Product datasheet Anti-NAPSIN A antibody [10C4B8] ab175426 5 Images Overview Product name Anti-NAPSIN A antibody [10C4B8] Description Mouse monoclonal [10C4B8] to NAPSIN A Tested applications IHC-P, WB Species reactivity Reacts with: Rat, Human Immunogen Recombinant fragment corresponding to Human NAPSIN A aa 20-158. Sequence: EPSGATLIRIPLHRVQPGRRILNLLRGWREPAELPKLGAPSPGDKPIFVP LSNYRDVQYFGEIGLGTPPQNFTVAFDTGSSNLWVPSRRCHFFSVPCWLH HRFDPKASSSFQANGTKFAI QYGTGRVDGILSEDKLTIG Database link: O96009 Run BLAST with Positive control Run BLAST with NAPSIN A recombinant protein; NAPSIN A transfected HEK293 cell lysate; Rat liver tissue lysate; Rectum cancer tissues; Liver cancer tissues. Properties Form Liquid Storage instructions Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Storage buffer Preservative: 0.05% Sodium azide Constituent: 99% PBS 0.5% protein stabilizer Purity Protein G purified Clonality Monoclonal Clone number 10C4B8 Isotype IgG1 Applications Our Abpromise guarantee covers the use of ab175426 in the following tested applications. 1 The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user. Application Abreviews Notes IHC-P 1/200 - 1/1000. WB 1/500 - 1/2000. Predicted molecular weight: 45 kDa. Target Function May be involved in processing of pneumocyte surfactant precursors. Tissue specificity Expressed predominantly in adult lung (type II pneumocytes) and kidney and in fetal lung. Low levels in adult spleen and very low levels in peripheral blood leukocytes. Sequence similarities Belongs to the peptidase A1 family. Cellular localization Secreted. Anti-NAPSIN A antibody [10C4B8] images All lanes : Anti-NAPSIN A antibody [10C4B8] (ab175426) at 1/500 dilution Lane 1 : HEK293 cell lysate Lane 2 : NAPSIN A (AA: 20-158)-hIgGFc transfected HEK293 cell lysate Predicted band size : 45 kDa Western blot - Anti-NAPSIN A [10C4B8] antibody (ab175426) Anti-NAPSIN A antibody [10C4B8] (ab175426) at 1/500 dilution + NAPSIN recombinant protein Predicted band size : 45 kDa Western blot - Anti-NAPSIN A [10C4B8] antibody (ab175426) 2 Anti-NAPSIN A antibody [10C4B8] (ab175426) at 1/500 dilution + Rat liver tissue lysate Predicted band size : 45 kDa Western blot - Anti-NAPSIN A [10C4B8] antibody (ab175426) Immunohistochemical analysis of paraffinembedded liver cancer tissues labeling NAPSIN A with ab175426 at 1/200 dilution with DAB staining. Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NAPSIN A [10C4B8] antibody (ab175426) Immunohistochemical analysis of paraffinembedded rectum cancer tissues labeling NAPSIN A with ab175426 at 1/200 dilution, with DAB staining. Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NAPSIN A [10C4B8] antibody (ab175426) Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE" Our Abpromise to you: Quality guaranteed and expert technical support Replacement or refund for products not performing as stated on the datasheet Valid for 12 months from date of delivery Response to your inquiry within 24 hours 3 We provide support in Chinese, English, French, German, Japanese and Spanish Extensive multi-media technical resources to help you We investigate all quality concerns to ensure our products perform to the highest standards If the product does not perform as described on this datasheet, we will offer a refund or replacement. For full details of the Abpromise, please visit http://www.abcam.com/abpromise or contact our technical team. Terms and conditions Guarantee only valid for products bought direct from Abcam or one of our authorized distributors 4