Product datasheet Anti-CLM-9 antibody ab190752 1 Image Overview Product name Anti-CLM-9 antibody Description Rabbit polyclonal to CLM-9 Tested applications WB Species reactivity Reacts with: Human Immunogen Synthetic peptide within Human CLM-9 aa 41-90 (internal sequence). The exact sequence is proprietary. Sequence: EELRDHRKYWCRKGGILFSRCSGTIYAEEEGQETMKGRVSIRDSRQELSL Database link: Q6UXG3 Run BLAST with Positive control Run BLAST with L929 cell extract. Properties Form Liquid Storage instructions Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Storage buffer pH: 7.40 Preservative: 0.02% Sodium azide Constituents: 49% PBS, 0.87% Sodium chloride, 50% Glycerol PBS without Mg2+ and Ca2+. Purity Immunogen affinity purified Purification notes ab190752 was affinity-purified from rabbit antiserum by affinity-chromatography using epitopespecific peptide. Clonality Polyclonal Isotype IgG Applications Our Abpromise guarantee covers the use of ab190752 in the following tested applications. The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user. 1 Application Abreviews WB Notes 1/500 - 1/1000. Predicted molecular weight: 36 kDa. Target Function Receptor which may mediate L-selectin-dependent lymphocyte rollings. Binds SELL in a calcium dependent manner. Binds lymphocyte. Tissue specificity Highly expressed in heart, skeletal muscle and placenta. Sequence similarities Belongs to the CD300 family. Contains 1 Ig-like V-type (immunoglobulin-like) domain. Domain Ig-like V-type domain mediates binding to lymphocyte. Post-translational modifications O-glycosylated with sialylated oligosaccharides. Cellular localization Apical cell membrane. Basolateral cell membrane. Endosome > multivesicular body membrane. Anti-CLM-9 antibody images Anti-CLM-9 antibody (ab190752) at 1/500 dilution + L929 cell extract at 30 µg Predicted band size : 36 kDa Western blot - Anti-CLM-9 antibody (ab190752) Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE" Our Abpromise to you: Quality guaranteed and expert technical support Replacement or refund for products not performing as stated on the datasheet Valid for 12 months from date of delivery Response to your inquiry within 24 hours We provide support in Chinese, English, French, German, Japanese and Spanish Extensive multi-media technical resources to help you We investigate all quality concerns to ensure our products perform to the highest standards If the product does not perform as described on this datasheet, we will offer a refund or replacement. For full details of the Abpromise, please visit http://www.abcam.com/abpromise or contact our technical team. Terms and conditions 2 Guarantee only valid for products bought direct from Abcam or one of our authorized distributors 3