Product datasheet Anti-SCAMP2 antibody [2F3] ab180385 2 Images Overview Product name Anti-SCAMP2 antibody [2F3] Description Mouse monoclonal [2F3] to SCAMP2 Tested applications ICC/IF, WB Species reactivity Reacts with: Human Immunogen Recombinant full length protein corresponding to Human SCAMP2 aa 1-329. Sequence: MSAFDTNPFADPVDVNPFQDPSVTQLTNAPQGGLAEFNPFSETNAATTVP VTQLPGSSQPAVLQPSVEPT QPTPQAVVSAAQAGLLRQQEELDRKAAE LERKERELQNTVANLHVRQNNWPPLPSWCPVKPCFYQDFSTE IPADYQ RICKMLYYLWMLHSVTLFLNLLACLAWFSGNSSKGVDFGLSILWFLIFTP CAFLCWYRPIYKAF RSDNSFSFFVFFFVFFCQIGIYIIQLVGIPGLGD SGWIAALSTLDNHSLAISVIMMVVAGFFTLCAVLSV FLLQRVHSLYRR TGASFQQAQEEFSQGIFSSRTFHRAASSAAQGAFQGN Database link: O15127 Run BLAST with Positive control Run BLAST with HEK293T cells transfected with the pCMV6-ENTRY SCAMP2 cDNA; COS7 cells transiently transfected by pCMV6-ENTRY SCAMP2 cDNA. Properties Form Liquid Storage instructions Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Storage buffer pH: 7.3 Preservative: 0.02% Sodium azide Constituents: 48% PBS, 50% Glycerol, 1% BSA Purity Protein A purified Purification notes Purified from mouse ascites fluids by affinity chromatography. Clonality Monoclonal 1 Clone number 2F3 Isotype IgG2a Applications Our Abpromise guarantee covers the use of ab180385 in the following tested applications. The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user. Application Abreviews Notes ICC/IF 1/100. WB 1/4000. Predicted molecular weight: 37 kDa. Target Function Functions in post-Golgi recycling pathways. Acts as a recycling carrier to the cell surface. Tissue specificity Widely expressed. Sequence similarities Belongs to the SCAMP family. Cellular localization Golgi apparatus > trans-Golgi network membrane. Recycling endosome membrane. Anti-SCAMP2 antibody [2F3] images All lanes : Anti-SCAMP2 antibody [2F3] (ab180385) at 1/4000 dilution Lane 1 : HEK293 cells transfected with pCMV6-ENTRY control cDNA. Lane 2 : HEK293 cells transfected with pCMV6-ENTRY SCAMP2 cDNA. Western blot - Anti-SCAMP2 [2F3] antibody Lysates/proteins at 5 µg per lane. (ab180385) Predicted band size : 37 kDa HEK293T cell lysates were generated from transient transfection of the cDNA clone (RC229105) 2 Immunofluorescence analysis of COS7 cells transiently transfected by pCMV6-ENTRY SCAMP2, labeling SCAMP2 with ab180385 at 1/100 dilution. Immunocytochemistry/ Immunofluorescence Anti-SCAMP2 [2F3] antibody (ab180385) Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE" Our Abpromise to you: Quality guaranteed and expert technical support Replacement or refund for products not performing as stated on the datasheet Valid for 12 months from date of delivery Response to your inquiry within 24 hours We provide support in Chinese, English, French, German, Japanese and Spanish Extensive multi-media technical resources to help you We investigate all quality concerns to ensure our products perform to the highest standards If the product does not perform as described on this datasheet, we will offer a refund or replacement. For full details of the Abpromise, please visit http://www.abcam.com/abpromise or contact our technical team. Terms and conditions Guarantee only valid for products bought direct from Abcam or one of our authorized distributors 3