Product datasheet Anti-RDH12 antibody ab173449 1 Image Overview Product name Anti-RDH12 antibody Description Rabbit polyclonal to RDH12 Tested applications WB Species reactivity Reacts with: Human Predicted to work with: Cow Immunogen Full length protein corresponding to Human RDH12 aa 1-316. (NP_689656.1). Sequence: MLVTLGLLTSFFSFLYMVAPSIRKFFAGGVCRTNVQLPGKVVVITGANTG IGKETARELASRGARVYIACRDVLKGESAASEIRVDTKNSQVLVRKLDLS DTKSIRAFAEGFLAEEKQLHILINNAGVMMCPYSKTADGFETHLGVNHLG HFLLTYLLLEQLKVSAPARVVNVSSVAHHIGKIPFHDLQSEKRYSRGFAY CHSKLANVLFTRELAKRLQGTGVTTYAVHPGVVRSELVRHSSLLCLLWRL FSPFVKTAREGAQTSLHCALAEGLEPLSGKYFSDCKRTWVSPRARNNKTA ERLWNVSCELLGIRWE Database link: Q96NR8 Run BLAST with Positive control Run BLAST with RDH12 transfected 293T cell line lysate. Properties Form Liquid Storage instructions Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Storage buffer pH: 7.2 Constituent: 100% PBS Purity Protein A purified Clonality Polyclonal Isotype IgG Applications Our Abpromise guarantee covers the use of ab173449 in the following tested applications. 1 The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user. Application Abreviews WB Notes Use a concentration of 1 µg/ml. Predicted molecular weight: 35 kDa. Target Function Exhibits an oxidoreductive catalytic activity towards retinoids. Most efficient as an NADPHdependent retinal reductase. Displays high activity toward 9-cis and all-trans-retinol. Also involved in the metabolism of short-chain aldehydes. No steroid dehydrogenase activity detected. Might be the key enzyme in the formation of 11-cis-retinal from 11-cis-retinol during regeneration of the cone visual pigments. Tissue specificity Widely expressed, mostly in eye, kidney, brain, skeletal msucle and stomach. Involvement in disease Defects in RDH12 are the cause of Leber congenital amaurosis type 13 (LCA13) [MIM:612712]. LCA designates a clinically and genetically heterogeneous group of childhood retinal degenerations, generally inherited in an autosomal recessive manner. Affected infants have little or no retinal photoreceptor function as tested by electroretinography. LCA represents the most common genetic cause of congenital visual impairment in infants and children. Defects in RDH12 are the cause of retinitis pigmentosa type 53 (RP53) [MIM:612712]. RP53 is a retinal dystrophy belonging to the group of pigmentary retinopathies. Retinitis pigmentosa is characterized by retinal pigment deposits visible on fundus examination and primary loss of rod photoreceptor cells followed by secondary loss of cone photoreceptors. Patients typically have night vision blindness and loss of midperipheral visual field. As their condition progresses, they lose their far peripheral visual field and eventually central vision as well. Sequence similarities Belongs to the short-chain dehydrogenases/reductases (SDR) family. Anti-RDH12 antibody images All lanes : Anti-RDH12 antibody (ab173449) at 1 µg/ml Lane 1 : RDH12 transfected 293T cell line lysate Lane 2 : Non-transfected 293T cell line lysate Lysates/proteins at 15 µl per lane. Secondary Western blot - Anti-RDH12 antibody (ab173449) Goat Anti-Rabbit IgG (H+L), Peroxidase Conjugated at 1/7500 dilution developed using the ECL technique Predicted band size : 35 kDa Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE" Our Abpromise to you: Quality guaranteed and expert technical support 2 Replacement or refund for products not performing as stated on the datasheet Valid for 12 months from date of delivery Response to your inquiry within 24 hours We provide support in Chinese, English, French, German, Japanese and Spanish Extensive multi-media technical resources to help you We investigate all quality concerns to ensure our products perform to the highest standards If the product does not perform as described on this datasheet, we will offer a refund or replacement. For full details of the Abpromise, please visit http://www.abcam.com/abpromise or contact our technical team. Terms and conditions Guarantee only valid for products bought direct from Abcam or one of our authorized distributors 3