Product datasheet Anti-C12orf23 antibody ab122784 2 Images Overview Product name Anti-C12orf23 antibody Description Rabbit polyclonal to C12orf23 Tested applications IHC-P, ICC/IF Species reactivity Reacts with: Human Immunogen antigen sequence: QQEIPSYLNDEPPEGSMKDHPQQQPGMLSR, corresponding to N terminal amino acids 8-37 of Human C12orf23. Run BLAST with Positive control Run BLAST with Human pancreas tissue. Properties Form Liquid Storage instructions Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. Storage buffer pH: 7.20 Preservative: 0.02% Sodium azide Constituents: 59% PBS, 40% Glycerol Purity Immunogen affinity purified Clonality Polyclonal Isotype IgG Applications Our Abpromise guarantee covers the use of ab122784 in the following tested applications. The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user. Application IHC-P Abreviews Notes 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. ICC/IF Use a concentration of 1 - 4 µg/ml. Recommend PFA Fixation and Triton X-100 treatment 1 Target Sequence similarities Belongs to the UPF0444 family. Cellular localization Membrane. Anti-C12orf23 antibody images Immunofluorescent staining of Human cell line U-2 OS shows positivity in mitochondria. Recommended concentration of ab122784 14 µg/ml. Cells treated with PFA/Triton X-100. Immunocytochemistry/ Immunofluorescence Anti-C12orf23 antibody (ab122784) ab122784, at 1/50 dilution, staining C12orf23 in Paraffin Embedded Human pancreas tissue by Immunohistochemistry. Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-C12orf23 antibody (ab122784) Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE" Our Abpromise to you: Quality guaranteed and expert technical support Replacement or refund for products not performing as stated on the datasheet Valid for 12 months from date of delivery Response to your inquiry within 24 hours We provide support in Chinese, English, French, German, Japanese and Spanish Extensive multi-media technical resources to help you We investigate all quality concerns to ensure our products perform to the highest standards If the product does not perform as described on this datasheet, we will offer a refund or replacement. For full details of the Abpromise, please visit http://www.abcam.com/abpromise or contact our technical team. 2 Terms and conditions Guarantee only valid for products bought direct from Abcam or one of our authorized distributors 3