(0.75”,_____,_____,____) =½x(lesserof(0.75”,0.375”,0.500”,0.423”) =½x0.375” =0.1875” Step3:Calculateweldsize(FilletweldLegsize); Leg=½tmin /0.707=0.1875/0.707=0.265”,roundedtonext1/16”=0.3125” 18 )LOOHW:HOG6L]H Perpar.UWͲ16(b); Fillet weld size for nozzles without repads must be calculated by converting throat size (tc), to leg size. tc = not less than smaller of ¼” or 0.707 x tmin tn d Assume, the vessel shell is 0.500” thick and the nozzle is 0.432”. What is the required fillet weld size for this branch connection? Step1: Find correct sketch (UW-16.1(a). tc t Step2: Calculate the throat size (tc) tc = lesser of ¼” or 0.707 x tmin = lesser of ¼” or 0.707 x (lesser of 0.750, 0.423, 0.500) = lesser of ¼” or (0.707 x 0.432) = lesser of ¼” or 0.305” = 0.250” a Step 3: Calculate weld size (Fillet weld Leg size); Leg = tc / 0.707 = 0.250 / 0.707 = 0.357”, rounded to next 1/16” = 0.375” 19 tc = 0.375” 0.3125” 0.250” 20 )LOOHW:HOG6L]H ASMEVIIIpar.UWͲ16(b); PracticeQuestion#8 Abranchconnectionisbeinginstalledwithoutareinforcementpad. Thenozzlethicknessis0.625”andthevesselshellis0.875”thick.Whatsize filletweldshouldbeusedforthisbranchconnection? tn d tc t a 21 )LOOHW:HOG6L]H ASMEVIIIpar.UWͲ16(b); PracticeQuestion#9 Abranchconnectionisbeinginstalledwithareinforcementpad. Thenozzlethicknessis0.625”,repadis0.750”thickandthe vesselshellis0.875”thick.Whatsizefilletweldshouldbe usedtoattachtherepad tothevesselshell? tn d tc te t 1/2tmin aͲ1 22 )LOOHW:HOG6L]H ASMEVIIIpar.UWͲ16(b),Fig.UWͲ16.1(a) Practice Question # 10 AnozzleisinstalledinavesselperFig.UWͲ16.1(a).Thevesselwallthickness is0.325”andthenozzlewallthicknessis0.375”.Whatistheminimumfillet WeldsizeforthenozzleͲtoͲshellfilletweld? tn d tc t a 23 )LOOHW:HOG6L]H ASMEVIIIpar.UWͲ16(b),Fig.UWͲ16.1(a) Practice Question # 11 AnozzleisinstalledinavesselperFig.UWͲ16.1(a).Thevesselwallthickness is0.325”andthenozzlewallthicknessis0.375”.Whatistheminimumfillet weldsizeforthenozzleͲtoͲshellfilletweld? tn d tc t a 24 )LOOHW:HOG6L]H ASMEVIIIpar.UGͲ37 Practice Question # 12 Anew8NPSnozzleisinstalledinavesselperFig.UWͲ16.1(h).Shellrequiredthicknessis 1.125”.Nominalshellthicknessis1.250”.Nominalthicknessforthenozzleis0.875”. Therepadthicknessis0.500”. 1) WhatistheminimumfilletweldsizeforthenozzleͲtoͲrepadfilletweld? 2) WhatistheminimumfilletweldsizefortheshellͲtoͲrepadfilletweld? tn d tw=0.7tmin tc t tc 25 Fig.UWͲ16Ͳ1(h) HEAD BANGER :KDWLVWKHPD[LPXPLQWHUYDOIRUFDOLEUDWLQJDHOHFWURPDJQHWLF \RNH" :KDWLVWKHPD[LPXPLQWHUYDOIRUDQH[WHUQDOLQVSHFWLRQ" :KDWLVWKHPD[LPXPLQWHUYDOIRUDUHOLHIYDOYHLQIRXOLQJRU FRUURVLYHVHUYLFH" :KDWLVWKHPD[LPXPLQWHUYDOIRUDQLQWHUQDOLQVSHFWLRQ" :KDWLVWKHPD[LPXPLQWHUYDOEHWZHHQUHDVVHVVPHQWVRID5%," :KDWLVWKHPD[LPXPLQWHUYDOIRUDUHOLHIYDOYHLQFOHDQQRQ IRXOLQJQRQFRUURVLYHVHUYLFH" :KDWLVWKHPLQLPXPUHPDLQLQJOLIHUHTXLUHGLQRUGHUWRSHUIRUPDQ 2QVWUHDPLQOLHXRIDQLQWHUQDOLQVSHFWLRQ" :KDWLVWKHGHQVLW\OLPLWVRIUDGLRJUDSKIRUDZHOGDVFRPSDUHG WRWKH,4," :KDWLVWKHPD[LPXPSHUFHQWRIFDUERQDOORZHGLQQHZPDWHULDOV" :KDWLVWKHPD[LPXPRSHUDWLQJSUHVVXUHRIDFRQYHQWLRQDO UXSWXUHGLVN DVDSHUFHQWDJHRIEXUVWSUHVVXUH " :KDWGLDPHWHUVKRXOGEHLQWKHKHPLVSKHULFDOKHDGIRUPXODWR HYDOXDWHDFRUURGHGDUHDRIDHOOLSVRGLDO RUWRULVSKHULFDOKHDG" :KDWLVWKHPD[LPXPDOORZHGFRUURVLRQUDWHWRHQDEOHDQRQ VWUHDPLQVSHFWLRQWREHSHUIRUPHGLQOLHXRIDQLQWHUQDOLQVSHFWLRQ" 1R]]OH5HLQIRUFHPHQW ASMEVIIIpar.UGͲ37 I. Nozzle Reinforcement Replacingarealostbycuttingholeinvessel(crossͲsectionalarea) Strengthofthemateriallost,mustbereplaced Strengthlost=diameterofholexshelltmin Limitsofreinforcement Extrametalmustbenearthenozzle Strengthofreinforcement Reinforcementmustbeequaltothestrengthremoved Additionalreinforcementmustbeadded Reinforcementcancomefrommultiplesources Shell,nozzle,repadandfilletwelds Corrosionallowancecannotbeused 29 1R]]OH5HLQIRUFHPHQW ASMEVIII,SubsectionA,PartUG,UGͲ37 Nozzle Reinforcement Variables 6XEVHFWLRQ%3DUW8:'HVLJQ8: E DQGSDJH GRZQRQFHIRU)LJ8: Variables for nozzles without repads Variables for nozzles with repads tn d tc te tc A = d x tr tn d A = d x tr t a t 1/2tmin aͲ1 A1 = d (t-tr) or 2(t + tn)(t-tr) , extra shell area, larger of these two A1 = d (t-tr) or 2(t + tn)(t-tr) , larger of these two A2 = 5t(tn-trn) or 5tn (tn-trn) , extra nozzle area, smaller of these two A41 = Leg2 A41 = leg2 d = diameter of nozzle in corroded condition t = shell thickness in the corroded condition tr = shell required thickness tn = nozzle thickness in the corroded condition trn = nozzle required thickness Dp =outsidediameterofrepad te = repad thickness Limits of reinforcement = greater of d or Rn+tn_t A2 = 5t(tn-trn) or 5tn (tn-trn) , smaller of these two A42 = Leg2 A5 = (Dp – d – 2tn)te Notes: A. Therewillbenonozzleprojectinginsidetheshell B. Beabletocompensateforcorrosionallowances C. Weldstrengthcalculationsareexcluded 30 1R]]OH5HLQIRUFHPHQW ASMEVIII,SubsectionA,PartUG,UGͲ37 Practice Question # 13 6XEVHFWLRQ%3DUW8:'HVLJQ8: E DQGSDJH GRZQRQFHIRU)LJ8: A12NPSnozzleisbeinginstalledonavessel.ThecorrodedIDofthenozzleis 12.0”.Shellthicknessis0.750”.Corrosionallowanceis1/16”.Requiredthickness fortheshellis0.625”.Theareathatmustbereplacedis; tn d tc t a 31 1R]]OH5HLQIRUFHPHQW ASMEVIIIpar.UGͲ37 Practice Question # 13 A12NPSnozzleisbeinginstalledonavessel.ThecorrodedIDofthenozzleis 12.0”.Shellthicknessis0.750”.Corrosionallowanceis1/16”.Requiredthickness fortheshellis0.625”.Theareathatmustbereplacedis; tn d tc t a ASMEVIII,SubsectionA,PartUG,UGͲ37 6XEVHFWLRQ%3DUW8:'HVLJQ8: E DQGSDJH GRZQRQFHIRU)LJ8: 32 1R]]OH5HLQIRUFHPHQW ASMEVIIIpar.UGͲ37 Practice Question # 14 A8NPSnozzleisbeinginstalledonavessel.ThecorrodedIDofthenozzleis 8.0”.Nozzlethicknessis0.250”.Requiredthicknessforthenozzleis0.100” Shellthicknessis0.450”.Requiredthicknessfortheshellis0.400”. Filletweldsizeis0.375”. 1.Whatisthearealost? 2.Whatisthelimitsofreinforcement? 3.Whatistheextraareaprovidedbyshell? 4.Whatistheextraareaprovidedbythenozzle? tn d tc t a 33 1R]]OH5HLQIRUFHPHQW Practice Question # 15 A12NPSnozzleisbeinginstalledinavesselasindicatedbyFig.UWͲ16.1(aͲ1).Thevessel wallthicknessis0.825”thick.Vesselrequiredthicknessis0.625”.Thenozzlewall thicknessis0.500”.Requirednozzlethicknessis0.375”.Therepadis0.375”thick. Corrosionallowanceis0.125”. 1) What is the limits of reinforcement (edge to edge)? tn d 2) What is the area lost? tc te t 1/2tmin Fig.UWͲ16.1(aͲ1) /HVVRQ3ODQ,9 $60(6HFWLRQ,; :36345:34 1 ExamRestrictions/Exclusions: 1. No more than one process (SMAW, GTAW or SAW). 2. One filler metal per process 3. PQR will be the supporting PQR for the WPS (only one WPS and one PQR). 4. Base metal limited to P1, P3, P4, P5 and P8 5. Dissimilar metals and/or thicknesses are excluded from exam 6. 7. 8. 9. Corrosion-resistant weld overlay, hard-facing overlay, and dissimilar metal welds with buttering of ferritic member is excluded from exam P1, P3, P4 & P5 lower transition temperature will be 1330 F and 1600 F upper transformation Editorial and non-technical requirements are excluded (i.e. Revision #, Company Name, WPS number, WPS Date, and Name of testing lab). Supplemental Variables are excluded from Exam. 2 BodyofKnowledge I. WPS/PQR/WPQ – BODY OF KNOWLEDGE $ 'HWHUPLQHLISURFHGXUHDQGTXDOLILFDWLRQUHFRUGVDUHLQFRPSOLDQFHZLWK$60( &RGHDQG$3, % 'HWHUPLQHLIDOOHVVHQWLDODQGQRQHVVHQWLDOYDULDEOHVKDYHEHHQDGGUHVVHG & 'HWHUPLQHQXPEHUDQGW\SHRIPHFKDQLFDOWHVWVWKDWDUHOLVWHGLQ345DUHWKH SURSHUWHVWVDQGZKHWKHUWKHUHVXOWVDUHDFFHSWDEOH 127(0XVWNQRZWKDWWKH345 PXVWEHVLJQHGDQGGDWHG 3 Layout of the ASME Section IX Code Book Divided into 2 parts QW – WELDING QB - BRAZING (pages 204 – 243 is not on exam) QW – Divided into 5 Articles Article I – Welding general requirements (13 pages) QW100 Article II – Welding Procedure Qualifications (WPS/PQR) QW200 Article III – Welding Performance Qualifications (WPQ) QW300 Article IV – Welding Data QW400 Article V - Standard WPS Specifications (NOT ON TEST) QW500 4 Purpose of ASME Section IX Section IX is focused on THREE things; 1. WPS - (Welding Procedure Specification) Directions to welder to for making production welds 2. PQR - (Procedure Qualification Record) Qualifies that the WPS can be used to make a quality weld 3. WPQ - (Welder Performance Qualification) Qualifies that the WELDER can make quality welds with a Welding Process (i.e. SMAW, GTAW, SAW). 5 General requirements of ASME Section IX $UWLFOH, QW100.1 (page 1) a. Provides directions to welder for making production welds in accordance with CODE requirements. b. WPS shall be qualified by Manufacturer/Contractor c. WPS specifies conditions which welding must be performed d. WPS must address essential and non-essential variables and supplemental variables when applicable (supplemental variables are not on API 510 exam). e. PQR establishes the properties of the weld, “not the skill of welder’. f. PQR must address essential variables and and supplemental variables when applicable (supplemental variables are not on API 510 exam). QW100.2 (page 2) a. WPQ determines welder’s ability to make sound welds. 6 General requirements of ASME Section IX (cont) $UWLFOH, QW100.3 a. WPS qualified per Section IX, can be used to make welds in accordance with Section VIII b. WPS qualified in accordance with Section IX 1962 or later can be used. c. WPS qualified in accordance with Section IX prior to 1962, can be used, if all the 1962 requirements are met. d. Prior to 2009, Section IX used “S” numbers. The 2010 Section IX eliminated the “S” numbers. WPS’s created using “S” numbers must be revised to show correct “P” number, but not RE-QUALIFIED. e. New WPS’s and Welder Qualifications, must be per 2010 Edition of Section IX QW-101 a. Section IX applies to preparation of WPS, PQR, WPQ for all types of manual & machine welding processes 7 General requirements of ASME Section IX (cont) $UWLFOH, QW102 (Definitions) (see QW492, page 193) a. b. Groove Weld – weld made in a groove formed within a single or two members. Heat-affected zone – base metal that was not melted, but whose mechanical properties were altered during welding c. Interpass temperature – highest temperature allowed in weld or weld joint prior to welding. o d. Lower Transformation Temperature 1330 F – Ferrite begins to transform into Austenite (P1, P3, P4, P5) e. Macro-Examination - Observing a cross-section of a specimen by the unaided eye or low magnification with or without etching. f. Performance Qualification – welder’s ability to produce welds meeting prescribed standards. g. Preheating – heat applied prior to welding o h. Upper Transformation temperature 1600 F – Transformation from ferrite to austenite is completed. (P1, P3, P4, P5) i. Welder – one who performs manual or semi-automatic welding. 8 General requirements of ASME Section IX (cont) $UWLFOH, QW103.1 - Responsibility a. QW103.2 - Records a. Manufacturer is responsible for and shall conduct testing required to Qualify WPS’s and Welders. Manufacturer shall maintain a record of the results of WPS and Welder Qualifications (i.e. PQR and WPQ). QW110 – Weld Orientation a. Weld orientations used for WPS and WPQ test are as indicated in figure QW 461.1 or QW 461.2 (page 151). 9 :KDWLVWKHUDWLRRIHQGXUDQFHOLPLWVWUHVVWRXOWLPDWHWHQVLOHVWUHVVIRU FDUERQVWHHO" :KDWLVWKHVWDWLFKHDGIDFWRUWREHXVHGIRUFDOFXODWLQJVWDWLF KHDGRIYHVVHOFRPSRQHQW" :KDWLVWKHMRLQWHIILFLHQF\ZKHQIXOO57LVSHUIRUPHGRQ7\SH MRLQWV" :KDWLVWKHMRLQWHIILFLHQF\ZKHQHYDOXDWLQJDFRUURGHGDUHDWKDWLV QRWDGMDFHQWWRDZHOG" +RZPDQ\DGGLWLRQDOUDGLRJUDSKVDUHUHTXLUHGZKHQDVSRW57IDLOV DFFHSWDQFHFULWHULD" +RZPDQ\WHQVLRQWHVWDUHUHTXLUHGWRTXDOLI\D:36" +RZPDQ\EHQGWHVWDUHUHTXLUHGWRTXDOLW\DZHOGHULQ** SRVLWLRQV" :KDWLVWKHPLQLPXPGHQVLW\DOORZHGLQWKHDUHDRILQWHUHVW ,4,RIDUDGLRJUDSKPDGHZLWKJDPPDUD\" :KDWLVWKHPLQLPXPQXPEHURIH[SRVXUHVUHTXLUHGWR57 GHJUHHVDURXQGDZHOGXVLQJ':(':9WHFKQLTXH HOOLSWLFDO " :KDWLVWKHPLQLPXPQXPEHURIH[SRVXUHVUHTXLUHGWR57 GHJUHHVDURXQGDZHOGXVLQJ':(6:9WHFKQLTXH" +RZPDQ\WHVWEDUVDUHUHTXLUHGLQHDFKVHWRIFKDUS\ LPSDFWWHVW" ,IDVKLPLVXVHGXQGHUDKROHW\SH,4,KRZPDQ\VLGHVRIWKH,4, PXVWEHYLVLEOH" +RZPDQ\EHQGVDUHUHTXLUHGWRTXDOLI\D:36" +RZPDQ\EHQGWHVWDUHUHTXLUHGWRTXDOLW\DZHOGHULQ*RU *SRVLWLRQV" :KDWLVWKHPD[LPXPGHQVLW\RIWKH,4,RUZHOGRQDUDGLRJUDSKLF ILOP" :KDWLVWKHPD[LPXPDOORZHGFKORULGHFRQWHQWZKHQ K\GURVWDWLFDOO\WHVWLQJDXVWHQLWLFVWDLQOHVVVWHHO" :KDWPDWHULDOVDUHVXEMHFWWRWHPSHUHPEULWWOHPHQW" :KDWPDWHULDOVDUHVXEMHFWWRFKORULGHVWUHVVFRUURVLRQFUDFNLQJ" Understanding P-Number $31XPEHU 4:SDJH :K\DUH31XPEHUVXVHG" $UWLFOH,9 4: +RZGR\RXGHWHUPLQHWKH31XPEHUIRUD0DWHULDO" 14 Understanding P-Number Example - WhatistheP-NumberforSA285GrC? $UWLFOH,9 4: Answer- FindSA285GrCintableQW/QB422(page76).ItisP1Gr1. 15 Understanding F-Numbers %)1XPEHU 4:SDJH :K\DUH)1XPEHUVXVHG" $UWLFOH,9 4: +RZGR\RXGHWHUPLQHWKH)1XPEHUIRUILOOHUPHWDO" 16 Understanding F-Numbers Example - WhatistheF-NumberforE8018? $UWLFOH,9 4: Answer- FindAWSclassificationinTableQW432(page134),thengohorizontallytoleft tillyougettotheF-Nocolumn.F4isanswer 17 P-Number and F-Number Practice Questions 31XPEHU 3UDFWLFH± ZKDW LVWKH3IRUIROORZLQJ" Material PͲNumber SA240Type 304 SA217TypeWC1 UNSS31000 )1XPEHU 3UDFWLFH± ZKDWLVWKH)IRUWKHIROORZLQJ" Filler MetalClassificationand/orSpecification FͲNumber E7024 E8018 SFA5.18 18 Test positions for Groove Welds (plate) QW120 – Test Positions a. Test coupons may be oriented in any position indicate in figures QW 461.3 (plate) or QW 461.4 (pipe) …..see page 153 $UWLFOH,94: 4: 3DJHGRZQWLPHV r 15deg r 15deg 19 Test positions for Groove Welds (Pipe) $UWLFOH,94: 4: 3DJHGRZQWLPHV r 15deg r 15deg 20 “FIELD” Weld Orientations $UWLFOH,9 4: 4: (QW110 page 151) Tabulation of Positions of GROOVE WELDS INCLINATION of AXIS Position Flat Diagram Reference A Inclination of Axis 0 to 15o Rotation of Face 150 to 210o Horizontal B 0 to 15o 80 to 150o 210 to 280o Overhead C 0 to 80o 0 to 80o 210 to 360o Vertical D E 15 to 80o 80 to 90o 80 to 280o 0 to 360o o 280 o 0 to o 360 ROTATION of FACE 21 “FIELD” Weld Orientations (QW110 page 151) Groove Weld – POSITION of Field Welds Tabulation of Positions of GROOVE WELDS 6WHS 6WHS 6WHS Position Flat Diagram Reference A Inclination of Axis 0 to 15o Rotation of Face 150 to 210o Horizontal B 0 to 15o 80 to 150o 210 to 280o Overhead C 0 to 80o 0 to 80o 210 to 360o Vertical D E 15 to 80o 80 to 90o 80 to 280o 0 to 360o 3RVLWLRQ RULHQWDWLRQRIWKH³:(/'´ 7KHUHDUHRQO\³´SRVLWLRQV )ODW $ +RUL]RQWDO % 9HUWLFDO & 2YHUKHDG ' 1RWH ( LVIRU)LOOHWZHOGVDQGWKLVZLOOQRWEHRQ([DP 22 “FIELD” Weld Orientations (QW110 page 151) 3UDFWLFH4XHVWLRQ $JURRYH ZHOGLVLQFOLQHGGHJUHHVIURPKRUL]RQWDODQGWKHIDFHRIWKHZHOGLVDWGHJUHHV SPFORFNSRVLWLRQ :KDW LVWKHZHOGLQJSRVLWLRQRIWKLVZHOG" 23 “FIELD” Weld Orientations 3UDFWLFH4XHVWLRQ $JURRYH ZHOGLVLQFOLQHGGHJUHHVIURPKRUL]RQWDO DQGWKHIDFHRIWKHZHOGLVDWGHJUHHV SPFORFN SRVLWLRQ :KDWLVZHOGLQJSRVLWLRQRIWKLVZHOG" 6WHS 6WHS 0DWFKWKH3RVLWLRQ IURP6WHSWRWKHIDFH URWDWLRQ 7KLVZLOOJLYH\RXWKH3RVLWLRQ V IRUWKLVSURGXFWLRQ ZHOG Tabulation of Positions of GROOVE WELDS 'HWHUPLQHZKLFKSRVLWLRQ WKLV³LQFOLQDWLRQRIZHOGD[LV´ WKLVZHOGFRXOGSRVVLEO\EH LH$%&RU' Tabulation of Positions of GROOVE WELDS 6WHS Position Flat Diagram Reference A Inclination of Axis 0 to 15o Rotation of Face 150 to 210o Horizontal B 0 to 15o 80 to 150o 210 to 280o Overhead C 0 to 80o 0 to 80o 210 to 360o Vertical D E 15 to 80o 80 to 90o 80 to 280o 0 to 360o (QW110 page 151) 6WHS Position Flat Diagram Reference A Inclination of Axis 0 to 15o Rotation of Face 150 to 210o Horizontal B 0 to 15o 80 to 150o 210 to 280o Overhead C 0 to 80o 0 to 80o 210 to 360o Vertical D E 15 to 80o 80 to 90o 80 to 280o 0 to 360o /RRNLQJDWWKHFKDUW GHJUHHVFDQEH³$´ ³%´³&´RU³'´ 24 “FIELD” Weld Orientations (QW110 page 151) 3UDFWLFH4XHVWLRQ $JURRYH ZHOGLVLQFOLQHGGHJUHHVIURPKRUL]RQWDO DQGWKHIDFHRIWKHZHOGLVDWGHJUHHV SPFORFN SRVLWLRQ :KDWLVZHOGLQJSRVLWLRQRIWKLVZHOG" 6WHS 0DWFK WKH³,QFOLQDWLRQ´WRWKH³)DFH5RWDWLRQ´WR GHWHUPLQHWKH326,7,21RIWKH:(/' Tabulation of Positions of GROOVE WELDS Position Flat Diagram Reference A Inclination of Axis 0 to 15o Rotation of Face 150 to 210o Horizontal B 0 to 15o 80 to 150o 210 to 280o Overhead C 0 to 80o 0 to 80o 210 to 360o Vertical D E 15 to 80o 80 to 90o 80 to 280o 0 to 360o $QVZHU 7KLVZHOGLVLQWKH³+RUL]RQWDO´DQG ³9HUWLFDO´SRVLWLRQ 25 Practice Questions for Weld Orientations 3UDFWLFH4XHVWLRQ $JURRYH ZHOGLVLQFOLQHGGHJUHHVIURPKRUL]RQWDODQGWKHIDFHRIWKHZHOGLVDWGHJUHHV FORFNSRVLWLRQ :KDWLVZHOGLQJSRVLWLRQRIWKLVZHOG" 26 Practice Questions for Weld Orientations 3UDFWLFH4XHVWLRQ $JURRYH ZHOGLVLQFOLQHGGHJUHHVIURPKRUL]RQWDODQGWKHIDFHRIWKHZHOGLVDWGHJUHHV:KDWLVZHOGLQJ SRVLWLRQRIWKLVZHOG" 27 Practice Questions for Weld Orientations 3UDFWLFH4XHVWLRQ $JURRYH ZHOGLVLQFOLQHGGHJUHHVIURPKRUL]RQWDODQGWKHIDFHRIWKHZHOGLVDWGHJUHHV FORFNSRVLWLRQ :KDWLVZHOGLQJSRVLWLRQRIWKLVZHOG" 28 Practice Questions for Weld Orientations 3UDFWLFH4XHVWLRQ $JURRYH ZHOGLVLQFOLQHGGHJUHHVIURPKRUL]RQWDODQGWKHIDFHRIWKHZHOGLVDWGHJUHHV FORFNSRVLWLRQ :KDWLVZHOGLQJSRVLWLRQRIWKLVZHOG" 29 7\SHVRI7HVW([DPV $UWLFOH, QW141.1 – Tension Test A. B. C. QW141.2 – Guided Bend Test A. B. Used to determine “notch toughness” of the welds QW142 – Special examination for welders A. Used to determine “size, contour & degree of soundness ” of fillet welds. QW141.4 – Charpy Impact A. Used to determine “degree of soundness and ductility” of groove weld joints. Types - Root, Face and Side bend QW141.3 – Fillet Weld Test A. Used to determine “ultimate strength” of groove weld joints (TENSILE STRENGTH). Types of Test - Reduced Section, Round (Turned), Full Section 2 Tensile Strength = Load/Area in lbs/in (psi) RT or UT may be substituted for mechanical test (bends) for welders. QW144 – Visual examination A. Used to determine welds meet “quality standards” 30 7(16,217(67 $UWLFOH,94: 4:SDJH GRZQWLPHV 31 7(16,217(67 QW141.1 – Tension Test A. B. C. QW151 – Tension Test QW 151.1 - Reduced section “may be” used for all thicknesses of plates QW 151.1(a) - For thicknesses 1” “SHALL” be FULL thickness specimens QW 151.1(b) - For thicknesses > 1” “may be” FULL thickness or multiple specimens QW 151.2 - Reduced section “may be” used for all thicknesses of pipe > 3” diameter. Used to determine “ultimate strength” of groove weld joints (TENSILE STRENGTH). Types of Test - Reduced Section, Round (Turned), Full Section 2 Tensile Strength = Load/Area in lbs/in (psi) QW 151.2(a) - For pipe thickness 1” “SHALL” be FULL thickness specimens QW 151.2(b) - For thicknesses > 1” “may be” FULL thickness or multiple specimens QW153 – Tension Test – Acceptance Criteria )DLOV LQ³:(/'´DQG 0DWHULDOV MRLQHGDUHVDPHVWUHQJWK 0DWHULDOV MRLQHGDUH'LIIHUHQWVWUHQJWKV 0XVW EH0676RI%DVH0HWDO± 4: D BBBBBBBBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBBBBBBB 0XVW EH0676RIZHDNHVW%DVH0HWDO 4: E 0XVW EHRI0676RI%DVH0HWDO 4: G BBBBBBBBBBBBBBBBBBBBBBBBBBBBBB )DLOV LQ³%DVH0HWDO´RXWVLGHZHOGRUZHOGLQWHUIDFH 127(/2$'LVDPHDVXUHRIWKHVWUHVV QHHGHGWRSXOOWKH7(16,21VSHFLPHQDSDUW LHIDLOXUH 32 :KDWPDWHULDOVDUHVXEMHFWWRSRO\WKHRQLFDFLGVWUHVVFRUURVLRQ FUDFNLQJ" :KDWLVDFRPPRQPDWHULDOZLWKDQHQGXUDQFHOLPLW" :KDWFRPPRQPDWHULDOVGRQRWKDYHDQHQGXUDQFHOPLW " :KDW31XPEHUVDUHDOORZHGWRXVHSUHKHDWLQOLHXRI3:+7" :KDW3QXPEHUVDUHDOORZHGWRXVHFRQWUROOHGGHSRVLWLRQLQOLHXRI 3:+7" :KDW3QXPEHUVVKRXOGEHH[DPLQHGIRUGHOD\HGFUDFNLQJDIWHU UHSDLUVWR66FODGGLQJ" :KDW&RGHLVXVHGIRU)LWQHVVIRU6HUYLFH" :KDW&RGHLVXVHGIRU5LVN%DVHG,QVSHFWLRQ" :KDW$3,&RGHLVXVHGIRUIDEULFDWLRQRIH[FKDQJHUV" :KDW&RGHLVXVHGIRUZHOGLQJRQLQVHUYLFHHTXLSPHQW" :KDW&RGHLVXVHGIRUGHYHORSPHQWRI1'(SURFHGXUHV" :KDW&RGHFDQEHXVHGDVDQDOWHUQDWLYHWRHYDOXDWHSLWWLQJ" :KDW&RGHLVXVHGWRFUHDWHD345" :KDW&RGHLVXVHGWRFUHDWHD:34" :KDW&RGHLVXVHGIRUTXDOLILFDWLRQUHTXLUHPHQWVRID1'( WHFKQLFLDQ" :KDWLVWKHMRLQWFDWHJRU\IRUDORQJLWXQGLQDO ZHOGLQDYHVVHO" :KDWLVWKHMRLQWFDWHJRU\IRUDFLUFXPIHUHQWLDOZHOGLQDYHVVHO" :KDWLVWKH-RLQW(IILFLHQFLHVWKDWFDQEHXVHGZKHQ)8//57LV SHUIRUPHGRQDYHVVHOZLWKDORQJVHDP" :KDWFRGHSURYLGHVJXLGDQFHIRUPDWHULDOYHULILFDWLRQ 30, " :KDWFRGHSURYLGHVJXLGDQFHIRULQVSHFWLRQWHVWLQJDQGPDLQWHQDQFH RIUHOLHIYDOYHV" 7(16,217(67 $60(,; 4: In order for a Tension test to pass, the specimen shall have a tensile strength of not less than; a) MSTS of the base metal (when it fails in weld) b) MSTS of the weaker of the two metals joined together (when it fails in the weld) c) 95% of the MSTS of base metal (when it fails in the base metal). 127(/2$'LVDPHDVXUHRIWKHVWUHVV QHHGHGWRSXOOWKH7(16,21VSHFLPHQDSDUW LHIDLOXUH FailureȱStressȱorȱUltimateȱStressȱ=ȱȱLoad/Areaȱ Load isȱtheȱamountȱofȱstressȱrequiredȱtoȱpullȱtheȱtensileȱspecimensȱapart Area ofȱaȱtensileȱspecimenȱisȱtheȱwidthȱxȱthickness 38 3UDFWLFH4XHVWLRQV IRU7HQVLRQ7HVW 3UDFWLFH4XHVWLRQ $ UHGXFHGVHFWLRQWHQVLRQWHVWVSHFLPHQEURNHLQWKHZHOGDWOEV6SHFLPHQPHDVXUHV´[ò´:KDWLV XOWLPDWHVWUHVVRIWKLVVSHFLPHQ" 6WUHVV /RDGDUHD 4:SDJH 3UDFWLFH4XHVWLRQ $ UHGXFHGVHFWLRQWHQVLRQWHVWVSHFLPHQEURNHLQWKHEDVHPHWDO%RWKSDUWVDUH$*U &6SHFLPHQPHDVXUHV´[ ò´:KDWLVWKHPLQLPXPDOORZHGIDLOXUHVWUHVV" 6WUHVV /RDGDUHD 4: 4:SDJH 3UDFWLFH4XHVWLRQ $UHGXFHGVHFWLRQWHQVLRQWHVWVSHFLPHQ EURNHQLQWKH+$=7KHWHVWFRXSRQLV´VFK SLSHZLWKRQHVLGHEHLQJ 6$)DQGRWKHU6$7\SH/6SHFLPHQPHDVXUHVô´[ò´8OWLPDWHIDLOXUHVWUHVVZDVSVL ,VWKLVWHQVLRQWHVWDFFHSWDEOH $FFHSWDEOH 6WUHVV 0676RI/RZHVWUDWHGPDWHULDO 4: 4:SDJH 39 3UDFWLFH4XHVWLRQV IRU7HQVLRQ7HVW 3UDFWLFH4XHVWLRQ $ UHGXFHGVHFWLRQWHQVLRQWHVWVSHFLPHQEURNHLQWKHZHOGDWOEV6SHFLPHQPHDVXUHV´[ò´:KDWLV XOWLPDWHVWUHVVRIWKLVVSHFLPHQ" 6WUHVV /RDGDUHD 3UDFWLFH4XHVWLRQ 4: 4:SDJH $ UHGXFHGVHFWLRQWHQVLRQWHVWVSHFLPHQEURNHLQWKHEDVHPHWDO%RWKSDUWVDUH$*U6SHFLPHQPHDVXUHV´[ ò´:KDWLVWKHPLQLPXPDOORZHGIDLOXUHVWUHVV" 3UDFWLFH4XHVWLRQ 4: 4:SDJH $UHGXFHGVHFWLRQWHQVLRQWHVWVSHFLPHQ EURNHQLQWKH+$=7KHWHVWFRXSRQLV´VFK SLSHZLWKRQHVLGHEHLQJ $*UDQGRWKHU$7\SH/6SHFLPHQPHDVXUHVô´[ò´8OWLPDWHIDLOXUHVWUHVVZDVSVL,VWKLV WHQVLRQWHVWDFFHSWDEOH $FFHSWDEOH 6WUHVV 0676RI/RZHVWUDWHGPDWHULDO 4: 4:SDJH 40 Bend Test - Specimens 7UDQVYHUVH %HQG /RQJLWXGLQDO %HQG 41 Bend Test QW141.2 – Bend Test 4:SDJH A. B. Face and Root Bend Test 4: D SDJHIRU:36345DQG4: D SDJH:34 These two test are always done together. Therefore, what ever # of face bends are required, the same number of root bends are also required. Side bends are only performed with other side bends (i.e. you will never see face, root AND side bends required). Side bends are only required for “THICKER” materials (i.e. ¾” or greater in thickness). See Table QW 451.1(a) on page 147. Acceptance Criteria 1. 2. 3. $UWLFOH,9 4: 4: Side Bend Test $UWLFOH, Used to determine “degree of soundness and ductility” of groove weld joints. Types of Test - Face, Root, and Side bends (determined by which face is on “Convex” side) 4:SDJH $UWLFOH, Weld and Haz must be in the bent portion of bend. No open discontinuity in weld or HAZ > 1/8” in any direction on convex surface Open discontinuity at the corners are acceptable,unless result from LOF, slag or internal discontinuities 127('XFWLOLW\LVDPDWHULDOVDELOLW\WREHVKDSHGZLWKRXWEUHDNLQJ 3UDFWLFH4XHVWLRQV IRU%HQG7HVW 3UDFWLFH4XHVWLRQ :KDWW\SHRIEHQG LVEHLQJSHUIRUPHGLQ)LJXUH³%´" ³7UDQVYHUVH´5RRW%HQG Figure“A” Figure“B” Figure“C” 43 3UDFWLFH4XHVWLRQV IRU%HQG7HVW 3UDFWLFH4XHVWLRQ :KDWW\SHRIEHQG LVUHSUHVHQWHGE\)LJXUH³$´" ³7UDQVYHUVH´)DFH%HQG Figure“A” Figure“B” Figure“C” 44 Visual Examinations QW144 – Visual Examination A. Used to determine if welds meet “q quality standards” B. Required for “PERFORMANCE” test, not PQR. 4:SDJH QW-194 Acceptance Criteria 1. Welds must be inspected after welding is complete and before specimens are removed (see QW-302.4) $UWLFOH,,, 2. Must have complete Joint penetration 3. Must have complete fusion of weld metal and base metal $UWLFOH, 4:SDJH Radiography QW142 – Radiography 4:SDJH 1. May be substituted for Groove weld Mechanical Test for WELDERS. QW-191 Acceptance Criteria $UWLFOH, 4:SDJH 1. No cracks, Lack of Fusion (LOF) or Incomplete Penetration (IP) 2. Elongated slag inclusions (i.e. indication is 3 times longer than width), max size permitted; 1. 2. 3. 4. Max length of 1/8” - for t up to 3/8” Max length of 1/3 t - for t > 3/8” but < 2 ¼” Max length ¾” - for t > 2 ¼” Aligned inclusions with aggregate length > t in 12t length of weld 3. Rounded Indications 1. Smaller of 20% of t or 1/8” 2. For clustered, assorted or randomly dispersed configurations, see Appendix I :KDWLVWKH-RLQW(IILFLHQF\WKDWFDQEHXVHGZKHQ6SRW57LV SHUIRUPHGRQDYHVVHOZLWKDORQJVHDP" :KDWLVWKHZHOGW\SHFODVVLILFDWLRQIRUDZHOGWKDWLVGRXEOH EXWWZHOG" :KDWLVWKHZHOGW\SHFODVVLILFDWLRQIRUDZHOGWKDWLVVLQJOHZHOGHG ZLWKEDFNLQJ" :KDWLVWKHZHOGW\SHFODVVLILFDWLRQIRUDZHOGWKDWLVVLQJOH ZHOGHGZLWKRXWEDFNLQJ" :KDWYHVVHOVHUYLFHPXVWDOZD\VEHIXOO\UDGLRJUDSKHG" :KDWLVWKHPD[LPXPVHWSUHVVXUHIRUDVLQJOHUHOLHIGHYLFHRQD YHVVHO" :KDWPDUNLQJVKRXOGEHDSSOLHGWRWKHQDPHSODWHWKDWLQGLFDWHVWKH YHVVHOZDV3:+7 G" :KDWPDUNLQJVKRXOGEHDSSOLHGWRWKHQDPHSODWHWKDW LQGLFDWHVWKHYHVVHOLVLQOHWKDOVHUYLFH" :KDWVWDPSLVXVHGRQPRVWSUHVVXUHYHVVHOV" :KDWVWDPSLVXVHGIRUPLQDWXUH YHVVHOV" :KDWVWDPSLVXVHGIRUUHOLHIYDOYHV" 0$:3LVDWWKHBBBBBBBRIDYHVVHO" +RZPXFKZHLJKWLVUHTXLUHGWRFKHFNWKHPDJQHWLFVWUHQJWKRI D$&\RNH" +RZPXFKZHLJKWLVUHTXLUHGWRFKHFNWKHPDJQHWLFVWUHQJWK RID'&\RNH" :KDWLVWKHKROHVL]HWKDWPXVWEHYLVLEOHLQDKROHW\SH,4," :KDWLVWKHPD[LPXPTXDOLILHGWKLFNQHVVRQD:36" :KDWLVWKHPLQLPXPOLJKWLQWHQVLW\DOORZHGZKHQSHUIRUPLQJ07 37RU97" :KDWLVWKHPLQLPXPEODFNOLJKWLQWHQVLW\DOORZHGZKHQ SHUIRUPLQJ07RU37" Welder Qualification Record WelderPerformanceQualification(WPQ) 1. Coupon or production for each welding process (SMAW, GTAW, SAW, etc) 4:SDJH 2. $UWLFOH,,, Qualified by; a. b. Production weld must be examined by RT or UT Coupon can be examined by VT and Mechanical or RT/UT See QW-300.1 NOTE:GMAWͲS“shortͲcircuitingmode”weldscannotbequalifiedbyRT 3. If examination is acceptable, welder is qualified within the limits of QW-304 4. WPQ is welded in accordance with a WPS. Preheat & PWHT required by WPS can be omitted for WPQ 4:SDJH 51 Welder Qualification Record Practice Question # 14 Which of the following cannot be used to qualify a welder? 1. 2. 3. 4. VT & Bend Test RT of 1st Production weld RT of test coupon Tension Test $UWLFOH,,, 4:SDJH 52 WPQ Bend Specimen Requirements Bends $UWLFOH,,, 1. Number of bends? AND 4:SDJH D 3ODWHSHU)LJXUH $UWLFOH,9 4: 4: E 3,3(± QXPEHURIEHQGVUHTXLUHGGHSHQGVRQ326,7,21 V RISLSHGXULQJZHOGLQJ 3LSH SRVLWLRQ * RU * EHQGV UHTXLUHG SHU SDUDJUDSK 4: 3LSH SRVLWLRQ * RU * EHQGV UHTXLUHG SHU QRWHV IRU 4: DQG 4: 3LSH SRVLWLRQ * 4: D SDJH 6HH1RWH * XVLQJ 21( FRXSRQ EHQGV UHTXLUHG SHU QRWHV IRU 4: DQG 4: 53 Bend Specimen Requirements for “Performance Qualification” $UWLFOH,9 Bends 4: 4: 2. Dimensions? )LJXUHV4: D E SDJH VLGHEHQG 3DJH± )DFHDQGURRW 3DJHGRZQ SDJHV 54 WPQ Bend Specimens Bends $UWLFOH,9 4: Where to remove the specimens? 4: FWRJ 4: 3DJHGRZQ SDJHV SDJHWKUX &RXSRQ ZHOGHGLQ *RU *RU *RU* * * LQ³21(´ FRXSRQ 55 Alternative Inspection (RT/UT) for WPQ $UWLFOH,,,VFUROO WR4: 4: Requirements NDE – Alternative Inspection (RT/UT in lieu of BENDS 7HVW&RXSRQ 4:SDJH 3URGXFWLRQ:HOG 1. Minimum Length of weld? ´ 1. Minimum Length of weld? ´XQOHVV*RU* 2. Pipe? )XOO&LUFXPIHUHQFH 2. Welder Operator? 0LQLPXPRIIW SRVLWLRQWKHQ RT cannot be used to test a welder for either of the following; 4:SDJH *0$:6 ± 6KRUWFLUFXLWLQJ PRGH 3 1R 0DWHULDOV 3 WKUX 3 3 WKUX 3 3 WKUX 3 IRU DOO SURFHVV H[FHSW *7$: 56 :HOGHU'LVTXDOLILFDWLRQ5HTXDOLI\ $)DLOV4XDOLILFDWLRQ7HVW 4:SDJH $UWLFOH,,, 4: 1. Fails Visual test; 4:SDJH Qualify by: making 2 coupons, both must pass VT and 1 picked for mechanical testing (bend) 2. Any of the bend test fail; 4:SDJH Qualify by: making 2 coupons, both must pass mechanical test. 3. Fails RT exam; 4:SDJH Qualify by; retest and RT twice the required length of weld %4XDOLILFDWLRQ([SLUHV 4:SDJH 1. Welder has not used the Process for 6 months 2. Reason to question welder’s ability to make sound weld Qualified by; Welding single coupon, plate or pipe, any thickness/diameter/position, VT/Bend or RT. 57 Practice Questions for Welder Qualification Practice Question # 15 RT can be used to qualify a welder, except for the following? 1. 2. 3. 4. Welding P21 material with GTAW process SAW process SMAW Process GMAW process in Short-circuiting mode $UWLFOH,,, 4: :HOGHU Practice Question # 16 A welder is being qualified by welding using ½” thickA106B pipe coupon in 5G position. How many face bends are required? 1. 2. 3. 4. 2 1 3 0 Practice Question # 17 $UWLFOH,9 4: SDJHGRZQ SDJHV A welder is being qualified for 2G and 5G on a single pipe 1” thick coupon (A240 type 304L coupon). How many side bends are required? 1. 2. 3. 4. 6 2 4 0 $UWLFOH,9 4: SDJHGRZQ SDJHV 58 Practice Questions for Welder Qualification Practice Question # 18 Which of the following is the manufacturer/contractor prohibited from delegating to another organization? 1. 2. 3. 4. Preparing test coupons Performing mechanical or NDE inspection of specimens Witnessing the welder making the weld coupon Developing the WPQ record Practice Question # 19 $UWLFOH,,, 3DU4: A welder was making test coupons for a 2G and 5G pipe qualification test and the 2G coupon failed VT examination. In order for the welder to be qualified, which of the following must occur? 1. 2. 3. 4. Make another 1G coupon and either RT or Mechanical Test the coupon Make two 1G coupons and VT and RT examine both coupons Make two 1G coupons and VT both coupons, but only RT one coupon Make two 2G coupons and VT both coupons, but only Mechanical test one coupon $UWLFOH,,, 4:SDU 4: Practice Question # 20 A 6G qualification coupon failed the mechanical testing (one of the bends failed), In order for the welder to be qualified, which of the following is required? $UWLFOH,,, 4:SDU 4: 1. 2. 3. 4. Two more coupons have to be welded and all 4 bends for each of the coupons have to pass mechanical test Two more coupons have to be welded and only one coupon has to pass the required mechanical test Another coupon has to be welded and all 4 bends has to pass mechanical test Two more coupons have to be welded and both coupons must be either pass mechanical testing or RT examined . 59 WPQ “P” Number Qualification Range 4XHVWLRQ :KDW³3´QXPEHU V LVDZHOGHUTXDOLILHGIRULIWKHWHVWFRXSRQ ZDVPDGHRQD6$%136FRXSRQDQGZHOGHGLQWKH*SRVLWLRQ" $UWLFOH,9 4: ) 1XPEHUV “P”number oftest coupon welded “P”number Range qualifiedto weldin FIELD Answer: 31RWKUX) WKUX 60 WPQ “F” Number Qualification Range 4XHVWLRQ $UWLFOH,9 4: SDJHXS WLPH “F”number Range qualifiedto weldin FIELD :KDW³)´QXPEHU V LVDZHOGHUTXDOLILHGIRULIWKHWHVWFRXSRQ ZDVPDGH)ILOOHUPHWDODQGZHOGHGLQWKH*SRVLWLRQ" Qualified with Answer: )1R 61 WPQ # of Bend Specimens 4XHVWLRQ :KDWW\SHEHQGDQGKRZPDQ\EHQGVDUHUHTXLUHGIRUD ZHOGHUWHVWPDGHRQD´[´SLSHFRXSRQZHOGHGLQWKH*SRVLWLRQ" $UWLFOH,9 4: SDJHGRZQ WLPHV Answer: IDFHDQGURRWRUVLGHEHQGV 62 WPQ # of Bend Specimens 4XHVWLRQ :KDWW\SHEHQGDQGKRZPDQ\EHQGVDUHUHTXLUHGIRUD ZHOGHUWHVWPDGHRQD´[´SLSHFRXSRQZHOGHGLQWKH*SRVLWLRQ" $UWLFOH,9 4: SDJHGRZQ WLPHV Answer: IDFHDQGURRWRUVLGHEHQGVWKLVLVDVLQGLFDWHGLQSDU4:SDJH 63 WPQ Thickness Limits 4XHVWLRQ :KDWWKLFNQHVVLVDZHOGHUTXDOLILHGIRULIWKHTXDOLILFDWLRQFRXSRQLV PDGHRQD´[´SLSHFRXSRQZHOGHGLQWKH*SRVLWLRQ" $UWLFOH,9 4: SDJHGRZQ WLPHV Answer: ´XQOHVVWKHZHOGLVPDGHLQOD\HUVWKHQWKLFNQHVVLV³8QOLPLWHG´ 64 WPQ Diameter Limits 4XHVWLRQ :KDWGLDPHWHULVDZHOGHUTXDOLILHGIRULIWKHTXDOLILFDWLRQFRXSRQLV PDGHRQD136[´SLSHFRXSRQZHOGHGLQWKH*SRVLWLRQ" $UWLFOH,9 4: SDJHGRZQ WLPHV Answer: ´2'WR8QOLPLWHG´ 65 WPQ Position Limits 4XHVWLRQ :KDWSRVLWLRQLVDZHOGHUTXDOLILHGIRULIWKHTXDOLILFDWLRQFRXSRQLV PDGHRQD136[´SLSHZHOGHGLQYHUWLFDOSRVLWLRQ" $UWLFOH,9 4:SDJH GRZQWLPHV Answer: )9DQG2 66 Welder Qualification Record WPQ Record 0XVWFRQWDLQIROORZLQJ $UWLFOH,,, 4: 4:SDJH 1. Variables used (i.e. process, type(manual/automatic, with/without backing, P-No, F-No, etc) 2. Essential Variables (i.e. joints, Base metal, Filler Metal, Position, etc) 3. Type of Test (i.e. VT, Bends and/or RT/UT) 4. Test Results (i.e. Acceptable or Failed) 5. Ranges Qualified – (i.e. thickness range, Positions, Diameters, fillet welds) 6. Certification (i.e. signature of Manufacturer/Contractor) 67 WPQ – Essential Variables Essential Variables Paragraph QW402 Joints QW403 BaseMetals $UWLFOH,,, 4: QW404Filler Metals QW405 Positions Variable Process SAW SMAW GTAW X X .4 Ͳ Backing .16 ØPipeDiameter X X X .18 ØPͲNumber X X X .14 ± Filler .15 ØFͲNumber .22 ± Inserts X .23 ØSolidormetalͲcoredto fluxcore X .30 ØtWelddeposit .1 X X X X X X X X X X X X .3 +Position QW408 Gas .8 ØјљVerƟcalwelding X QW409 Electrical .4 ØCurrentorpolarity X 68 &RPSOHWLQJD:345HFRUG Step1 DetermineWhatweldingPROCESSandTYPEusedtomaketestcoupon SMAWandManual ThesearesetbyWPS Step2 Findthe“Essential”variablesfortheweldingprocessusedinASMEIX. Page57 Step3 CompleteTestingVariablesandQualificationLimits(“RangeQualified” section) QW353forSMAW WeldingVariables(QW350) WeldingProcess(es) Type(i.e.manual,semi-automatic)used 3. Backing(withorwithout) (QW402.4) 4. x TestCouponProductionWeld(dia ifpipe) (QW403.16Base) 5. BasemetalP-NumbertoP-Number (QW403.18P-Number) 6. FillerMetalorElectrodeSpec(SFA) 7. FillerMetalF-Number(QW404.15F-Number) 8. ConsumableInsert(GTAWorPAW) 9. FillerMetalType(solid/metalorfluxcored/powder) 1. 2. ActualVariables SMAW Manual None 6”NPS P1toP1 5.1 F3 N/A N/A QW353forSMAW RangeQualified SMAW . Manual F1toF3with,F3wo 27/8”OD P1-P15F,P34,P41-49 -------_F1,F2,andF3 ------------ ------------ $UWLFOH,9 4: SDJHXS WLPH $UWLFOH,9 4: SDJHGRZQ WLPHV $UWLFOH,9 4: $UWLFOH,9 4: SDJHXS WLPH 69 &RPSOHWLQJD:345HFRUG FRQW WeldingVariables(QW350) 10. DepositedThicknessforeachprocess(QW403.30) a. b. 11. Process1: SMAW 3layersminimumYesNo x Process2: SMAW 3layersminimumYesNo Positionqualified(1G,2G,3G,4G,5G,6G,etc) ActualVariables . .280” . ------ . 2G RangeQualified . ------------ . F,H 12. Verticalprogression(uphillordownhill) . Uphill n/ahorz 13. InertGasBacking(GTAW,PAW,GMAW) . N/A ------------ 14. GMAWTransfermode(Spray,Globular,Pulse,orShortCircuit) 15. GTAWCurrenttype/polarity(AC,DCEP,DCEN) N/A N/A . . ------------ . $UWLFOH,9 4: SDJHGRZQ WLPHV $UWLFOH,9 4:SDJH GRZQ WLPHV 6HH4: RQ 3DJH ------------ ________________________________________________________________________________________________________________ Step4 Complete“Results:sectionandthenSignandDateForm That’sIT,youjustcompletedaWPQRECORD 70 3UDFWLFH4XHVWLRQ IRU :HOGHUV4XDOLILFDWLRQ5HFRUG PracticeQuestion#28 WeldingVariables(QW350) DetermineifEssential Variablesare“Correct” 1. WeldingProcess(es) 2. Type(i.e.manual,semi-automatic)used 3. Backing(withorwithout) 4. xTestCouponProductionWeld(dia ifpipe) 5. BasemetalP-NumbertoP-Number 6. FillerMetalorElectrodeSpec(SFA) FillerMetalF-Number 7. 8. ConsumableInsert(GTAWorPAW) 9. FillerMetalType(solid/metalorfluxcored/powder) . 10. DepositedThicknessforeachprocess x a. Process1: SMAW 3layersminimumYesNo b. Process1: SMAW 3layersminimumYesNo 11. Positionqualified(1G,2G,3G,4G,5G,6G,etc) 12. Verticalprogression(uphillordownhill) 13. InertGasBacking(GTAW,PAW,GMAW) 14. GMAWTransfermode(Spray,Globular,Pulse,orShortCircuit) 15. GTAWCurrenttype/polarity(AC,DCEP,DCEN) ActualVariables . SMAW . Manual . . . . With 3” P3 5.4 F3 N/A N/A .300” ------6G Downhill N/A N/A N/A $UWLFOH,9 4: SDJHXS WLPH RangeQualified .. SMAW . . Manual . F1,F2&F3with 27/8”MintoUnlimited . P1-P15F,P34,P41-49 . . --------. F1,F2,andF3 . -------. -------. Max of .600” . -------ALL . . Downhill only . -------. -------. -------- $UWLFOH,9 4: SDJHGRZQ WLPHV $UWLFOH,9 4: $UWLFOH,9 4: SDJHXS WLPH $UWLFOH,9 4: SDJHGRZQ WLPHV $UWLFOH,9 4:SDJH GRZQWLPHV 6HH4: RQ 3DJH 71 *RWRSDJH SDU WPQ WeldingVariables $UWLFOH,9 4: SDJHGRZQ WLPHV X $UWLFOH,9 4: X $UWLFOH,9 4: SDJH83 WLPHV $UWLFOH,9 4: SDJHGRZQ WLPHV $UWLFOH,9 4:SDJH GRZQWLPHV X X X X X *RWRSDJH SDU 72 WPQ WeldingVariables 5HIHUHQFH:34 IRU³0U52'%851(5´WRDQVZHUWKHIROORZLQJTXHVWLRQV $UWLFOH,9 4: SDJHGRZQ WLPH $UWLFOH,9 4: SDJHGRZQ WLPHV $UWLFOH,9 4: $UWLFOH,9 4: SDJH83 WLPH $UWLFOH,9 4: SDJHGRZQ WLPHV $UWLFOH,9 4:SDJH GRZQWLPHV 73 WPQ WeldingVariables ReferenceWPQ Ͳ MR.RODBURNERtoanswerthefollowingquestions; :KDW³)´QXPEHUVLV0U5RG%XUQHUTXDOLILHGIRU" $UWLFOH,9 4: SDJH83 WLPH :KDW³SLSHGLDPHWHU´LV0U5RG%XUQHUTXDOLILHGIRU" :KDW³3´QXPEHULV0U5RG%XUQHUTXDOLILHGIRU" $UWLFOH,9 4: SDJHGRZQ WLPHV $UWLFOH,9 4: :KDWWKLFNQHVVUDQJHLV0U5RG%XUQHUTXDOLILHGIRU" :KDW³SRVLWLRQV´LV0U5RG%XUQHUTXDOLILHGIRU" +RZPDQ\%HQGVSHFLPHQVDUHUHTXLUHGLIWHVWHGE\ EHQGV" $UWLFOH,9 4: SDJHGRZQ WLPHV $UWLFOH,9 4:SDJH GRZQWLPHV $UWLFOH,9 4: SDJHGRZQ WLPHV 74 :KDWOHWWHULVXVHGGXULQJUDGLRJUDSK\WRGHWHUPLQHLIWKHILOPLV SURSHUO\SURWHFWHGIURPEDFNVFDWWHU" :KDWOHDGOHWWHULVXVHGGXULQJUDGLRJUDSK\WRVLJQLI\WKDWD ILOPVLGH,4,LVEHLQJXVHG" :KDWDUHWKHWZRPDLQJDPPDUD\LVRWRSHVXVHGIRULQGXVWULDO UDGLRJUDSK\" :KDWLVWKHPLQLPXPUHFRPPHQGHGUHVLVWDQFHRIDJURXQGLQJ V\VWHP" :KDWLVWKHPD[LPXPUHFRPPHQGHGUHVLVWDQFHRIDJURXQGLQJ V\VWHP" +RZVKRXOGDUHOLHIYDOYHEHWUDQVSRUWHG" :KDWLVWKHPLQLPXPWDSHUUHTXLUHGIRUDSUHVVXUHYHVVHOVKHOOZLWK PLVPDWFK" :KDWSRVLWLRQTXDOLILHVDZHOGHUIRUDOOSRVLWLRQV" :KDWYDULDEOHVDUHUHTXLUHGWREHRQD:36" :KDWYDULDEOHVDUHUHTXLUHGWREHRQD345" $ZHOGHUFDQEHTXDOLILHGE\UDGLRJUDSK\IRUDOOSURFHVVHVH[FHSW" +RZPDQ\&0/ VVKRXOGEHXVHGIRU DWKLFNQHVVLQVSHFWLRQRI YHVVHO" :KDWGRHVDZHOGHUTXDOLILFDWLRQWHVWGHWHUPLQH" :KDWGRHVDJXLGHGEHQGWHVWGHWHUPLQH" :KDWGRHVD&KDUS\LPSDFWWHVWGHWHUPLQH" :KDWPXVWEHLQWKHEHQWSRUWLRQRIDJXLGHGEHQGVSHFLPHQ" $ZHOGHUFDQQRWEHTXDOLILHGE\57IRUZKDWZHOGLQJSURFHVV" Welding Procedure - Requirements (WPS) 1. WPSrequirements (QW-200.1,page14) a. WPSprovidesdirectionsformakingproductionwelds. b. Mustcontainessential,nonessentialandwhenrequired supplementaryvariables. 1) $UWLFOH,, MustreferencethesupportingPQR c. Changescanbemadeto“nonessential”variableswithout requalification.Changesto“essentialorsupplementary”variables requirerequalification. d. FormatofWPSmaybeanyformataslongaseveryessential, nonessentialandsupplementaryvariableisincluded. e. WPSmustbereadilyavailableatthefabricationsiteforreview by welderandinspector. 79 Welding Procedure – Requirements (PQR) 345UHTXLUHPHQWV 4:SDJH $UWLFOH,, a. IsaRecordoftheweldingdatausedtomakethetestcouponand mechanicaltestresults. a. Must; 1) Containessential andsupplementaryvariables(supplementalisnotAPI570Exam). 2) Recordrangeofvariablesusedtomakethecouponmustbeincluded 3) Becertifiedbythemanufacturer/contractor(i.e.signedanddated). b. ChangestothePQRarenotallowed,exceptforeditorialtypechanges(i.e.P#entered incorrectly,orCodechangestheF#forthematerialsused,etc.)AllchangestoaPQR, requirerecertification(i.e.signedanddatedbymanufacturer/contractor). c. Formatmaybeanyformataslongfollowingareincluded; a. Essentialandsupplementaryvariables b. Typeofmechanicaltest,numberoftestsandtestresults d. PQRmustbeavailablefortheAI,butnotthewelder. e. TherecouldbemultiplePQR’ssupportingoneWPSormultipleWPS’sforasinglePQR. 80 6WHSVWR48$/,)<D:HOGLQJ3URFHGXUH 1. WPS ispreparedforproductionweldsthataretobemade. (QW-100) 2. Welder(employeeorcontractedout),makesaTestCouponusingdirectionsfrom theWPS. (QW-201) 3. Thecouponismechanicallytested- BendsandTensiontest (RTisnotallowed). 4. Ifmechanicaltestingisacceptable,WPSisQualifiedwithinrangessetby variables usedtomakethetestcoupon. (QW-202.2) 5. PQRisarecordcreatedbasedonvariablesusedtomakethetestcouponand subsequentmechanicaltestingresults. NOTE:PQR“Must” besignedanddatedtobeCERTIFIED. 81 'LIIHUHQFHEHWZHHQ :36345 DQG :34 1. WhatisthedifferencebetweentheProcedureQUALIFICATIONand WelderQUALIFICATION? A. ProcedurequalificationrequiresTWOdocuments(WPS/PQR). B. Examinationsaredifferent; 1) WPS/PQR– requiresBends/TensiontestandCharpy testwhennotch toughnessisrequired.Also,HardnesswhenPWHT’d. 2) WPQ– requiresVTandBendtestorRT/UTexamination. C. WPQonlyrequires“Essential”variablestoberecorded, whiletheWPSmustrecord“Essential,Non-EssentialandSupplementary (whenrequired)variables”. PQRmustrecord“EssentialandSupplementary”variables. 82 %DVLF6WHSVRI5HYLHZLQJ :36345 1. VerifyWPShasbeenproperlycompletedandaddressesrequirements ofSectionIX (forAPIExam,meansEssentialVariablesandNon-Essentialvariablesare addressed)API577par6.4page18 2. VerifyPQRhasbeenproperlycompletedandaddressesrequirements ofSectionIX (forAPIExam,meansEssentialVariablesareaddressedandPQRissignedand dated)API577par6.4page18 3. VerifyPQRessentialvariablesproperlysupporttherangespecifiedin WPS (forAPIExam,meansEssentialVariablesareaddressedandPQRissignedanddated)API577 par6.4page18 83 :363455HYLHZ,QVWUXFWLRQV INSTRUCTIONSforCheckingWPSandPQR STEP1 Locatetheappropriate“WeldingVariablesChart”fortheWeldingPROCESS(i.e.SMAW– QW253,SAW-QW254orGTAWQW256……thesearetheonlythreethatwillbeontheAPIExam). STEP2 VerifyPQRissignedbyManufacture/Contractor– QW202(b). STEP3 VerifyWPSreferencesthesupportingPQR– QW201(b). STEP4 VerifyallNon-EssentialvariablesareaddressedontheWPS,andvalidatethatonthechecklist(e.g.enter“OK”or“ERROR”in theVALIDATEcolumn)- QW201(b). STEP5 Listvaluesforall“ESSENTIAL”variablesonChecklistfromthePQR– QW202(b). STEP6 Listvaluesforall“ESSENTIAL”variablesonChecklistfromtheWPS– QW201(b). STEP7 UseSectionIXtodetermineandlistthe“ACCEPTABLE”rangeforallessentialvariables(basedonthePQRresults) STEP8 Comparethe“Acceptable”rangeagainsttheWPSvaluesanddocumentthefindingsinthe“VALIDATE”column. STEP9 CheckTESTINGdataonPQRandverifycorrecttype/numberofBENDspecimens(i.e.2face&2Root,etc)weretestedand resultsareacceptableorrejectable.Recordanswerin“Validate”columnofchecklist. STEP10 CheckTESTINGdataonPQRandverifycorrecttype/numberofTENSILEspecimens(i.e.2ormore,dependingonthickness) weretestedandresultsareacceptableorrejectable.Recordanswerin“Validate”columnofchecklist. STEP11 CheckforP-Noand/orF-Nomistakes. 84 Practice Question for Reviewing WPS/PQR 3UDFWLFH4XHVWLRQ 5HYLHZ:36-&33DQG345-&334 1.)IsthePQRsigned&dated? 2.)NowchecktheEssential,Non-essentialvariablesandrangesqualified 85 WPS/PQR“Review”Results $UWLFOH,9JCPP101 4: JCPPQ101 ReviewofWPS# Rev# 0 Dated: SupportingPQR# Rev# 0 Dated: Paragraph BriefofVariables Essential Par4: QW402Joints $UWLFOH,9 QW403 4: BaseMetals Par4: QW404Filler Metals Par4: QW405Positions 4: QW406Preheat QW407PWHT Par4: QW409Electric Par4: Par4: QW410 Technique Par4: 9/11/2001 9/12/2001 STEP4 STEP5 NonͲEssential PQR .1 I GrooveDesign NE Ͳ .4 - NE Ͳ .10 I Rootspacing NE Ͳ .11 r Retainers NE Ͳ Backing STEP6 WPS ½” ½”thk 1/16”to1” ½”thk P1 SA53GrB(P1_) F3 F-4 1 1 STEP7 Validate QualifiedFor? OKorError ----------------3/16”to1” ½”plateN/A P1 F3 1 ----Maxof1” --------- OK OK OK OK PQRshouldbe1/16”to1” .8 I Tqualified E .9 tPass>½inch E .11 I PͲNo.qualified E .4 I FͲNumber E .5 I AͲNumber E .6 I Diameter .30 It .33 I AWSClassification NE .1 +Position NE .3 I np Verticalwelding NE 1. Decrease>100oF .2 I Preheatmaintenance .1 I PWHT E .4 Tlimits E .4 I Currentorpolarity NE Ͳ .8 I I&Erange NE Ͳ .1 I String/Weave NE Ͳ .5 I Methodofcleaning NE Ͳ .6 I Methodbackgouge NE Ͳ ----- .9 I Multitosinglepass/side NE Ͳ ----- OK ----- OK NE E Ͳ ½” Ͳ Ͳ Ͳ 50oF E NE None ----- .25 I Manualorautomatic NE Ͳ r Peening NE Ͳ .64 UseofThermalProcesses None ----- ERROR– shouldbeF3 OK OK OK OK OK OK 50oF 50oF OK None None OK Ͳ .26 E 1/16”to1” OK OK ----- None ----- ----- ----------------- -------None OK OK OK OK OK OK OK OK OK 86 WPS/PQR“Review”Results Numberofbends Required OnPQR (#&Type) (#&Type) 2F&2ROR4S 4SIDES NOTE: BENDSPECIMENS Results AllowableDefects OnPQR 1/8” OK Validate (OkorError) OK 1.OpendiscontinuityinweldorHAZ<1/8”(SeeQW-163,page6) 2.Ignoreopendiscontinuityoncorners,unlessresultfromLOF,Slagorinternaldiscontinuity TENSILESPECIMENS CompareResults Ultimate MSTSofBase Failure #onPQR Metal Stress NumberofTensileSpecimens #Required 2 2 60,000PSI 57,038Base 66,158Weld $UWLFOH,9 4: Validate (OkorError) OK NOTE:1.FailureStress(failedin“BaseMetal”)mustbe .95%ofMSTS(seeQW-153,page4) 2.FailureStress(failedin“WELD”)mustbe MSTS(QW-153) 3.Verifythatthe“UltimateFailureStress” iscalculatedproperly(S=Load/Area)– (seeQW-152,page4) CheckforP-No,F-Noand/orSpecificationmistakesontheWPS/PQR. Results- NoF-NoorP-Noerrors. 87 Practice Questions for Reviewing WPS/PQR Practice Question # 30 IstheP#qualifiedinaccordancewithASMESectionIX? Result– Yes,P8 (VVHQWLDO $60(6HF ,;4: SDJH :36-&33 6XSSOHPHQWDU\ (VVHQWLDO 345-&334 $UWLFOH,9 4: 1RQHVVHQWLDO $UWLFOH,9 4:SDJH GRZQWLPH Ifyoudon’tknowSA240Type304isP8,thenlookitupatP-NoTab 88 Practice Questions for Reviewing WPS/PQR 8VH:36-&33DQG345-&334WRDQVZHUWKHIROORZLQJTXHVWLRQV Practice Question # 31 $UWLFOH,9 4: IsthebasemetalthicknessinaccordancewithASMESectionIX? Result– No,PQRcouponwas½”whichqualifiesthk rangeof3/16”to1”, WPSindicated1/16”to1” 89 Practice Questions for Reviewing WPS/PQR 8VH:36-&33DQG345-&334WRDQVZHUWKHIROORZLQJTXHVWLRQV Practice Question # 32 IstheshieldinggasinaccordancewithASMESectionIX? Result– NO,WPSisforsinglegas(argon)andPQRisfor75/25mix Essential (VVHQWLDO 9DULDEOHV IRU*7$: RQ3DJH $UWLFOH,, 4:4: SDJH GRZQWLPHV ,QGLFDWHV12&+$1*(SHUPLWWHG³³ 90 Practice Questions for Reviewing WPS/PQR 8VH:36-&33DQG345-&334WRDQVZHUWKHIROORZLQJTXHVWLRQV Practice Question # 33 IstheF#qualifiedinaccordancewithASMESectionIX? Result– NO,ER304isF6&E7018isaF4 $UWLFOH,, 7DEOH4: 3DU4: 7DEOH4: (LV) (5LV) 91 Practice Questions for Reviewing WPS/PQR 8VH:36-&33DQG345-&334WRDQVZHUWKLVTXHVWLRQ Practice Question # 34 ArethetensiletestinaccordancewithASMESectionIX? 1R %DVHPHWDOIDLOHGDWVWUHVVOHVVWKDQ[ DQG :HOGPHWDOIDLOHGDWDVWUHVVOHVVWKHQ %DVHPHWDOIDLOXUHVWUHVVZDVSVLZKLFKLVOHVVWKDQRI [ $UWLFOH,9 4:SDJH GRZQWLPH :HOGPHWDOIDLOXUHVWUHVVZDVSVLZKLFKLVOHVVWKDQ0676IRU6$7\SH LH 3HUSDU4: G LIVSHFLPHQEUHDNVLQWKHEDVHPHWDO RXWVLGHRIWKHZHOGRUZHOGLQWHUIDFHWHVWLVDFFHSWDEOH SURYLGHGWKHVWUHQJWKLVQRWPRUHWKDQEHORZWKH 0676RIWKHEDVHPHWDOEHORZ [0676 6$7\SH%DVH PHWDOLVRQ3DJH $QG0676LVSVL )DLOXUHLQ%DVH0HWDOKDGWREHPRUHWKDQ[SVL SVL 3HUSDU4: D LIVSHFLPHQEUHDNVLQWKHZHOGPHWDO WHVWLVDFFHSWDEOHSURYLGHGWKHVWUHQJWKLVHTXDOWRRU JUHDWHUWKDQ0676RIWKHEDVHPHWDO )DLOXUHLQ:HOGKDVWREHHTXDOWRRUJUHDWHUWKDQWKH0676 6$7\SHLVSVL 0676IRU 92 WPS/PQR 5HIHUHQFH:36 -&3 DQG345 -&334 WRDQVZHUWKHIROORZLQJTXHVWLRQV :KDWLVWKHPD[LPXPWKLFNQHVVTXDOLILHG" 93 WPS/PQR 5HIHUHQFH:36 -&3 DQG345 -&334 WRDQVZHUWKHIROORZLQJTXHVWLRQV :KDWLVWKHPD[LPXPWKLFNQHVVTXDOLILHG" :36-&3 PQRJCPͲPQ101 94 WPS/PQR 5HIHUHQFH:36 -&3 DQG345 -&334 WRDQVZHUWKHIROORZLQJTXHVWLRQV :KDWLVWKHPD[LPXPWKLFNQHVVTXDOLILHG" 2T=2x½”=1” $UWLFOH,9 4: 7DEOH4: 95 WPS/PQR 5HIHUHQFH:36 -&3 DQG345 -&334 WRDQVZHUWKHIROORZLQJ TXHVWLRQV $UWLFOH,9 4: :KDW³3´QXPEHU V FDQEHZHOGHGZLWKWKLVSURFHGXUH" 96 WPS/PQR 5HIHUHQFH:36 -&3 DQG345 -&334 WRDQVZHUWKHIROORZLQJ TXHVWLRQV $UWLFOH,9 4: :KDW³3´QXPEHU V FDQEHZHOGHGZLWKWKLVSURFHGXUH" :36-&3 PQRJCPͲPQ101 SAͲ53Bis“PͲ1 97 WPS/PQR :KDW³3´QXPEHU V FDQEHZHOGHGZLWKWKLVSURFHGXUH" 3 WR3 WeldedPͲ1 WeldedPͲ1 98 WPS/PQR 5HIHUHQFH:36 -&3 DQG345 -&334 WRDQVZHUWKHIROORZLQJTXHVWLRQV :KDWHOHFWURGHVFDQEHXVHGRQSURGXFWLRQZHOGV LH ³)´QXPEHUV " 99 WPS/PQR 5HIHUHQFH:36 -&3 DQG345 -&334 WRDQVZHUWKHIROORZLQJ TXHVWLRQV :KDWHOHFWURGHVFDQEHXVHGRQSURGXFWLRQZHOGV LH ³)´QXPEHUV " PQRJCPͲPQ101 :36-&3 100 WPS/PQR 5HIHUHQFH:36 -&3 DQG345 -&334 WRDQVZHUWKHIROORZLQJTXHVWLRQV :KDWHOHFWURGHVFDQEHXVHGRQSURGXFWLRQZHOGV LH ³)´QXPEHUV " $UWLFOH,, 4: SDJHGRZQ WLPHV Gotopar 404.4 101 WPS/PQR 5HIHUHQFH:36 -&3 DQG345 -&334 WRDQVZHUWKHIROORZLQJTXHVWLRQV :KDWHOHFWURGHVFDQEHXVHGRQSURGXFWLRQZHOGV LH ³)´QXPEHUV " ³)´QXPEHUXVHGWRZHOGWKHFRXSRQ LH) ZDVXVHG ,QRUGHUIRUWKLV345 WR VXSSRUWWKH:36D) HOHFWURGHPXVWEHXVHG $UWLFOH,9 4: SDJHGRZQ WLPH WPS PQR 102 WPS/PQR 5HIHUHQFH:36 -&3 DQG345 -&334 WRDQVZHUWKHIROORZLQJ TXHVWLRQV :KDWWKLFNQHVVUDQJHZDVTXDOLILHGE\WKLV345DQGGRHVLWVXSSRUWWKHUDQJH OLVWHGLQWKH:36" $UWLFOH,9 4: 103 WPS/PQR 5HIHUHQFH:36 -&3 DQG345 -&334 WRDQVZHUWKHIROORZLQJTXHVWLRQV :KDWWKLFNQHVVUDQJHZDVTXDOLILHGE\WKLV345DQGGRHVLWVXSSRUWWKHUDQJH OLVWHGLQWKH:36" $UWLFOH,9 :36-&3 4: PQRJCPͲPQ101 104 WPS/PQR 5HIHUHQFH:36 -&3 DQG345 -&334 WRDQVZHUWKHIROORZLQJTXHVWLRQV :KDWWKLFNQHVVUDQJHZDVTXDOLILHGE\WKLV345DQGGRHVLWVXSSRUWWKHUDQJH OLVWHGLQWKH:36" $UWLFOH,9 ´WR´DQGGRHVQRWVXSSRUWWKH´WR´UDQJHOLVWHGRQWKH:36 4: 7DEOH4: 105 WPS/PQR 5HIHUHQFH:36 -&3 DQG345 -&334 WRDQVZHUWKHIROORZLQJ TXHVWLRQV +RZPDQ\EHQGVSHFLPHQVDUHUHTXLUHGDQGZHUHWKHFRUUHFWEHQGVSHFLPHQV WHVWHG" 106 WPS/PQR 5HIHUHQFH:36 -&3 DQG345 -&334 WRDQVZHUWKHIROORZLQJ TXHVWLRQV +RZPDQ\EHQGVSHFLPHQVDUHUHTXLUHGDQGZHUHWKHFRUUHFWEHQGVSHFLPHQV WHVWHG" $UWLFOH,9 4: PQRJCPͲPQ101 107 WPS/PQR 5HIHUHQFH:36 -&3 DQG345 -&334 WRDQVZHUWKHIROORZLQJ TXHVWLRQV +RZPDQ\EHQGVSHFLPHQVDUHUHTXLUHGDQGZHUHWKHFRUUHFWEHQGVSHFLPHQV WHVWHG" $UWLFOH,9 (LWKHUIDFHDQGURRWVRUVLGHEHQGV<HVVLGHEHQGVZHUHWHVWHG 4: 108 WPS/PQR 5HIHUHQFH:36 -&3 DQG345 -&334 WRDQVZHUWKHIROORZLQJTXHVWLRQV +RZPDQ\WHQVLOHVSHFLPHQVDUHUHTXLUHGDQGDUHWKHUHVXOWVDFFHSWDEOH" 109 WPS/PQR 5HIHUHQFH:36 -&3 DQG345 -&334 WRDQVZHUWKHIROORZLQJTXHVWLRQV +RZPDQ\WHQVLOHVSHFLPHQVDUHUHTXLUHGDQGDUHWKHUHVXOWVDFFHSWDEOH" PQRJCPͲPQ101 110 WPS/PQR 5HIHUHQFH:36 -&3 DQG345 -&334 WRDQVZHUWKHIROORZLQJTXHVWLRQV +RZPDQ\WHQVLOHVSHFLPHQVDUHUHTXLUHGDQGDUHWKHUHVXOWVDFFHSWDEOH" $UWLFOH,9 4: 111 WPS/PQR 5HIHUHQFH:36 -&3 DQG345 -&334 WRDQVZHUWKHIROORZLQJTXHVWLRQV +RZPDQ\WHQVLOHVSHFLPHQVDUHUHTXLUHGDQGDUHWKHUHVXOWVDFFHSWDEOH" WHQVLOHVSHFLPHQVDUHUHTXLUHG<HVERWKSDVVHG PQRJCPͲPQ101 112 WPS/PQR 5HIHUHQFH:36-&3DQG345-&334WRDQVZHUWKHIROORZLQJ TXHVWLRQV :KDWWKLFNQHVVUDQJHLVTXDOLILHG" $UWLFOH,9 4: :KDW³3´QXPEHU V FDQEHZHOGHGZLWKWKLVSURFHGXUH" $UWLFOH,9 4: :KDWHOHFWURGHVFDQEHXVHGRQSURGXFWLRQZHOGV LH ³)´QXPEHUV " Par4: :KDWWKLFNQHVVUDQJHZDVTXDOLILHGE\WKLV345 DQGGRHVLWVXSSRUWWKHUDQJH OLVWHGLQWKH:36" +RZPDQ\EHQGVSHFLPHQVDUHUHTXLUHGDQGZHUHWKHFRUUHFWEHQGVSHFLPHQV WHVWHG" $UWLFOH,9 4: $UWLFOH,9 4: +RZPDQ\WHQVLOHVSHFLPHQVDUHUHTXLUHGDQGDUHWKHUHVXOWVDFFHSWDEOH" Par4: 113 /HVVRQ3ODQ9 *HQHUDO:HOGLQJ5XOHV 1'( $60(6HFWLRQ9,,,$60(9$3,DQG$3, 1 3RVW:HOG+HDW7UHDWPHQW 3:+7 $60(6HFWLRQ9,,, $60(9,,, 6XEVHFWLRQ%8: )DEULFDWLRQSDJHGRZQ WLPHV 8: $60(6(&7,219,,, $60(9,,, 6XEVHFWLRQ&8&6 'HVLJQ8&67DEOH 8&6 3DU8:DQG8&6 PWHT temps, see Table UCS-56 Partial HT requires 5 ft overlap for each successive heats (partial means part cannot fit into furnace) per par UW-40(a)(2). HT of welds includes a zone extend 1t or 2”, whichever is less, beyond each side of the weld (par UW-40(a) No control of temperature up to 800oF. Par UCS-56(c.) Heating rate above 800oF shall not be more than 400oF per hr/max metal thickness. Par UCS-56(d)(1)(2). Variation in temperature cannot exceed 250oF in any 15 ft length of vessel. Par UCS56(d)(2) Holding time is per Table UCS-56 During holding time, temperature cannot vary by more than 150oF. Par UCS-56(d)(3). Cool down rate shall not be more than 500oF per hr/max metal thickness. No control necessary below 800oF. Par UCS-56(d)(5). 2 3RVW:HOG+HDW7UHDWPHQW 3:+7 $60(6HFWLRQ9,,, $60(6(&7,219,,, 7DEOH8&6DQG8&6 $60(9,,, 6XEVHFWLRQ&8&6'HVLJQ 8&6SDJHGRZQWLPHV 7DEOH8&6 $60(9,,, 6XEVHFWLRQ&8&6'HVLJQ 8&6 3 3RVW:HOG+HDW7UHDWPHQW 3:+7 $60(6HFWLRQ9,,, 3UDFWLFH4XHVWLRQ A 2” thick vessel fabricated from SA-516-70N was repaired and PWHT’d at 1000o F. How long should the vessel be maintained at this PWHT temperature? 4 3RVW:HOG+HDW7UHDWPHQW 3:+7 $60(6HFWLRQ9,,, 3UDFWLFH4XHVWLRQ $60(9,,, 6XEVHFWLRQ&8&6'HVLJQ8&6 SDJHGRZQWLPHV 7DEOH8&6 $60(9,,, 6XEVHFWLRQ&8&6'HVLJQ8&6 A 2” thick vessel fabricated from SA-516-70N was repaired and PWHT’d at 1000o F. How long should the vessel be maintained at this PWHT temperature? ANSWER 4hrs &15min 5 3RVW:HOG+HDW7UHDWPHQW 3:+7 $60(6HFWLRQ9,,, 3UDFWLFH4XHVWLRQ A 3” thick vessel fabricated from SA-516-70 was repaired and PWHT’d at 950o F. How long should the vessel be maintained at this PWHT temperature? 6 Post Weld Heat Treatment (PWHT) ( API 510) $3,6HFWLRQSDJHGRZQWLPHV SDU API510 PWHTshouldbemadeasrequiredbyASMECode(Par8.1.6.4) LocalPWHTmaybesubstitutedfor360degreebandingonlocalrepairs(Par 8.1.6.4.1) Ifapprovedbytheengineer. Apreheatof300oForhigherismaintainedduringwelding PWHTtemperaturemaintainedforadistancenotlessthan2xt,fromthetoeoftheweld. Atleasttwothermocouplesmustbeused. MetallurgistapprovesthePWHTprocedureifitisperformedforenvironmentalͲassisted crackingresistance. 7 3UHKHDW $60(6HFWLRQ9,,, $60(6HFWLRQ9,,, 8&6 IfarepairismadetoavesselafterPWHT.AMinimumpreheatof200oFshallbe maintainedduringtherepairforP1materials.And350oFforP3materials.ParUCS56(f)(4)(b). $60(9,,, 6XEVHFWLRQ&8&6'HVLJQ8&6 SDJHGRZQWLPHV 8&6 I E Noweldingrecommendedattemperatureslowerthan0oF.Temperaturesbetween32oF and0oF,surfaceswithin3”oftheweldshouldbeheatedtoaminimumof60oF.Par. UW-30. $60(9,,, 6XEVHFWLRQ%8:8: PWHTcanbeavoidedforcertainthickness.Example:P1between1¼”&1½”doesn’t requiredPWHTifaminimumofa200oFpreheatisappliedduringwelding. $60(9,,, 6XEVHFWLRQ&8&6'HVLJQ8&6 SDJHGRZQWLPHV 1RWH E 8 3UHKHDW $60(6HFWLRQ9,,, $3,6HFWLRQSDJHGRZQWLPHV SDU $3, 3DU Preheat in lieu of PWHT for P1 and P3 materials, provided; 1. Preheat temperature maintained at a minimum of 300oF. 2. Preheat temperature maintained at a distance of 4” or 4t, whichever is greater, on each side of weld 3. Maximum interpass temperature of 600oF 9 $3, *HQHUDO 5HTXLUHPHQWV,QIRUPDWLRQ 6FRSH $3,6FRSH 3URYLGHVJXLGDQFHRQZHOGLQJLQVSHFWLRQZLWKIDEULFDWLRQDQGUHSDLURI5HILQHU\ &KHP 3ODQW HTXLSPHQWSLSLQJ /HDUQLQJWUDLQLQJREWDLQHGIURP$3,FDQQRWUHSODFHWUDLQLQJH[SHULHQFHUHTXLUHGWREHD&:, $3,GRHVQRWUHTXLUHZHOGVWREHLQVSHFWHGQRUGRHVLWUHTXLUHZHOGVWREHLQVSHFWHGWRVSHFLILF WHFKQLTXHVDQGH[WHQW *HQHUDO $3,6HFWLRQ 3DU $´RUVPDOOHUHOHFWURGHVKRXOGEHXVHGIRUWKHVW SDVVRQLQVHUYLFHHTXLSPHQWZLWK $3,$SSHQGL[$ DWKLFNQHVVRIó´RUOHVV$3, SDJHGRZQWLPHV )LJXUH$ :KLFKWZRSURFHVVHVFDQXVHWKLVHOHFWURGH (5;;6; "*0$:DQG*7$: $3, )LJXUH$ 10 $3, *HQHUDO 5HTXLUHPHQWV,QIRUPDWLRQ 'HILQLWLRQV $3, 'HILQLWLRQV &UDFN± IUDFWXUHW\SHGLVFRQWLQXLW\FKDUDFWHUL]HGE\DVKDUSWLSDQGKLJKUDWLRRIOHQJWKWRZLGWK 'HIHFW ± DGLVFRQWLQXLW\WKDWUHQGHUVDSDUWSURGXFWXQDEOHWRPHHWPLQLPXPDFFHSWDQFH VWDQGDUGVVSHFLILFDWLRQV 'LVFRQWLQXLW\ ± LQWHUUXSWLRQLQPDWHULDOEXWLVQRWDGHIHFW +$= ± SRUWLRQRIEDVHPHWDOZKHUHPHFKDQLFDOSURSHUWLHVRUPLFURVWUXFWXUHZHUHDOWHUHGE\KHDW IURPZHOGLQJFXWWLQJ ,4, ± ,PDJH4XDOLW\,QGLFDWRU 11 WeldProcessͲ Schematics 1 2 $3,± :HOGLQJ3URFHVVHV *HQHUDOLQIRUPDWLRQDGYDQWDJHVDQGGLVDGYDQWDJHV 60$:± 6KLHOGHG0HWDO$UF:HOGLQJ )&$:± )OX[&RUH$UF:HOGLQJ D LVPRVWZLGHO\XVHGSURFHVV E 'LVDGYDQWDJHVLQFOXGHORZGHSRVLWLRQ UDWHVDQGVODJPXVWEHUHPRYHG D 6KLHOGLQJJDVHYROYHVIURPIOX[LQVLGHWKHWXEXODU HOHFWURGHZLWKZLWKRXWDGGLWLRQDOVKLHOGLQJ E +LJKGHSRVLWLRQUDWHV KLJKHUWKDQ60$: F HTXLSPHQWLQH[SHQVLYHDQGSRUWDEOH F 6KLHOGLQJSURYLGHGDWWKHVXUIDFHPDNLQJLWPRUHWROHUDQWRIDLUFXUUHQWV WKDQ*0$: *7$:± *DV7XQJVWHQ$UF:HOGLQJ G 'LVDGYDQWDJHVLQFOXGHODUJHYROXPHRIIXPHVHTXLSPHQWLVH[SHQVLYHDQG EDFNLQJPDWHULDOUHTXLUHGIRUURRWSDVVHV D &DQEHXVHGZLWKRUZLWKRXWILOOHUPHWDO H[FHOOHQWURRWSDVVSHQHWUDWLRQDQGKLJKSXULW\ ZHOGV E 'LVDGYDQWDJHVLQFOXGHORZHUGHSRVLWLRQUDWHVWKDQ 60$:ORZWROHUDQFHIRUFRQWDPLQDWHVDQGKDUGWR ZHOGLQGUDIWV *0$:± *DV0HWDO$UF:HOGLQJ D &DQEHRSHUDWHGLQVHPLDXWRPDWLFPDFKLQHRU DXWRPDWLFPRGHV E +LJKHUGHSRVLWLRQUDWHVWKDQ60$:DQGPLQLPDOSRVWZHOGFOHDQLQJ F 'LVDGYDQWDJHVLQFOXGHZHOGLQJPXVWEHVKLHOGHGIRUDLUFXUUHQWV HTXLSPHQWLVH[SHQVLYHDQG*0$:6VXVFHSWLEOHWR/2) 6$:± 6XEPHUJHG$UF:HOGLQJ D 6KLHOGLQJE\EODQNHWRIJUDQXODUIOX[ E 9HU\KLJKGHSRVLWLRQUDWHV F 5HSHDWDEOHKLJKTXDOLW\ZHOGV G 'LVDGYDQWDJHVLQFOXGHKLJKDPSHUDJHSRZHUVXSSO\UHTXLUHGZHOGLV QRWYLVLEOHGXULQJZHOGLQJYHU\FRVWO\HTXLSPHQWDQGOLPLWHGWRVKRS DSSOLFDWLRQVDQGIODWSRVLWLRQ 13 WeldingProcessͲ Productivity 3URGXFWLYLW\&RPSDULVRQE\ :HOGLQJ3URFHVV :HOGLQJ3URFHVV 3RVLWLRQ $PSV $UF7LPH 3URGXFWLYLW\ OEVKU *7$: * DQG* 60$: *DQG* 60$: )/$7 * *0$:6 *DQG* *0$: )/$7 * )&$: *DQG* )&$: )/$7 * 6$: )/$7 * 6$: )/$7 * 14 $3,± :HOGLQJ3URFHGXUHVDQG0DWHULDOV *HQHUDO,QIRUPDWLRQ :36 $3,6HFWLRQ )RUPDWRI:36LVQRWIL[HG $60(6HFWLRQ,;GRHVQRWDOORZIRUFRQWUDFWRU¶VWRXVHHDFKRWKHU¶VZHOGLQJSURFHGXUHV $GGUHVVHVDOOHVVHQWLDO QRQHVVHQWLDO DQGVXSSOHPHQWDU\YDULDEOHV VXSSOHPHQWDU\YDULDEOHVQRW RQ$3,([DP 127((66(17,$/YDULDEOHVDIIHFWWKH³PHFKDQLFDO´SURSHUWLHVRIZHOG 345 )RUPDWRI 345LVQRWIL[HG 5HFRUGV(VVHQWLDOYDULDEOHV1RQHVVHQWLDOYDULDEOHVDUHRSWLRQDO6RIRUWKH$3, ([DPRQO\KDYHWR5(&25'(VVHQWLDOYDULDEOHV 0DQXIDFWXUHUFRQWUDFWRUPXVWVXSHUYLVHPDNLQJRIWKHFRXSRQDQGPXVWFHUWLI\345 SURSHUO\TXDOLILHVWKH:36 LHVLJQDQGGDWH345 :HOGLQJ0DWHULDOV :K\ZHUH31R¶VFUHDWHG" 7RUHGXFHWKHQXPEHURISURFHGXUHV :K\ZHUH)1R¶VFUHDWHG" 7RUHGXFHQXPEHURISURFHGXUHVDQGTXDOLILFDWLRQV $:6FODVVLILFDWLRQ 6)$ SURYLGHV PHDQVWRGHVLJQDWH³VWUHQJWK´³SRVLWLRQ´DQG³&KHPLFDORSHUDWLQJ FKDUDFWHULVWLFV RIWKHZLUHHOHFWURGH ( 7HQVLOHVWUHQJWK³´PHDQV³DOOSRVLWLRQV´DQG³´PHDQVQRQORZK\GURJUHQ'&(1 $1RLVFKHPLFDOFRPSRVLWLRQRIWKHGHSRVLWHGZHOGPHWDO 15 $3,± :HOGHU4XDOLILFDWLRQ 5HTXLUHPHQWV,QIRUPDWLRQ :HOGHU4XDOLILFDWLRQ $3,SDU± SDJH $3,6HFWLRQ )RUPDWRI:34LVQRWIL[HG 3HUIRUPDQFHTXDOLILFDWLRQHVWDEOLVKHVZHOGHU¶VDELOLW\WRGHSRVLWVRXQGZHOGPHWDO 4XDOLILFDWLRQOLPLWHGE\HVVHQWLDOYDULDEOHV 3HUIRUPDQFHTXDOLILFDWLRQVKDOOEHZHOGHGLQDFFRUGDQFHZLWKDQTXDOLILHG:36H[FHSWSUHKHDW 3:+7FDQEHRPLWWHG VHH$60(6HF,;SDUSDJH 5HVSRQVLELOLW\IRUTXDOLI\LQJZHOGHUVLVUHVWULFWHGWRFRQWUDFWRUPDQXIDFWXUHU FDQQRWEH GHOHJDWHG :34UHFRUGLQFOXGHVHVVHQWLDOYDULDEOHVW\SHRIWHVWWHVWUHVXOWVDQGUDQJHVTXDOLILHG ,IPHFKDQLFDOWHVWLQJSHUIRUPHG97PXVWDOVREHSHUIRUPHG :HOGHUTXDOLILFDWLRQH[SLUHVLIWKHZHOGLQJ352&(66LVQRWXVHGGXULQJDVL[PRQWK SHULRG :HOGHUTXDOLILFDWLRQFDQEHUHYRNHGLIWKHUHLVDQ\UHDVRQWRTXHVWLRQWKHLUDELOLW\WR PDNHZHOGV :HOGHU¶VORJRUFRQWLQXLW\UHSRUWFDQEHXVHGWRYHULI\ZHOGHU¶VTXDOLILFDWLRQVDUH FXUUHQW 16 :KDWLVXVHGWRGHWHUPLQHWKHLQVSHFWLRQLQWHUYDORIDUHOLHIYDOYH" :KDWLVWKHGHILQLWLRQRIDUHSDLU" :KDWLVWKHGHILQLWLRQRIDQDOWHUDWLRQ" :KDWFDXVHVIDWLJXHFUDFNLQJ" :KDWDUHWKUHHIDFWRUVDIIHFWLQJFUHHS" 5%,XVHVZKDWIDFWRUV" :KDWZHOGLQJSURFHVVHVFDQEHXVHGZKHQSUHKHDWRUFRQWUROOHG GHSRVLWLRQLVXVHGLQOLHXRI3:+7" 7HPSHUHPEULWWOHPHQWRFFXUVPRUHTXLFNO\WR&U0R VWHHOVDWBBBBBBBBBBBGHJ) :KDWVWDPSLVXVHGIRUUXSWXUHGLVN" :KDWPXVWD69UHSDLURUJDQL]DWLRQKDYH" :KHQDUHEDODQFHGEHOORZVVDIHW\UHOLHIYDOYHVXVHG" :KHQLVSLORWRSHUDWHGXVHG" &DQUXSWXUHGLVFEHXVHGGRZQVWUHDPRI6DIHW\5HOLHIYDOYHV" :KHQZRXOGDUXSWXUHGLVFEHXVHG" :KDWLVWKHPDLQFDXVHIRU69¶VWRPDOIXQFWLRQ" :KDWDUHWKHWZRPDLQFDXVHGIRU69VSULQJVWRPDOIXQFWLRQ" 1'(± $3,DQG$60(9 5HTXLUHPHQWV,QIRUPDWLRQ $60(9$UWLFOH *(1(5$/ $3,6HFWLRQ $3,SDU± SDJH 1'(LVLQVSHFWLRQVZKLFKDOORZPDWHULDOVWREHH[DPLQHGZLWKRXWFKDQJLQJRUGHVWUR\LQJWKHLU XVHIXOQHVV 6HH7DEOHRI$3, SDJH WRXQGHUVWDQGZKLFK1'(PHWKRGLVEHVWVXLWHGWRGHWHFWGLVFRQWLQXLWLHV 97 97LVWKHPRVWH[WHQVLYHO\XVHG1'(PHWKRGIRUZHOGV 97FRQGXFWHGZKHQDFFHVVLVVXIILFLHQWWRDOORZWKHH\HZLWKLQ´WR´RIVXUIDFHDQGDQJOHQRWOHVWKDQ GHJUHHV 3HUVRQQHOVKDOOSDVVDQDQQXDO-OHWWHUVRQMDHJHUYLVLRQWHVW$60(6HF9SDU7 :ULWWHQSURFHGXUHUHTXLUHG $60(6HF97DEOH7FRQWDLQVUHTXLUHPHQWVIRUWKHSURFHGXUH $60(6HF $ELOLW\WRGHWHFWDILQHOLQH ´RUOHVVOLQH LQIDFHRIDVLPLODUSDUWFDQYDOLGDWHSURFHGXUH$60(6HF9 9SDJH SDU7 5HTXLUHG0,1,080OLJKWLQWHQVLW\LVIRRWFDQGOHV OX[ $60(6HF9SDU7 &KHFNOLVW6+$//EHSURYLGHGWRYHULI\WKHUHTXLUHGREVHUYDWLRQVDUHSHUIRUPHG$60(6HF9SDU7 5HFRUGVRI97H[DPLQDWLRQVDUHDVUHTXLUHGE\UHIHUHQFLQJFRGH $60(6HF9SDU7 5HFRUGVRILQGLYLGXDOH[DPLQDWLRQVDUHQRWUHTXLUHGH[FHSWIRUWKRVHRILQSURFHVVH[DPLQDWLRQV 21 1'(± $3,DQG$60(9 5HTXLUHPHQWV,QIRUPDWLRQ $3,6HFWLRQ DQGSDJHGRZQ WLPHV $60(9$UWLFOH 07 $3,SDU± 3HU$60(6HF9SDU7DZULWWHQSURFHGXUHLVUHTXLUHGDQGVKDOOEHXVHGZKHQUHTXLUHGE\ UHIHUHQFLQJFRGH )RUDGGHGVHQVLWLYLW\ZHWIOXRUHVFHQWPDJQHWLFSDUWLFOH :)07 PD\EHXVHG 'LUHFWLRQRIPDJQHWLFIOX[DQGEHFKHFNHGZLWK3,(JDXJH 0D[LPXPVHQVLWLYLW\LVZKHQOLQHVPDJQHWLFIOX[LVSHUSHQGLFXODUWRWKHGLVFRQWLQXLW\ $60(6HF97 7HPSHUDWXUHOLPLWVDUHVHWE\PDQXIDFWXUHURIWKHSDUWLFOHV 3URGWHFKQLTXHFDQEHGLUHFWRUUHFWLILHG $60(6HF97 $60(6HF97F 3URGVSDFLQJVKDOOEHOHVVWKDQ´DQG JUHDWHUWKDQRUHTXDOWR´ $60(6HF97 <RNHWHFKQLTXHFDQEH$&RU'&HOHFWURPDJQHWLFRUSHUPDQHQWPDJQHW\RNHV $60(6HF9SDU7 $&<RNHVKDOOKDYHDOLIWLQJSRZHURIOEV $60(6HF9SDU7E '&<RNHRUSHUPDQHQWPDJQHWLFVKDOOKDYHDOLIWLQJSRZHURIOEV $60(6HF9SDU7F $WOHDVWWZRVHSDUDWHH[DPLQDWLRQVQGEHLQJSHUSHQGLFXODUWRVW $60(6HF9SDU7 )HUURPDJQHWLFSDUWLFOHVFDQEHGU\RUZHW0DJQHWL]LQJFXUUHQWVKDOOUHPDLQRQZKHQDSSO\LQJGU\ SDUWLFOHVDQGWXUQHGRQDIWHUZHWSDUWLFOHVDUHDSSOLHG $60(6HF9SDU7D E 22 1'(± $3,DQG$60(9 5HTXLUHPHQWV,QIRUPDWLRQ 07± &RQW¶G $60(9$UWLFOH ([FHVVGU\SDUWLFOHVVKDOOEHUHPRYHGZLWKDOLJKWDLUVWUHDPIURPDEXOERUV\ULQJHRURWKHUVRXUFHRIORZ SUHVVXUHDLUZKLOHWKHPDJQHWL]LQJFXUUHQWLVPDLQWDLQHG $60(6HF9SDU7 /LJKWLQWHQVLW\IRU³9LVLEOH´07VKDOOEHDPLQLPXPRIIRRWFDQGOHV OX[ $60(6HF9SDU7 /LJKWLQWHQVLW\IRU³:)07´VKDOOEHEODFNOLJKWVZLWKPLQLPXPZFPDWSDUWVXUIDFH $60( 6HF9SDU7 ([DPLQHUPXVWEHLQGDUNHQHGH[DPDUHDIRUDPLQLPXPRIPLQXWHVSULRUWRSHUIRUPLQJH[DP (DFKZHLJKWVKDOOEHZHLJKHGZLWKDVFDOHIURPDUHSXWDEOHPDQXIDFWXUHUDQG67(1&,/('ZLWKWKH DSSOLFDEOHQRPLQDOZHLJKWSULRUWR),56786( $60(6HF9SDU7 23 1'(± $3,DQG$60(9 5HTXLUHPHQWV,QIRUPDWLRQ $3,6HFWLRQ 37 $3,SDU $60(9$UWLFOH (IIHFWLYHLQORFDWLQJVXUIDFHFRQQHFWLQJGLVFRQWLQXLWLHVLQIHUURPDJQHWLFPDWHULDOV 6WDQGDUGSHQHWUDQWV\VWHPOLPLWHGWR) 7ZRJHQHUDOSHQHWUDQWWHFKQLTXHV FRORUFRQWUDVWDQGIOXRUHVFHQW 7KUHHSHQHWUDQWV\VWHPV 6ROYHQWUHPRYDEOHZDWHUZDVKDEOHDQGSRVWHPXOVLILHG 0XVWFOHDQGU\ZLWKLQ´RIWKHDUHDWREHH[DPLQHG $60(6HF97E 3DUWWREHH[DPLQHGPXVWEHEHWZHHQ)DQG) $60(6HF97 )OXRUHVFHQWSHQHWUDQWFDQQRWEHXVHGDIWHUXVLQJFRORUFRQWUDVW $60(6HF9 7 /LJKWPHWHUVVKDOOEHFDOLEUDWHGDWOHDVWRQFHSHU\HDU $60(6HF97 'LHFDQEHDSSOLHGE\GLSSLQJEUXVKLQJRUVSUD\LQJ )OXVKLQJWKHVXUIDFHZLWKVROYHQWIROORZLQJDSSOLFDWLRQRIWKHSHQHWUDQWLVSURKLELWHG $60(6HF9SDU7 0LQLPXPOLJKWLQWHQVLW\RIIRRWFDQGOHVRUOX[ $60(6HF9SDU7 0LQLPXPEODFNOLJKWLQWHQVLW\RI:FPð $60(6HF9SDU7 )LQDOLQWHUSUHWDWLRQVKDOOEHPDGHQRWOHVVWKDQPLQQRUPRUHWKDQPLQDIWHUGHYHORSHULVGU\ $60( 6HF9SDU7DQG7 24 1'(± $3,DQG$60(9 5HTXLUHPHQWV,QIRUPDWLRQ 57 $3,SDUWKUX $3,6HFWLRQ 57LVDYROXPHWULFH[DPLQDWLRQPHWKRG ,4,¶VDUHXVHGWRGHWHUPLQHWKHUHTXLUHGVHQVLWLYLW\LVDFKLHYHGDQGHVWDEOLVKHVWKHTXDOLW\OHYHORIWKH UDGLRJUDSK 7ZRW\SHVRI,4,¶V KROHW\SHDQGZLUHW\SH 7UHSUHVHQWVERWKWKH7+,&.1(66RIWKHKROHW\SHSHQHWUDPHWHU DQGWKHGLDPHWHURIWKH VPDOOHVWKROHLQWKHSHQHWUDPHWHU 7KHKROHLQWKHSHQHWUDPHWHU WKDWLVUHTXLUHGWREHYLVLEOHLVFDOOHGWKH³(VVHQWLDO+ROH´ *DPPDUD\LVRWRSHVXVHGIRUZHOGLQVSHFWLRQLV,ULGLXPDQG&REDOW ,ULGLXPLVQRUPDOO\XVHGIRUVWHHOWKLFNQHVVEHWZHHQó´WR´ &REDOWLVQRUPDOO\XVHGIRUVWHHOWKLFNQHVVEHWZHHQ´WR´ (OOLSWLFDOH[SRVXUHWHFKQLTXHXVHGIRUZHOGVLQFRPSRQHQWV´RUOHVVLQQRPLQDORXWVLGHGLDPHWHU :HOGFUDFNVDUHQRWDOZD\VGHWHFWDEOHE\UDGLRJUDSK\ )LOPGHQVLW\LQDUHDRILQWHUHVWVKRXOGEHZLWKLQWRIRU;UD\DQGWRIRUJDPPDUD\ 'HQVLWRPHWHUPXVWEHFDOLEUDWHGXVLQJDVWHSWDEOHRUVWHSZHGJHWKDWLVWUDFHDEOHWRDQDWLRQDOVWDQGDUG /HDGOHWWHU³%´PHDVXULQJò´WDOO[´WKLFNLVSODFHGRQEDFNRIILOPFDVVHWWHVWRFKHFNIRUEDFNVFDWWHU 25 1'(± $3,DQG$60(9 5HTXLUHPHQWV,QIRUPDWLRQ 57 $3,SDUWKUX $60(9$UWLFOH $3,6HFWLRQ /LJKWLPDJHRIWKHOHDGOHWWHU³%´RQGDUNEDFNJURXQGLQGLFDWHVLQVXIILFLHQWSURWHFWLRQIURPEDFNVFDWWHU 'DUNLPDJHRIWKHOHDGOHWWHU³%´RQDOLJKWEDFNJURXQGLVRIQRFRQFHUQ 'HQVLW\RIWKHILOPFDQEHMXGJHGXVLQJDGHQVLWRPHWHURUVWHSZHGJHFRPSDULVRQILOP $60(6HF9SDU7 'HQVLWRPHWHUVVKDOOEHFDOLEUDWHGDWOHDVWHYHU\GD\V $60(6HF9SDU7 'HQVLWRPHWHUUHDGLQJVPXVWQRWYDU\E\QRPRUHWKDQ GHQVLW\GXULQJFDOLEUDWLRQV $60(6HF97 G ³),/06,'(´SHQHWUDPHWHU FDQRQO\EHXVHGZKHQLWLVQRSRVVLEOHWRXVHD³6285&(6,'(´ SHQHWUDPHWHU $60(6HF97 E ,ID³),/06,'(´SHQHWUDPHWHU LVXVHGDOHDGOHWWHU³)´PXVWEHSODFHGRQRUDGMDFHQWWRWKH,4, $60(6HF 97 E &DOLEUDWLRQRIWKHGHQVLWRPHWHUVKDOOEHYHULILHGDWWKHEHJLQQLQJRIHDFKVKLIWDQGDIWHUKRXUVRI FRQWLQXDOXVH$60(6HF97 D 26 1'( 5HTXLUHPHQWV,QIRUPDWLRQ 3UDFWLFH4XHVWLRQ $60(9$UWLFOH 7SDJHGRZQ WLPHV 7DEOH :KDW,4,LVUHTXLUHGZKHQUDGLRJUDSKLQJWKHIROORZLQJ" Vessel thickness of 1.125”, using a SWE/SWV technique and technician has access to the ID of the vessel. 27 1'( 5HTXLUHPHQWV,QIRUPDWLRQ 3UDFWLFH4XHVWLRQ $60(9$UWLFOH 7SDJHGRZQ WLPHV 7DEOH :KDW,4,LVUHTXLUHGZKHQUDGLRJUDSKLQJWKHIROORZLQJ" Vessel thickness of 1.125”, using a SWE/SWV technique and technician has access to the ID of the vessel. 28 1'( 5HTXLUHPHQWV,QIRUPDWLRQ 3UDFWLFH4XHVWLRQ $60(9$UWLFOH 7SDJHGRZQ WLPHV 7DEOH :KDW,4,LVUHTXLUHGZKHQUDGLRJUDSKLQJWKHIROORZLQJ" Vessel thickness of 1.125”, using a SWE/SWV technique and technician does not have access to the ID of the vessel. 29 1'( 5HTXLUHPHQWV,QIRUPDWLRQ 3UDFWLFH4XHVWLRQ $60(9$UWLFOH 7SDJHGRZQ WLPHV 7DEOH :KDW,4,LVUHTXLUHGZKHQUDGLRJUDSKLQJWKHIROORZLQJ" Vessel thickness of 1.125”, using a SWE/SWV technique and technician does not have access to the ID of the vessel. 30 1'(± $3,DQG$60(9 5HTXLUHPHQWV,QIRUPDWLRQ 87 $3,SDUWKUX $3,6HFWLRQ 87LVFDSDEOHRIGHWHFWLQJVXUIDFHDQGVXEVXUIDFHGLVFRQWLQXLWLHV 6WUDLJKWEHDPWHFKQLTXHLVXVHGIRUWKLFNQHVVDQGFKHFNLQJIRUODPLQDWLRQV $6FDQGLVSOD\LVWKHPRVWFRPPRQGLVSOD\ 6KHDUZDYH DQJOHEHDP WHFKQLTXHLVXVHGWRLGHQWLI\GLVFRQWLQXLWLHVLQZHOGV &DOLEUDWLRQEORFNVKRXOGEHRIVDPHGLDPHWHUWKLFNQHVVDQGKHDWWUHDWPHQWDVWKHSURGXFWH[DPLQHG 7KHWHPSHUDWXUHRIWKHFDOLEUDWLRQEORFNVKRXOGEHZLWKLQ)RIWKHSDUWWREHH[DPLQHG (DFKSDVVRIWKHWUDQVGXFHUVKRXOGRYHUODSWKHSUHYLRXVSDVVE\RIWKHVL]HRIWKHWUDQVGXFHU 5DWHRIVHDUFKVKDOOQRWH[FHHG´SHUVHFRQGXQOHVVWKHFDOLEUDWLRQZDVSHUIRUPHGDWDQLQFUHDVHGVSHHG 6FDQQLQJVKRXOGEHSHUIRUPHGDWDJDLQVHWWLQJDWOHDVWWZRWLPHVWKHUHIHUHQFHOHYHOXVHGGXULQJ FDOLEUDWLRQ G%GURSWHFKQLTXHLVFRPPRQO\XVHGWRGHWHUPLQHWKHOHQJWKRIWKHUHIOHFWRU 31 Welding Procedure (WPS), Procedure Qualification Record (PQR) and Welder Performance Qualification (WPQ) Forms Index x WPS JCP-P101 x PQR JCP-PQ101 x WPS JCP-P201 x PQR JCP-PQ201 x WPS JCP-P301 x PQR JCP-PQ301 x Rod Burner WPQ Form – with qualified range x Rod Burner WPQ Form – without qualified range x Blank WPS Form x Blank PQR Form x Blank WPQ Form ASME Section IX – WPS QW-482 Suggested Format For Welding Procedure Specification (WPS) (See Section IX QW-200.1) Company Name JC Penny By Mr. Penny Welding Procedure Specification No. JCP-P101 Date 9/11/2001 Supporting PQR No.(s)JCP-PQ101 Revision No. 0 Date 9/11/2001 Welding Process(es) SMAW Type(s) Manual Test Description Joints (QW 402) Joint Design Single V Groove and Fillets Root Spacing .0625” to 1.250” Backing: Yes x No x Backing Material (Type) Metal (Refer to both backing and retainers) Metal Nonmetallic Nonfusing Metal Other Sketches, Production drawings, weld symbols, or written description should show the general arrangement of the parts to be welded. Where applicable, the details of weld groove may be specified. (At the option of the manufacturer, sketches may be attached to illustrate joint design, weld layers, and bead sequence (e.g. for notch toughness procedures, for multiple process procedures, etc)). Base Metals (QW 403) P-No. 1 Group No. to P-No. 1 Group No. OR Specification and type/grade to Specification and type/grade OR Chemical Analysis and Mech. Prop. to Chemical Analysis and Mech. Prop. Thickness Range: Base Metal: Groove 1/16” to 1” Fillet All Maximum pass thickness ½” (yes) x (no) Pipe Diameter (Groove) 2 7/8” (Fillet) All Filler Metals (QW 404) Spec. No. (SFA) _ _ _ _ _ _ _ _ _ AWS No. (Class) _ _ _ _ _ _ _ _ _ F-No. _ _ _ _ _ _ _ _ _ _ _ _ _ _ A-No. _ _ _ _ _ _ _ _ _ _ _ _ _ _ Size of Filler Metals_ _ _ _ _ _ _ _ Weld Metal: Thickness Range: Groove_ _ _ _ _ _ _ _ _ _ _ Fillet_ _ _ _ _ _ _ _ _ _ _ _ Electrode-Flux (Class) _ _ _ _ _ _ _ Flux Type_ _ _ _ _ _ _ _ _ _ _ _ _ Consumable Insert_ _ _ _ _ _ _ _ _ Other_ _ _ _ _ _ _ _ _ _ _ _ _ _ _ 1st Filler Metal 5.1 E-7018 3 1 3/32”, 1/8”, 5/16” .0625” to 1.0” .250” to 1.0” N/A N/A N/A 2nd Filler Metal Positions (QW 405) Position(s) of Groove ALL Welding Progression: UP X Position(s) of fillet ALL Preheat (QW 406) Preheat Temp, Min Interpass Temp, Max Preheat Maintenance WPS No. JCP-P101 Postweld Heat Treatment (QW 407) Temperature Range None Time Range Other Down Gas (QW 408) 50oF 350oF None (Continuous or special heating, where applicable, should be recorded. Percent Composition Mixtures Flow Rate Gases N/A Shielding Trailing Backing Other Page of 2 Rev.# 0 Electrical Characteristics (QW 409) Filler Metal Weld Pass(es) Process Classifi -cation Diameter All SMAW E-7018 1/8” Current Type and Polarity DCEP Amps (Range) 70 to 200 Wire Feed Speed (Range) Energy or Power (Range) Volts (Range) Travel Speed (Range) N/A N/A 19 - 25 5 to 7 Other (e.g Remarks, Comments, Hot Wire Addition, Technique, Torch Angle, etc) NOTE: Amps and volts, or power or energy range, should be recorded for each electrode size, position, and thickness, etc Pulsing Current N/A Tungsten Electrode Size and Type N/A Mode of Metal Transfer for GMAW or FCAW Heat Input (max.) (Pure Tungsten, 2% Thoriated, etc) N/A (Spray Arc, Short Circuiting Arc, Globular Arc, etc) Technique (QW 410) String or Weave Bead String or Weave Orifice, Nozzle, or Gas Cup Size N/A Initial and Interpass cleaning (Brushing, Grinding, etc Method of Back Gouging Grinding Oscillation N/A Contact Tube to Work Distance N/A Multiple or Single Pass (per side) Multiple of Single Electrodes Peening N/A Other N/A Grinding, Chipping or Wire Brush Multiple or Single Single Page 2 of 2 ASME Section IX –PQR QW-483 Suggested Format For Procedure Qualification Record (PQR) (See Section IX QW-200.2) Company Name JC Penny PQR No. JCP-PQ101 WPS # JCP-P101 Date 9/12/2001 Welding Process(es) SMAW Type(s) Manual Joints (QW 402) Groove D G Design i off TTest C Coupon Base Metals (QW 403) Material Spec. SA-53 Gr B P-No. to P-No. Thickness of Test Coupon ½” Diameter of Test Coupon 6” Other Postweld Heat Treatment (QW 407) Temperature Range None Time Range Other Gas (QW 408) Filler Metals (QW 404) SFA Specification 5.1 AWS Classification E-7018 Filler Metal F-No. 4 Weld Metal Analysis A-No. 1 Size of Filler Metal 5/32” Other Weld Metal Thickness Positions (QW 405) Position of Groove ALL Weld Progression (Uphill, Downhill) Other Preheat (QW 406) Preheat Temp 50oF Interpass Temp Other Shielding Trailing Backing Gases N/A Percent Composition Mixtures Flow Rate Electrical Characteristics (QW 409) Current DC Polarity Straight Amps: 150-300 Volts 20-28 Tungsten Electrode Size N/A Other Technique (QW 410) Travel Speed 3”/min String or Weave Bead Stringer Oscillation Multipass or Single Pass (per side) Multiple Single or Multiple Electrodes Single Other QW 483 (back) PQR No. JCP-PQ101 Specimen No. Width (inch) .750 .756 T1 T2 SIDE SIDE SIDE SIDE # # # # Specimen No. Thickness (inch) .455 .451 Type and Figure No. 1 2 3 4 Notch Location Area (sq. inches) .341 .341 Ultimate Load (lbs) 19,450 22,560 Guided Bend Tests (QW -160) Ultimate Stress (psi) 57,038 66,158 Test Temp No Impact Values Type of Failure & Location Pass - Base Pass - Weld Results Pass Pass Pass Pass Notch Toughness Tests (QW -170) Notch Type Result – Satisfactory: YES Macro Results Tensile Test (QW -150) Lateral Exp % Shear Mils Fillet Weld Test (QW -180) Penetration into Parent Metal YES Drop Weight Break No Break No Other Tests Type of Test Deposit Analysis Other …………………………………………………………………………………………………………………………………………………………………………………. Welder’s Name Jack Shift Jr Test conducted by: Clock No. Stamp No. Laboratory Test No. B2 We certify that the statements in this record are correct and that the test welds were prepared, welded, and tested in accordance with the requirements of ASME Section IX. Manufacturer Date 9/11/2001 By: JC Penny Jack Shift Sr Page 2 of 2 ASME Section IX – WPS QW-482 Suggested Format For Welding Procedure Specification (WPS) (See Section IX QW-200.1) Company Name JC Penny By Mr. Penny Welding Procedure Specification No. JCP-P201 Date 8/11/2001 Supporting PQR No.(s)JCP-PQ201 Revision No. 0 Date 8/11/2001 Welding Process(es) GTAW Type(s) Manual Test Description Joints (QW 402) Joint Design Single V Groove Root Spacing 1.250” Backing: Yes x No x Backing Material (Type) Solid Metal or weld metal (Refers to both backing and retainers) Metal Nonmetallic Nonfusing Metal Other Sketches, Production drawings, weld symbols, or written description should show the general arrangement of the parts to be welded. Where applicable, the details of weld groove may be specified. (At the option of the manufacturer, sketches may be attached to illustrate joint design, weld layers, and bead sequence (e.g. for notch toughness procedures, for multiple process procedures, etc)). Base Metals (QW 403) P-No. Group No. to P-No. Group No. OR Specification and type/grade SA 240 Type 304 to Specification and type/grade SA 240 Type 304 OR Chemical Analysis and Mech. Prop. to Chemical Analysis and Mech. Prop. Thickness Range: Base Metal: Groove 1/16” to 1” Fillet All Maximum pass thickness ½” (yes) x (no) Pipe Diameter (Groove) 2 7/8” (Fillet) All Filler Metals (QW 404) Spec. No. (SFA): 5.9 AWS No. (Class): ER304 F-No.: F-6 A-No.: A-8 Size of Filler Metals: 3/32”, 1/8”,5/16” Weld MetalThickness Range: Groove: .0625” to 1.0” Fillet: No limit Electrode-Flux (Class): Flux Type: Consumable Insert: Other: N/A N/A None N/A No single pass > ½” Positions (QW 405) Position(s) of Groove ALL Welding Progression: UP X Position(s) of fillet ALL Preheat (QW 406) Preheat Temp, Min Interpass Temp, Max Preheat Maintenance Page of 2 Rev.# 0 WPS No. JCP-P201 Postweld Heat Treatment (QW 407) Temperature Range None Time Range Other Down Gas (QW 408) 80oF 350oF None (Continuous or special heating, where applicable, should be recorded. Gases Argon None None Shielding Trailing Backing Other Percent Composition Mixtures Flow Rate Electrical Characteristics (QW 409) Filler Metal Current Type and Polarity Amps (Range) Wire Feed Speed (Range) Energy or Power (Range) Volts (Range) Travel Speed (Range) Weld Pass(es) Process Classifi -cation Diameter All GTAW ER304 3/32” DCSP 60-100 N/A N/A N/A N/A All All GTAW GTAW ER304 ER304 1/8” 5/16”” DCSP DCSP 70-110 90-160 N/A N/A N/A N/A N/A N/A N/A N/A Other (e.g Remarks, Comments, Hot Wire Addition, Technique, Torch Angle, etc) NOTE: Amps and volts, or power or energy range, should be recorded for each electrode size, position, and thickness, etc Pulsing Current N/A Tungsten Electrode Size and Type Heat Input (max.) N/A 2% Thoriated (EWTh-2) or Cesium Stablilized (EWCe-2) Mode of Metal Transfer for GMAW or FCAW (Pure Tungsten, 2% Thoriated, etc) N/A (Spray Arc, Short Circuiting Arc, Globular Arc, etc) Technique (QW 410) String or Weave Bead String or Weave Orifice, Nozzle, or Gas Cup Size 3/8” to ¾” diameter shielding gas cup size Initial and Interpass cleaning (Brushing, Grinding, etc Grinding, Chipping, Wire Brush or Thermal process Method of Back Gouging Grinding or thermal process Oscillation N/A Contact Tube to Work Distance N/A Multiple or Single Pass (per side) Multiple Multiple of Single Electrodes Single Peening None Other Page 2 of 2 ASME Section IX –PQR QW-483 Suggested Format For Procedure Qualification Record (PQR) (See Section IX QW-200.2) Company Name JC Penny PQR No. JCP-PQ201 WPS # JCP-P201 Date 8/12/2001 Welding Process(es) GTAW Type(s) Manual Joints (QW 402) Groove D G Design i off TTest C Coupon Base Metals (QW 403) Material Spec. SA-240 Type 304 P-No. 8 to P-No. 8 Thickness of Test Coupon ½” Diameter of Test Coupon Plate Other Postweld Heat Treatment (QW 407) Temperature Range None Time Range Other Gas (QW 408) Filler Metals (QW 404) SFA Specification 5.18 AWS Classification E-7018 Filler Metal F-No. 6 Weld Metal Analysis A-No. 8 Size of Filler Metal N/A Other Weld Metal Thickness Electrical Characteristics (QW 409) Current DC Polarity Straight Amps: 90-100 Volts 20-28 Tungsten Electrode Size 1/8” Other ½” Positions (QW 405) Position of Groove 1G Weld Progression (Uphill, Downhill) Other Preheat (QW 406) Preheat Temp 50oF Interpass Temp 250oF Other Shielding Trailing Backing Percent Composition Gases Mixtures Flow Rate Argon/CO 75%/25% 15-25 None None N/A Technique (QW 410) Travel Speed 5”/min String or Weave Bead Weave Oscillation Multipass or Single Pass (per side) Multiple Single or Multiple Electrodes Single Other QW 483 (back) PQR No. JCP-PQ101 Specimen No. T1 T2 Face # 1 Face # 2 Root # 3 Root # 4 Specimen No. Width(W) (inch) .750 .750 Thickness(y) (inch) .440 .449 Type and Figure No. Notch Location Area (sq. inches) .330 .337 Ultimate Load (lbs) 24,450 24,000 Guided Bend Tests (QW -160) Ultimate Stress (psi) 74,090 71,216 Test Temp No Impact Values Type of Failure & Location Pass - Weld Pass - Base Results Pass Pass Pass Pass Notch Toughness Tests (QW -170) Notch Type Result – Satisfactory: YES Macro Results Tensile Test (QW -150) Lateral Exp % Shear Mils Fillet Weld Test (QW -180) Penetration into Parent Metal YES Drop Weight Break No Break No Other Tests Type of Test Deposit Analysis Other …………………………………………………………………………………………………………………………………………………………………………………. Welder’s Name Jack Shift Jr Clock No. Test conducted by: Shear Metal Testing Lab Stamp No. Laboratory Test No. B2 SM-1001 We certify that the statements in this record are correct and that the test welds were prepared, welded, and tested in accordance with the requirements of ASME Section IX. Manufacturer Date 8/12/2001 By: JC Penny Jack Shift Sr Page 2 of 2 ASME Section IX – WPS QW-482 Suggested Format For Welding Procedure Specification (WPS) (See Section IX QW-200.1) Company Name JC Penny By Mr. Penny Welding Procedure Specification No. JCP-P301 Date 9/11/2001 Supporting PQR No.(s)JCP-PQ301 Revision No. 0 Date 9/11/2001 Welding Process(es) SMAW Type(s) Manual Test Description Joints (QW 402) Joint Design Single V Groove and Fillets Root Spacing .0625” to 1.250” Backing: Yes x No x Backing Material (Type) Metal (Refer to both backing and retainers) Metal Nonmetallic Nonfusing Metal Other Sketches, Production drawings, weld symbols, or written description should show the general arrangement of the parts to be welded. Where applicable, the details of weld groove may be specified. (At the option of the manufacturer, sketches may be attached to illustrate joint design, weld layers, and bead sequence (e.g. for notch toughness procedures, for multiple process procedures, etc)). Base Metals (QW 403) P-No. 1 Group No. to P-No. 1 Group No. OR Specification and type/grade to Specification and type/grade OR Chemical Analysis and Mech. Prop. to Chemical Analysis and Mech. Prop. Thickness Range: Base Metal: Groove 1/16” to 1” Fillet All Maximum pass thickness ½” (yes) x (no) Pipe Diameter (Groove) 2 7/8” (Fillet) All Filler Metals (QW 404) Spec. No. (SFA) _ _ _ _ _ _ _ _ _ AWS No. (Class) _ _ _ _ _ _ _ _ _ F-No. _ _ _ _ _ _ _ _ _ _ _ _ _ _ A-No. _ _ _ _ _ _ _ _ _ _ _ _ _ _ Size of Filler Metals_ _ _ _ _ _ _ _ Weld Metal: Thickness Range: Groove_ _ _ _ _ _ _ _ _ _ _ Fillet_ _ _ _ _ _ _ _ _ _ _ _ Electrode-Flux (Class) _ _ _ _ _ _ _ Flux Type_ _ _ _ _ _ _ _ _ _ _ _ _ Consumable Insert_ _ _ _ _ _ _ _ _ Other_ _ _ _ _ _ _ _ _ _ _ _ _ _ _ 1st Filler Metal 5.1 E-7018 3 1 3/32”, 1/8”, 5/16” .0625” to 1.0” .250” to 1.0” N/A N/A N/A 2nd Filler Metal Positions (QW 405) Position(s) of Groove ALL Welding Progression: UP X Position(s) of fillet ALL Preheat (QW 406) Preheat Temp, Min Interpass Temp, Max Preheat Maintenance WPS No. JCP-P301 Postweld Heat Treatment (QW 407) Temperature Range None Time Range Other Down Gas (QW 408) 50oF 350oF None (Continuous or special heating, where applicable, should be recorded. Percent Composition Mixtures Flow Rate Gases N/A Shielding Trailing Backing Other Page 1 of 2 Rev.# 0 Electrical Characteristics (QW 409) Filler Metal Weld Pass(es) Process Classifi -cation Diameter All SMAW E-7018 1/8” Current Type and Polarity DCEP Amps (Range) 70 to 200 Wire Feed Speed (Range) Energy or Power (Range) Volts (Range) Travel Speed (Range) N/A N/A 19 - 25 5 to 7 Other (e.g Remarks, Comments, Hot Wire Addition, Technique, Torch Angle, etc) NOTE: Amps and volts, or power or energy range, should be recorded for each electrode size, position, and thickness, etc Pulsing Current N/A Tungsten Electrode Size and Type N/A Mode of Metal Transfer for GMAW or FCAW Heat Input (max.) (Pure Tungsten, 2% Thoriated, etc) N/A (Spray Arc, Short Circuiting Arc, Globular Arc, etc) Technique (QW 410) String or Weave Bead String or Weave Orifice, Nozzle, or Gas Cup Size N/A Initial and Interpass cleaning (Brushing, Grinding, etc Method of Back Gouging Grinding Oscillation N/A Contact Tube to Work Distance N/A Multiple or Single Pass (per side) Multiple of Single Electrodes Peening N/A Other N/A Grinding, Chipping or Wire Brush Multiple or Single Single Page 2 of 2 ASME Section IX –PQR QW-483 Suggested Format For Procedure Qualification Record (PQR) (See Section IX QW-200.2) Company Name JC Penny PQR No. JCP-PQ301 WPS # JCP-P301 Date 9/12/2001 Welding Process(es) SMAW Type(s) Manual Joints (QW 402) Groove D G Design i off TTest C Coupon Base Metals (QW 403) Material Spec. SA-53 Gr B P-No. to P-No. Thickness of Test Coupon ½” Diameter of Test Coupon 6” Other Postweld Heat Treatment (QW 407) Temperature Range None Time Range Other Gas (QW 408) Filler Metals (QW 404) SFA Specification 5.1 AWS Classification E-7018 Filler Metal F-No. 4 Weld Metal Analysis A-No. 1 Size of Filler Metal 5/32” Other Weld Metal Thickness Positions (QW 405) Position of Groove ALL Weld Progression (Uphill, Downhill) Other Preheat (QW 406) Preheat Temp 50oF Interpass Temp Other Shielding Trailing Backing Gases N/A Percent Composition Mixtures Flow Rate Electrical Characteristics (QW 409) Current DC Polarity Straight Amps: 150-300 Volts 20-28 Tungsten Electrode Size N/A Other Technique (QW 410) Travel Speed 3”/min String or Weave Bead Stringer Oscillation Multipass or Single Pass (per side) Multiple Single or Multiple Electrodes Single Other QW 483 (back) PQR No. JCP-PQ301 Specimen No. Width (inch) .750 .756 T1 T2 Type and Figure No. SIDE # 1 SIDE # 2 Face # 1 Face # 2 Specimen No. Thickness (inch) .455 .451 Notch Location Area (sq. inches) .341 .341 Ultimate Load (lbs) 19,450 22,560 Guided Bend Tests (QW -160) Ultimate Stress (psi) 57,038 66,158 Test Temp No Impact Values Type of Failure & Location Pass - Base Pass - Weld Results Pass Pass Pass Pass Notch Toughness Tests (QW -170) Notch Type Result – Satisfactory: YES Macro Results Tensile Test (QW -150) Lateral Exp % Shear Mils Fillet Weld Test (QW -180) Penetration into Parent Metal YES Drop Weight Break No Break No Other Tests Type of Test Deposit Analysis Other …………………………………………………………………………………………………………………………………………………………………………………. Welder’s Name Jack Shift Jr Test conducted by: Clock No. Stamp No. Laboratory Test No. B2 We certify that the statements in this record are correct and that the test welds were prepared, welded, and tested in accordance with the requirements of ASME Section IX. Manufacturer Date 9/11/2001 By: JC Penny Jack Shift Sr Page 2 of 2 ASME Section IX – Welder Qualification Homework – WPQ’s QW-484A Suggested Format For Welder Performance Qualification (WPQ) (See Section IX QW-301) Welder(s) Name Mr. Rod Burner Identification Number A11 Test Description Identification of WPS followed WPS 101 Test Coupon Production Weld Specification and Type/Grade or UNS Number of base metal(s) A 106B to A106B Thickness .280 Testing Variables and Qualification Limits Welding Variables (QW350) Actual Values Welding Process(es) Type (i.e. manual, semi-automatic) used Manual Backing (with or without) None Test Coupon Range Qualified SMAW Production Weld (dia if pipe) SMAW Manual F1 to F3 with,F3 wo __ 6” NPS 2 7/8” OD Base metal P-Number to P-Number P-1 to P-1 P1-P15F, P34, P41-P49 Filler Metal or Electrode Spec (SFA) 5.1 ------- Filler Metal F-Number F3 F1,F2, & F3 Consumable Insert (GTAW or PAW) N/A ------- Filler Metal Type (solid/metal or flux cored/powder) N/A ------- Deposited Thickness for each process Process 1: SMAW 3 layers minimum Process 2: Yes 3 layers minimum No Yes .280” No Position qualified (1G,2G,3G,4G,5G,6G, etc) .560 ---- ------- 2G F, H Vertical progression (uphill or downhill) Uphill Uphill Inert Gas Backing (GTAW, PAW, GMAW) N/A ------- GMAW Transfer mode (Spray, Globular, Pulse, or Short Circuit) N/A ------- GTAW Current type/polarity (AC,DCEP,DCEN) N/A ------- RESULTS Visual examination of completed weld (QW 302.4) Acceptable Transverse face and root bends (QW 462.3(a) Type Longitudinal bends (QW 462.3(b) Results Side bends (QW 462.2) Type Face No defects – Acceptable Root No defects - Acceptable Results Alternative Volumetric Examination Results (QW 191) N/A Fillet weld – fracture test (QW 181.2) Length and percent of defects N/A Fillet size (in.) Concavity/convexity (in.) N/A Macro examination (QW 184) RT or x UT Other tests Film or specimens evaluated by Company Mechanical tests conducted by Ben Tension Laboratory test no. 123 Welding supervised by Red Eye We certify that the statements in this record are correct and that the test coupons were prepared, welded, and tested in accordance with the requirements of Section IX of the ASME Code. Organization Date By April 7, 2010 Worlds Best Fabricator John Doe Welding Procedure (WPS), Procedure Qualification Record (PQR) and Welder Performance Qualification (WPQ) Forms Index x WPS JCP-P101 x PQR JCP-PQ101 x WPS JCP-P201 x PQR JCP-PQ201 x WPS JCP-P301 x PQR JCP-PQ301 x Rod Burner WPQ Form – with qualified range x Rod Burner WPQ Form – without qualified range x Blank WPS Form x Blank PQR Form x Blank WPQ Form ASME Section IX – WPS QW-482 Suggested Format For Welding Procedure Specification (WPS) (See Section IX QW-200.1) Company Name JC Penny By Mr. Penny Welding Procedure Specification No. JCP-P101 Date 9/11/2001 Supporting PQR No.(s)JCP-PQ101 Revision No. 0 Date 9/11/2001 Welding Process(es) SMAW Type(s) Manual Test Description Joints (QW 402) Joint Design Single V Groove and Fillets Root Spacing .0625” to 1.250” Backing: Yes x No x Backing Material (Type) Metal (Refer to both backing and retainers) Metal Nonmetallic Nonfusing Metal Other Sketches, Production drawings, weld symbols, or written description should show the general arrangement of the parts to be welded. Where applicable, the details of weld groove may be specified. (At the option of the manufacturer, sketches may be attached to illustrate joint design, weld layers, and bead sequence (e.g. for notch toughness procedures, for multiple process procedures, etc)). Base Metals (QW 403) P-No. 1 Group No. to P-No. 1 Group No. OR Specification and type/grade to Specification and type/grade OR Chemical Analysis and Mech. Prop. to Chemical Analysis and Mech. Prop. Thickness Range: Base Metal: Groove 1/16” to 1” Fillet All Maximum pass thickness ½” (yes) x (no) Pipe Diameter (Groove) 2 7/8” (Fillet) All Filler Metals (QW 404) Spec. No. (SFA) _ _ _ _ _ _ _ _ _ AWS No. (Class) _ _ _ _ _ _ _ _ _ F-No. _ _ _ _ _ _ _ _ _ _ _ _ _ _ A-No. _ _ _ _ _ _ _ _ _ _ _ _ _ _ Size of Filler Metals_ _ _ _ _ _ _ _ Weld Metal: Thickness Range: Groove_ _ _ _ _ _ _ _ _ _ _ Fillet_ _ _ _ _ _ _ _ _ _ _ _ Electrode-Flux (Class) _ _ _ _ _ _ _ Flux Type_ _ _ _ _ _ _ _ _ _ _ _ _ Consumable Insert_ _ _ _ _ _ _ _ _ Other_ _ _ _ _ _ _ _ _ _ _ _ _ _ _ 1st Filler Metal 5.1 E-70 3 1 3/32”, 1/8”, 5/16” .0625” to 1.0” .250” to 1.0” N/A N/A N/A 2nd Filler Metal Positions (QW 405) Position(s) of Groove ALL Welding Progression: UP X Position(s) of fillet ALL Preheat (QW 406) Preheat Temp, Min Interpass Temp, Max Preheat Maintenance WPS No. JCP-P101 Postweld Heat Treatment (QW 407) Temperature Range None Time Range Other Down Gas (QW 408) 50oF 350oF None (Continuous or special heating, where applicable, should be recorded. Percent Composition Mixtures Flow Rate Gases N/A Shielding Trailing Backing Other Page of 2 Rev.# 0 Electrical Characteristics (QW 409) Filler Metal Weld Pass(es) Process Classifi -cation Diameter All SMAW E-7018 1/8” Current Type and Polarity DCEP Amps (Range) 70 to 200 Wire Feed Speed (Range) Energy or Power (Range) Volts (Range) Travel Speed (Range) N/A N/A 19 - 25 5 to 7 Other (e.g Remarks, Comments, Hot Wire Addition, Technique, Torch Angle, etc) NOTE: Amps and volts, or power or energy range, should be recorded for each electrode size, position, and thickness, etc Pulsing Current N/A Tungsten Electrode Size and Type N/A Mode of Metal Transfer for GMAW or FCAW Heat Input (max.) (Pure Tungsten, 2% Thoriated, etc) N/A (Spray Arc, Short Circuiting Arc, Globular Arc, etc) Technique (QW 410) String or Weave Bead String or Weave Orifice, Nozzle, or Gas Cup Size N/A Initial and Interpass cleaning (Brushing, Grinding, etc Method of Back Gouging Grinding Oscillation N/A Contact Tube to Work Distance N/A Multiple or Single Pass (per side) Multiple of Single Electrodes Peening N/A Other N/A Grinding, Chipping or Wire Brush Multiple or Single Single Page 2 of 2 ASME Section IX –PQR QW-483 Suggested Format For Procedure Qualification Record (PQR) (See Section IX QW-200.2) Company Name JC Penny PQR No. JCP-PQ101 WPS # JCP-P101 Date 9/12/2001 Welding Process(es) SMAW Type(s) Manual Joints (QW 402) Groove D G Design i off TTest C Coupon Base Metals (QW 403) Material Spec. SA-53 Gr B P-No. to P-No. Thickness of Test Coupon ½” Diameter of Test Coupon 6” Other Postweld Heat Treatment (QW 407) Temperature Range None Time Range Other Gas (QW 408) Filler Metals (QW 404) SFA Specification 5.1 AWS Classification E-7018 Filler Metal F-No. 4 Weld Metal Analysis A-No. 1 Size of Filler Metal 5/32” Other Weld Metal Thickness Positions (QW 405) Position of Groove ALL Weld Progression (Uphill, Downhill) Other Preheat (QW 406) Preheat Temp 50oF Interpass Temp Other Shielding Trailing Backing Gases N/A Percent Composition Mixtures Flow Rate Electrical Characteristics (QW 409) Current DC Polarity Straight Amps: 150-300 Volts 20-28 Tungsten Electrode Size N/A Other Technique (QW 410) Travel Speed 3”/min String or Weave Bead Stringer Oscillation Multipass or Single Pass (per side) Multiple Single or Multiple Electrodes Single Other QW 483 (back) PQR No. JCP-PQ101 Specimen No. Width (inch) .750 .756 T1 T2 SIDE SIDE SIDE SIDE # # # # Specimen No. Thickness (inch) .455 .451 Type and Figure No. 1 2 3 4 Notch Location Area (sq. inches) .341 .341 Ultimate Load (lbs) 19,450 22,560 Guided Bend Tests (QW -160) Ultimate Stress (psi) 57,038 66,158 Test Temp No Impact Values Type of Failure & Location Pass - Base Pass - Weld Results Pass Pass Pass Pass Notch Toughness Tests (QW -170) Notch Type Result – Satisfactory: YES Macro Results Tensile Test (QW -150) Lateral Exp % Shear Mils Fillet Weld Test (QW -180) Penetration into Parent Metal YES Drop Weight Break No Break No Other Tests Type of Test Deposit Analysis Other …………………………………………………………………………………………………………………………………………………………………………………. Welder’s Name Jack Shift Jr Test conducted by: Clock No. Stamp No. Laboratory Test No. B2 We certify that the statements in this record are correct and that the test welds were prepared, welded, and tested in accordance with the requirements of ASME Section IX. Manufacturer Date 9/11/2001 By: JC Penny Jack Shift Sr Page 2 of 2 ASME Section IX – WPS QW-482 Suggested Format For Welding Procedure Specification (WPS) (See Section IX QW-200.1) Company Name JC Penny By Mr. Penny Welding Procedure Specification No. JCP-P201 Date 8/11/2001 Supporting PQR No.(s)JCP-PQ201 Revision No. 0 Date 8/11/2001 Welding Process(es) GTAW Type(s) Manual Test Description Joints (QW 402) Joint Design Single V Groove Root Spacing 1.250” Backing: Yes x No x Backing Material (Type) Solid Metal or weld metal (Refers to both backing and retainers) Metal Nonmetallic Nonfusing Metal Other Sketches, Production drawings, weld symbols, or written description should show the general arrangement of the parts to be welded. Where applicable, the details of weld groove may be specified. (At the option of the manufacturer, sketches may be attached to illustrate joint design, weld layers, and bead sequence (e.g. for notch toughness procedures, for multiple process procedures, etc)). Base Metals (QW 403) P-No. Group No. to P-No. Group No. OR Specification and type/grade SA 240 Type 304 to Specification and type/grade SA 240 Type 304 OR Chemical Analysis and Mech. Prop. to Chemical Analysis and Mech. Prop. Thickness Range: Base Metal: Groove 1/16” to 1” Fillet All Maximum pass thickness ½” (yes) x (no) Pipe Diameter (Groove) 2 7/8” (Fillet) All Filler Metals (QW 404) Spec. No. (SFA): 5.9 AWS No. (Class): ER304 F-No.: F-6 A-No.: A-8 Size of Filler Metals: 3/32”, 1/8”,5/16” Weld MetalThickness Range: Groove: .0625” to 1.0” Fillet: No limit Electrode-Flux (Class): Flux Type: Consumable Insert: Other: N/A N/A None N/A No single pass > ½” Positions (QW 405) Position(s) of Groove ALL Welding Progression: UP X Position(s) of fillet ALL Preheat (QW 406) Preheat Temp, Min Interpass Temp, Max Preheat Maintenance Page of 2 Rev.# 0 WPS No. JCP-P201 Postweld Heat Treatment (QW 407) Temperature Range None Time Range Other Down Gas (QW 408) 80oF 350oF None (Continuous or special heating, where applicable, should be recorded. Gases Argon None None Shielding Trailing Backing Other Percent Composition Mixtures Flow Rate Electrical Characteristics (QW 409) Filler Metal Current Type and Polarity Amps (Range) Wire Feed Speed (Range) Energy or Power (Range) Volts (Range) Travel Speed (Range) Weld Pass(es) Process Classifi -cation Diameter All GTAW ER304 3/32” DCSP 60-100 N/A N/A N/A N/A All All GTAW GTAW ER304 ER304 1/8” 5/16”” DCSP DCSP 70-110 90-160 N/A N/A N/A N/A N/A N/A N/A N/A Other (e.g Remarks, Comments, Hot Wire Addition, Technique, Torch Angle, etc) NOTE: Amps and volts, or power or energy range, should be recorded for each electrode size, position, and thickness, etc Pulsing Current N/A Tungsten Electrode Size and Type Heat Input (max.) N/A 2% Thoriated (EWTh-2) or Cesium Stablilized (EWCe-2) Mode of Metal Transfer for GMAW or FCAW (Pure Tungsten, 2% Thoriated, etc) N/A (Spray Arc, Short Circuiting Arc, Globular Arc, etc) Technique (QW 410) String or Weave Bead String or Weave Orifice, Nozzle, or Gas Cup Size 3/8” to ¾” diameter shielding gas cup size Initial and Interpass cleaning (Brushing, Grinding, etc Grinding, Chipping, Wire Brush or Thermal process Method of Back Gouging Grinding or thermal process Oscillation N/A Contact Tube to Work Distance N/A Multiple or Single Pass (per side) Multiple Multiple of Single Electrodes Single Peening None Other Page 2 of 2 ASME Section IX –PQR QW-483 Suggested Format For Procedure Qualification Record (PQR) (See Section IX QW-200.2) Company Name JC Penny PQR No. JCP-PQ201 WPS # JCP-P201 Date 8/12/2001 Welding Process(es) GTAW Type(s) Manual Joints (QW 402) Groove D G Design i off TTest C Coupon Base Metals (QW 403) Material Spec. SA-240 Type 304 P-No. 8 to P-No. 8 Thickness of Test Coupon ½” Diameter of Test Coupon Plate Other Postweld Heat Treatment (QW 407) Temperature Range None Time Range Other Gas (QW 408) Filler Metals (QW 404) SFA Specification 5.18 AWS Classification E-7018 Filler Metal F-No. 6 Weld Metal Analysis A-No. 8 Size of Filler Metal N/A Other Weld Metal Thickness Electrical Characteristics (QW 409) Current DC Polarity Straight Amps: 90-100 Volts 20-28 Tungsten Electrode Size 1/8” Other ½” Positions (QW 405) Position of Groove 1G Weld Progression (Uphill, Downhill) Other Preheat (QW 406) Preheat Temp 50oF Interpass Temp 250oF Other Shielding Trailing Backing Percent Composition Gases Mixtures Flow Rate Argon/CO 75%/25% 15-25 None None N/A Technique (QW 410) Travel Speed 5”/min String or Weave Bead Weave Oscillation Multipass or Single Pass (per side) Multiple Single or Multiple Electrodes Single Other QW 483 (back) PQR No. JCP-PQ01 Specimen No. T1 T2 Face # 1 Face # 2 Root # 3 Root # 4 Specimen No. Width(W) (inch) .750 .750 Thickness(y) (inch) .440 .449 Type and Figure No. Notch Location Area (sq. inches) .330 .337 Ultimate Load (lbs) 24,450 24,000 Guided Bend Tests (QW -160) Ultimate Stress (psi) 74,090 71,216 Test Temp No Impact Values Type of Failure & Location Pass - Weld Pass - Base Results Pass Pass Pass Pass Notch Toughness Tests (QW -170) Notch Type Result – Satisfactory: YES Macro Results Tensile Test (QW -150) Lateral Exp % Shear Mils Fillet Weld Test (QW -180) Penetration into Parent Metal YES Drop Weight Break No Break No Other Tests Type of Test Deposit Analysis Other …………………………………………………………………………………………………………………………………………………………………………………. Welder’s Name Jack Shift Jr Clock No. Test conducted by: Shear Metal Testing Lab Stamp No. Laboratory Test No. B2 SM-1001 We certify that the statements in this record are correct and that the test welds were prepared, welded, and tested in accordance with the requirements of ASME Section IX. Manufacturer Date 8/12/2001 By: JC Penny Jack Shift Sr Page 2 of 2 ASME Section IX – WPS QW-482 Suggested Format For Welding Procedure Specification (WPS) (See Section IX QW-200.1) Company Name JC Penny By Mr. Penny Welding Procedure Specification No. JCP-P301 Date 9/11/2001 Supporting PQR No.(s)JCP-PQ301 Revision No. 0 Date 9/11/2001 Welding Process(es) SMAW Type(s) Manual Test Description Joints (QW 402) Joint Design Single V Groove and Fillets Root Spacing .0625” to 1.250” Backing: Yes x No x Backing Material (Type) Metal (Refer to both backing and retainers) Metal Nonmetallic Nonfusing Metal Other Sketches, Production drawings, weld symbols, or written description should show the general arrangement of the parts to be welded. Where applicable, the details of weld groove may be specified. (At the option of the manufacturer, sketches may be attached to illustrate joint design, weld layers, and bead sequence (e.g. for notch toughness procedures, for multiple process procedures, etc)). Base Metals (QW 403) P-No. 1 Group No. to P-No. 1 Group No. OR Specification and type/grade to Specification and type/grade OR Chemical Analysis and Mech. Prop. to Chemical Analysis and Mech. Prop. Thickness Range: Base Metal: Groove 1/16” to 1” Fillet All Maximum pass thickness ½” (yes) x (no) Pipe Diameter (Groove) 2 7/8” (Fillet) All Filler Metals (QW 404) Spec. No. (SFA) _ _ _ _ _ _ _ _ _ AWS No. (Class) _ _ _ _ _ _ _ _ _ F-No. _ _ _ _ _ _ _ _ _ _ _ _ _ _ A-No. _ _ _ _ _ _ _ _ _ _ _ _ _ _ Size of Filler Metals_ _ _ _ _ _ _ _ Weld Metal: Thickness Range: Groove_ _ _ _ _ _ _ _ _ _ _ Fillet_ _ _ _ _ _ _ _ _ _ _ _ Electrode-Flux (Class) _ _ _ _ _ _ _ Flux Type_ _ _ _ _ _ _ _ _ _ _ _ _ Consumable Insert_ _ _ _ _ _ _ _ _ Other_ _ _ _ _ _ _ _ _ _ _ _ _ _ _ 1st Filler Metal 5.1 E-7018 3 1 3/32”, 1/8”, 5/16” .0625” to 1.0” .250” to 1.0” N/A N/A N/A 2nd Filler Metal Positions (QW 405) Position(s) of Groove ALL Welding Progression: UP X Position(s) of fillet ALL Preheat (QW 406) Preheat Temp, Min Interpass Temp, Max Preheat Maintenance WPS No. JCP-P301 Postweld Heat Treatment (QW 407) Temperature Range None Time Range Other Down Gas (QW 408) 50oF 350oF None (Continuous or special heating, where applicable, should be recorded. Percent Composition Mixtures Flow Rate Gases N/A Shielding Trailing Backing Other Page 1 of 2 Rev.# 0 Electrical Characteristics (QW 409) Filler Metal Weld Pass(es) Process Classifi -cation Diameter All SMAW E-7018 1/8” Current Type and Polarity DCEP Amps (Range) 70 to 200 Wire Feed Speed (Range) Energy or Power (Range) Volts (Range) Travel Speed (Range) N/A N/A 19 - 25 5 to 7 Other (e.g Remarks, Comments, Hot Wire Addition, Technique, Torch Angle, etc) NOTE: Amps and volts, or power or energy range, should be recorded for each electrode size, position, and thickness, etc Pulsing Current N/A Tungsten Electrode Size and Type N/A Mode of Metal Transfer for GMAW or FCAW Heat Input (max.) (Pure Tungsten, 2% Thoriated, etc) N/A (Spray Arc, Short Circuiting Arc, Globular Arc, etc) Technique (QW 410) String or Weave Bead String or Weave Orifice, Nozzle, or Gas Cup Size N/A Initial and Interpass cleaning (Brushing, Grinding, etc Method of Back Gouging Grinding Oscillation N/A Contact Tube to Work Distance N/A Multiple or Single Pass (per side) Multiple of Single Electrodes Peening N/A Other N/A Grinding, Chipping or Wire Brush Multiple or Single Single Page 2 of 2 ASME Section IX –PQR QW-483 Suggested Format For Procedure Qualification Record (PQR) (See Section IX QW-200.2) Company Name JC Penny PQR No. JCP-PQ301 WPS # JCP-P301 Date 9/12/2001 Welding Process(es) SMAW Type(s) Manual Joints (QW 402) Groove D G Design i off TTest C Coupon Base Metals (QW 403) Material Spec. SA-53 Gr B P-No. to P-No. Thickness of Test Coupon ½” Diameter of Test Coupon 6” Other Postweld Heat Treatment (QW 407) Temperature Range None Time Range Other Gas (QW 408) Filler Metals (QW 404) SFA Specification 5.1 AWS Classification E-7018 Filler Metal F-No. 4 Weld Metal Analysis A-No. 1 Size of Filler Metal 5/32” Other Weld Metal Thickness Positions (QW 405) Position of Groove ALL Weld Progression (Uphill, Downhill) Other Preheat (QW 406) Preheat Temp 50oF Interpass Temp Other Shielding Trailing Backing Gases N/A Percent Composition Mixtures Flow Rate Electrical Characteristics (QW 409) Current DC Polarity Straight Amps: 150-300 Volts 20-28 Tungsten Electrode Size N/A Other Technique (QW 410) Travel Speed 3”/min String or Weave Bead Stringer Oscillation Multipass or Single Pass (per side) Multiple Single or Multiple Electrodes Single Other QW 483 (back) PQR No. JCP-PQ301 Specimen No. Width (inch) .750 .756 T1 T2 Type and Figure No. SIDE # 1 SIDE # 2 Face # 1 Face # 2 Specimen No. Thickness (inch) .455 .451 Notch Location Area (sq. inches) .341 .341 Ultimate Load (lbs) 19,450 22,560 Guided Bend Tests (QW -160) Ultimate Stress (psi) 57,038 66,158 Test Temp No Impact Values Type of Failure & Location Pass - Base Pass - Weld Results Pass Pass Pass Pass Notch Toughness Tests (QW -170) Notch Type Result – Satisfactory: YES Macro Results Tensile Test (QW -150) Lateral Exp % Shear Mils Fillet Weld Test (QW -180) Penetration into Parent Metal YES Drop Weight Break No Break No Other Tests Type of Test Deposit Analysis Other …………………………………………………………………………………………………………………………………………………………………………………. Welder’s Name Jack Shift Jr Test conducted by: Clock No. Stamp No. Laboratory Test No. B2 We certify that the statements in this record are correct and that the test welds were prepared, welded, and tested in accordance with the requirements of ASME Section IX. Manufacturer Date 9/11/2001 By: JC Penny Jack Shift Sr Page 2 of 2 ASME Section IX – Welder Qualification Homework – WPQ’s QW-484A Suggested Format For Welder Performance Qualification (WPQ) (See Section IX QW-301) Welder(s) Name Mr. Rod Burner Identification Number A11 Test Description Identification of WPS followed WPS 101 Test Coupon Production Weld Specification and Type/Grade or UNS Number of base metal(s) A 106B to A106B Thickness .280 Testing Variables and Qualification Limits Welding Variables (QW350) Actual Values Welding Process(es) Type (i.e. manual, semi-automatic) used Manual Backing (with or without) None Test Coupon Range Qualified SMAW Production Weld (dia if pipe) SMAW Manual F1 to F3 with,F3 wo __ 6” NPS 2 7/8” OD Base metal P-Number to P-Number P-1 to P-1 P1-P15F, P34, P41-P49 Filler Metal or Electrode Spec (SFA) 5.1 ------- Filler Metal F-Number F3 F1,F2, & F3 Consumable Insert (GTAW or PAW) N/A ------- Filler Metal Type (solid/metal or flux cored/powder) N/A ------- Deposited Thickness for each process Process 1: SMAW 3 layers minimum Process 2: Yes 3 layers minimum No Yes .280” No Position qualified (1G,2G,3G,4G,5G,6G, etc) .560 ---- ------- 2G F, H Vertical progression (uphill or downhill) Uphill Uphill Inert Gas Backing (GTAW, PAW, GMAW) N/A ------- GMAW Transfer mode (Spray, Globular, Pulse, or Short Circuit) N/A ------- GTAW Current type/polarity (AC,DCEP,DCEN) N/A ------- RESULTS Visual examination of completed weld (QW 302.4) Acceptable Transverse face and root bends (QW 462.3(a) Type Longitudinal bends (QW 462.3(b) Results Side bends (QW 462.2) Type Face No defects – Acceptable Root No defects - Acceptable Results Alternative Volumetric Examination Results (QW 191) N/A Fillet weld – fracture test (QW 181.2) Length and percent of defects N/A Fillet size (in.) Concavity/convexity (in.) N/A Macro examination (QW 184) RT or x UT Other tests Film or specimens evaluated by Company Mechanical tests conducted by Ben Tension Laboratory test no. 123 Welding supervised by Red Eye We certify that the statements in this record are correct and that the test coupons were prepared, welded, and tested in accordance with the requirements of Section IX of the ASME Code. Organization Date By April 7, 2010 Worlds Best Fabricator John Doe ASME Section IX – WPS QW-482 Suggested Format For Welding Procedure Specification (WPS) (See Section IX QW-200.1) Company Name By Welding Procedure Specification No. Date Supporting PQR No.(s) Date Revision No. Welding Process(es) Joints (QW 402) Joint Design Root Spacing Backing: Yes Backing Material (Type) Metal Nonmetallic Type(s) Test Description No (Refer to both backing and retainers) Nonfusing Metal Other Sketches, Production drawings, weld symbols, or written description should show the general arrangement of the parts to be welded. Where applicable, the details of weld groove may be specified. (At the option of the manufacturer, sketches may be attached to illustrate joint design, weld layers, and bead sequence (e.g. for notch toughness procedures, for multiple process procedures, etc)). Base Metals (QW 403) P-No. Group No. to P-No. Group No. OR Specification and type/grade to Specification and type/grade OR Chemical Analysis and Mech. Prop. to Chemical Analysis and Mech. Prop. Thickness Range: Base Metal: Groove Fillet Maximum pass thickness ≤ ½” (yes) (no) Filler Metals (QW 404) Spec. No. (SFA) _ _ _ _ _ _ _ _ _ AWS No. (Class) _ _ _ _ _ _ _ _ _ F-No. _ _ _ _ _ _ _ _ _ _ _ _ _ _ A-No. _ _ _ _ _ _ _ _ _ _ _ _ _ _ Size of Filler Metals_ _ _ _ _ _ _ _ Filler Metal Product Form_ _ _ _ _ Weld Metal: Thickness Range: Groove_ _ _ _ _ _ _ _ _ _ _ Fillet_ _ _ _ _ _ _ _ _ _ _ _ Electrode-Flux (Class) _ _ _ _ _ _ _ Flux Type_ _ _ _ _ _ _ _ _ _ _ _ _ Consumable Insert_ _ _ _ _ _ _ _ _ Other_ _ _ _ _ _ _ _ _ _ _ _ _ _ _ 1st Filler Metal 2nnd Filler Metal Page 1 of 2 Positions (QW 405)) Position(s) of Groove Welding Progression: UP Position(s) of fillet WPS No. Postweld Heat Treatment (QW 407)) Temperature Range Time Range Other Down Preheat (QW 406)) Preheat Temp, Min Interpass Temp, Max Preheat Maintenance Gas (QW 408)) Gases Shielding Trailing Backing Other (Continuous or special heating, where applicable, should be recorded. Rev.# Percent Composition Mixtures Flow Rate Electrical Characteristics (QW 4099) Filler Metal Weld Pass(es) Process Classifi -cation Diameter Current Type and Polarity Amps (Range) Wire Feed Speed (Range) Energy or Power (Range) Volts (Range) Travel Speed (Range) Other (e.g Remarks, Comments, Hot Wire Addition, Technique, Torch Angle, etc) NOTE: Amps and volts, or power or energy range, should be recorded for each electrode size, position, and thickness, etc Pulsing Current Tungsten Electrode Size and Type Mode of Metal Transfer for GMAW or FCAW Heat Input (max.) (Pure Tungsten, 2% Thoriated, etc) (Spray Arc, Short Circuiting Arc, Globular Arc, etc) Technique (QW 410) String or Weave Bead Orifice, Nozzle, or Gas Cup Size Initial and Interpass cleaning (Brushing, Grinding, etc Method of Back Gouging Oscillation Contact Tube to Work Distance Multiple or Single Pass (per side) Multiple of Single Electrodes Electrode Spacing Peening Other Page 2 of 2 ASME Section IX – PQR Company Name PQR No. Welding Process(es) QW-483 Suggested Format For Procedure Qualification Record (PQR) (See Section IX QW-200.2) Joints (QW 402) WPS # Type(s) Date .375" Groove Design of Test Coupon Base Metals (QW 403) Material Spec. P-No. to P-No. Thickness of Test Coupon Diameter of Test Coupon Other Postweld Heat Treatment (QW 407) Temperature Range Time Range Other Gas (QW 408) Filler Metals (QW 404) SFA Specification AWS Classification Filler Metal F-No. Weld Metal Analysis A-No. Size of Filler Metal Other Weld Metal Thickness Positions (QW 405) Position of Groove ALL Weld Progression (Uphill, Downhill) Other Preheat (QW 406) Preheat Temp 50oF Interpass Temp None Other Shielding Trailing Backing Gases N/A Percent Composition Mixtures Flow Rate Electrical Characteristics (QW 409) Current Polarity Amps: Volts Tungsten Electrode Size Other Technique (QW 410) Travel Speed String or Weave Bead Oscillation Multipass or Single Pass (per side) Single or Multiple Electrodes Other QW 483 (back) PQR No. Specimen No. Width (inch) Thickness (inch) Type and Figure No. Specimen No. Notch Location Area (sq. inches) Ultimate Load (lbs) Guided Bend Tests (QW -160) Ultimate Stress (psi) Test Temp No Impact Values Lateral Exp % Shear Mils Fillet Weld Test (QW -180) Type of Failure & Location Results Notch Toughness Tests (QW -170) Notch Type Result – Satisfactory: YES Macro Results Tensile Test (QW -150) Penetration into Parent Metal YES Drop Weight Break No Break No Other Tests Type of Test Deposit Analysis Other …………………………………………………………………………………………………………………………………………………………………………………. Welder’s Name Test conducted by: Clock No. Stamp No. Laboratory Test No. We certify that the statements in this record are correct and that the test welds were prepared, welded, and tested in accordance with the requirements of ASME Section IX. Manufacturer Date By: Page 2 of 2 ASME Section IX – Welder Qualification Homework – WPQ’s QW-484A Suggested Format For Welder Performance Qualification (WPQ) (See Section IX QW-301) Identification Number Welder(s) Name Test Description Identification of WPS followed Test Coupon Production Weld Specification and Type/Grade or UNS Number of base metal(s) Thickness Testing Variables and Qualification Limits Welding Variables (QW350) Actual Values Range Qualified Welding Process(es) Type (i.e. manual, semi-automatic) used Backing (with or without) Test Coupon Production Weld (dia if pipe) Base metal P-Number to P-Number Filler Metal or Electrode Spec (SFA) Filler Metal F-Number Consumable Insert (GTAW or PAW) Filler Metal Type (solid/metal or flux cored/powder) Deposited Thickness for each process Process 1: 3 layers minimum Yes No Process 2: 3 layers minimum Yes No Position qualified (1G,2G,3G,4G,5G,6G, etc) Vertical progression (uphill or downhill) Inert Gas Backing (GTAW, PAW, GMAW) GMAW Transfer mode (Spray, Globular, Pulse, or Short Circuit) GTAW Current type/polarity (AC,DCEP,DCEN) RESULTS Visual examination of completed weld (QW 302.4) □ Transverse face and root bends (QW 462.3(a) Type Longitudinal bends (QW 462.3(b) Results Type Alternative Volumetric Examination Results (QW 191) Results RT or Fillet weld – fracture test (QW 181.2) Macro examination (QW 184) Side bends (QW 462.2) UT Length and percent of defects Fillet size (in.) x Concavity/convexity (in.) Other tests Film or specimens evaluated by Company Mechanical tests conducted by Laboratory test no. Welding supervised by We certify that the statements in this record are correct and that the test coupons were prepared, welded, and tested in accordance with the requirements of Section IX of the ASME Code. Organization Date By