Product datasheet Anti-RAB3GAP2 antibody ab182270 1 Image Overview Product name Anti-RAB3GAP2 antibody Description Rabbit polyclonal to RAB3GAP2 Tested applications WB Species reactivity Reacts with: Human Predicted to work with: Mouse, Rat, Rabbit, Chicken, Guinea pig, Cow, Cat, Dog, Pig Immunogen Synthetic peptide within Human RAB3GAP2 aa 73-122 (internal sequence). The exact sequence is proprietary. Sequence: SWLQDCVLSLSPTNDLMVIAREQKAVFLVPKWKYSDKGKEEMQFAVGWSG Database link: Q9H2M9-2 Run BLAST with Positive control Run BLAST with Human fetal liver lysate. Properties Form Liquid Storage instructions Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Storage buffer Constituents: 98% PBS, 2% Sucrose Purity Immunogen affinity purified Clonality Polyclonal Isotype IgG Applications Our Abpromise guarantee covers the use of ab182270 in the following tested applications. The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user. Application Abreviews Notes 1 Application Abreviews WB Notes Use a concentration of 1 µg/ml. Predicted molecular weight: 23 kDa. 2 isoforms of RAB3GAP2 exist. Isoform 1 at 150kDa and Isoform 2 is expected at 23 kDa. Target Relevance RAB3GAP2 is a regulatory subunit of a GTPase activating protein that has specificity for Rab3 subfamily (RAB3A, RAB3B, RAB3C and RAB3D). Rab3 proteins are involved in regulated exocytosis of neurotransmitters and hormones. Rab3 GTPase-activating complex specifically converts active Rab3-GTP to the inactive form Rab3-GDP. It is required for normal eye and brain development and may participate in neurodevelopmental processes such as proliferation, migration and differentiation before synapse formation, and non-synaptic vesicular release of neurotransmitters. Cellular localization Cytoplasmic. Note: In neurons, it is enriched in the synaptic soluble fraction. Anti-RAB3GAP2 antibody images Anti-RAB3GAP2 antibody (ab182270) at 1 µg/ml + Human fetal liver lysate at 10 µg Predicted band size : 23 kDa The band detected on this Western Blot is isoform 2 of RAB3GAP2 expected at 23 kDa. We currently have no data about the detection of isoform 1, which would be expected at 150 kDa. Western blot - Anti-RAB3GAP2 antibody (ab182270) Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE" Our Abpromise to you: Quality guaranteed and expert technical support Replacement or refund for products not performing as stated on the datasheet Valid for 12 months from date of delivery Response to your inquiry within 24 hours We provide support in Chinese, English, French, German, Japanese and Spanish Extensive multi-media technical resources to help you We investigate all quality concerns to ensure our products perform to the highest standards If the product does not perform as described on this datasheet, we will offer a refund or replacement. For full details of the Abpromise, please visit http://www.abcam.com/abpromise or contact our technical team. 2 Terms and conditions Guarantee only valid for products bought direct from Abcam or one of our authorized distributors 3