Product datasheet Anti-CDC42EP3 antibody ab194461 2 Images Overview Product name Anti-CDC42EP3 antibody Description Mouse Polyclonal to CDC42EP3 Tested applications WB Species reactivity Reacts with: Human Predicted to work with: Mouse Immunogen Recombinant fragment (GST-tag) corresponding to Human CDC42EP3 aa 42-108. NP_006440). Sequence: IHIGKEGQHDVFGDISFLQGNYELLPGNQEKAHLGQFPGHNEFFRANSTS DSVFTETPSPVLKNAIS Database link: Q9UKI2 Run BLAST with Positive control Run BLAST with K562 cell lysate. Properties Form Liquid Storage instructions Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Purity Whole antiserum Clonality Polyclonal Isotype IgG Applications Our Abpromise guarantee covers the use of ab194461 in the following tested applications. The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user. Application WB Abreviews Notes 1/500 - 1/1000. Predicted molecular weight: 28 kDa. 1 Target Relevance CDC42EP3 is probably involved in the organization of the actin cytoskeleton. May act downstream of CDC42 to induce actin filament assembly leading to cell shape changes. It induces pseudopodia formation in fibroblasts. Cellular localization Endomembrane system; Peripheral membrane protein. Cytoplasm; cytoskeleton. Anti-CDC42EP3 antibody images Anti-CDC42EP3 antibody (ab194461) at 1/500 dilution + K562 whole cell lysate at 50 µg developed using the ECL technique Predicted band size : 28 kDa Western blot - Anti-CDC42EP3 antibody (ab194461) Anti-CDC42EP3 antibody (ab194461) at 1/1000 dilution + recombinant Human CDC42EP3 (immunogen) at 0.2 µg developed using the ECL technique Predicted band size : 28 kDa Predicted MW of immunogen: 33.48 KDa Western blot - Anti-CDC42EP3 antibody (ab194461) Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE" Our Abpromise to you: Quality guaranteed and expert technical support Replacement or refund for products not performing as stated on the datasheet Valid for 12 months from date of delivery Response to your inquiry within 24 hours We provide support in Chinese, English, French, German, Japanese and Spanish Extensive multi-media technical resources to help you We investigate all quality concerns to ensure our products perform to the highest standards If the product does not perform as described on this datasheet, we will offer a refund or replacement. For full details of the Abpromise, please visit http://www.abcam.com/abpromise or contact our technical team. Terms and conditions 2 Guarantee only valid for products bought direct from Abcam or one of our authorized distributors 3