Product datasheet Recombinant Human ARMS2 protein ab174457 1 Image Overview Product name Recombinant Human ARMS2 protein Protein length Full length protein Description Nature Recombinant Source E. coli Amino Acid Sequence Accession P0C7Q2 Species Human Sequence MGSSHHHHHHSSGLVPRGSHMGSMLRLYPGPMVTEAEGKGGPEMASLSSS VVPVSFISTLRESVLDPGVGGEGASDKQRSKLSLSHSMIPAAKIHTELCL PAFFSPAGTQRRFQQPQHHLTLSIIHTAAR Molecular weight 14 kDa including tags Amino acids 1 to 107 Tags His tag N-Terminus Additional sequence information NCBI Accession No.: NP_001093137 Specifications Our Abpromise guarantee covers the use of ab174457 in the following tested applications. The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user. Applications SDS-PAGE Purity > 85 % by SDS-PAGE. Form Liquid Preparation and Storage Stability and Storage Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or 80°C. Avoid freeze / thaw cycle. Information available upon request. 1 General Info Relevance ARMS2 is thought to play a role in diseases in the elderly. Mutations in this gene have been associated with age-related macular degeneration (ARMD). ARMD is the most common cause of irreversible vision loss. In most patients, the disease is manifest as ophthalmoscopically visible yellowish accumulations of protein and lipid (known as drusen) that lie beneath the retinal pigment epithelium and within an elastin containing structure known as Bruch's membrane. ARMD is likely to be a mechanistically heterogeneous group of disorders, and the specific disease mechanisms that underlie the vast majority of cases are currently unknown. However, studies have suggested that both genetic and environmental factors may be implicated. Cellular localization Cytoplasmic Recombinant Human ARMS2 protein images 15% SDS-PAGE analysis of ab174457 (3 µg) SDS-PAGE - (ab174457) Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE" Our Abpromise to you: Quality guaranteed and expert technical support Replacement or refund for products not performing as stated on the datasheet Valid for 12 months from date of delivery Response to your inquiry within 24 hours We provide support in Chinese, English, French, German, Japanese and Spanish Extensive multi-media technical resources to help you We investigate all quality concerns to ensure our products perform to the highest standards If the product does not perform as described on this datasheet, we will offer a refund or replacement. For full details of the Abpromise, please visit http://www.abcam.com/abpromise or contact our technical team. Terms and conditions Guarantee only valid for products bought direct from Abcam or one of our authorized distributors 2