Anti-RAB3GAP2 antibody ab182270 Product datasheet 1 Image

advertisement
Product datasheet
Anti-RAB3GAP2 antibody ab182270
1 Image
Overview
Product name
Anti-RAB3GAP2 antibody
Description
Rabbit polyclonal to RAB3GAP2
Tested applications
WB
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Rabbit, Chicken, Guinea pig, Cow, Cat, Dog, Pig
Immunogen
Synthetic peptide within Human RAB3GAP2 aa 73-122 (internal sequence). The exact
sequence is proprietary.
Sequence:
SWLQDCVLSLSPTNDLMVIAREQKAVFLVPKWKYSDKGKEEMQFAVGWSG
Database link: Q9H2M9-2
Run BLAST with
Positive control
Run BLAST with
Human fetal liver lysate.
Properties
Form
Liquid
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long
term. Avoid freeze / thaw cycle.
Storage buffer
Constituents: 98% PBS, 2% Sucrose
Purity
Immunogen affinity purified
Clonality
Polyclonal
Isotype
IgG
Applications
Our Abpromise guarantee covers the use of ab182270 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application
Abreviews
Notes
1
Application
Abreviews
WB
Notes
Use a concentration of 1 µg/ml. Predicted molecular weight: 23 kDa.
2 isoforms of RAB3GAP2 exist. Isoform 1 at 150kDa and Isoform 2 is expected
at 23 kDa.
Target
Relevance
RAB3GAP2 is a regulatory subunit of a GTPase activating protein that has specificity for Rab3
subfamily (RAB3A, RAB3B, RAB3C and RAB3D). Rab3 proteins are involved in regulated
exocytosis of neurotransmitters and hormones. Rab3 GTPase-activating complex specifically
converts active Rab3-GTP to the inactive form Rab3-GDP. It is required for normal eye and brain
development and may participate in neurodevelopmental processes such as proliferation,
migration and differentiation before synapse formation, and non-synaptic vesicular release of
neurotransmitters.
Cellular localization
Cytoplasmic. Note: In neurons, it is enriched in the synaptic soluble fraction.
Anti-RAB3GAP2 antibody images
Anti-RAB3GAP2 antibody (ab182270) at 1
µg/ml + Human fetal liver lysate at 10 µg
Predicted band size : 23 kDa
The band detected on this Western Blot is
isoform 2 of RAB3GAP2 expected at 23 kDa.
We currently have no data about the detection
of isoform 1, which would be expected at 150
kDa.
Western blot - Anti-RAB3GAP2 antibody
(ab182270)
Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"
Our Abpromise to you: Quality guaranteed and expert technical support
Replacement or refund for products not performing as stated on the datasheet
Valid for 12 months from date of delivery
Response to your inquiry within 24 hours
We provide support in Chinese, English, French, German, Japanese and Spanish
Extensive multi-media technical resources to help you
We investigate all quality concerns to ensure our products perform to the highest standards
If the product does not perform as described on this datasheet, we will offer a refund or replacement. For full details of the Abpromise,
please visit http://www.abcam.com/abpromise or contact our technical team.
2
Terms and conditions
Guarantee only valid for products bought direct from Abcam or one of our authorized distributors
3
Download
Related flashcards

Neuroscience

42 cards

Neuroscience

66 cards

Neurophysiology

58 cards

Brain disorders

35 cards

Sleep disorders

45 cards

Create Flashcards