Product datasheet Anti-PUS10 antibody ab185078 2 Images Overview Product name Anti-PUS10 antibody Description Rabbit polyclonal to PUS10 Tested applications WB, IHC-P Species reactivity Reacts with: Human Predicted to work with: Mouse, Rat Immunogen Recombinant fragment corresponding to Human PUS10 aa 270-375 (internal sequence). Sequence: NSPKAVCAVLEIECAHGAVFVAGRYNKYSRNLPQTPWIIDGERKLESSVE ELISDHLLAVFKAESFNFSSSGREDVDVRTLGNGRPFAIELVNPHRVHFT SQEIKE Database link: Q3MIT2 Run BLAST with Positive control Run BLAST with Human cerebral cortex tissue; RT4 cell lysate Properties Form Liquid Storage instructions Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Storage buffer pH: 7.2 Preservative: 0.02% Sodium azide Constituents: 59% PBS, 40% Glycerol Purity Immunogen affinity purified Clonality Polyclonal Isotype IgG Applications Our Abpromise guarantee covers the use of ab185078 in the following tested applications. The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user. 1 Application Abreviews Notes WB 1/500 - 1/1000. Predicted molecular weight: 60 kDa. IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. Target Function Pseudouridylate synthases catalyze pseudouridination of structural RNAs, including transfer, ribosomal, and splicing RNAs. PUS10 catalyzes the formation of the universal psi55 in the GC loop of transfer RNAs (Probable). Modulator of TRAIL-induced cell death via activation of procaspase 8 and BID cleavage. Required for the progression of the apoptotic signal through intrinsic mitochondrial cell death. Sequence similarities Belongs to the pseudouridine synthase Pus10 family. Post-translational modifications Proteolytically cleaved during TRAIL-induced cell death. Cleaved, in vitro, either by caspase-3 or caspase-8. Phosphorylated upon DNA damage, probably by ATM or ATR. Anti-PUS10 antibody images Anti-PUS10 antibody (ab185078) at 1/500 dilution + RT4 cell lysate Predicted band size : 60 kDa Western blot - Anti-PUS10 antibody (ab185078) Immunohistochemical analysis of Human cerebral cortex tissue labeling PUS10 using ab185078 at 1/50 dilution. Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PUS10 antibody (ab185078) 2 Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE" Our Abpromise to you: Quality guaranteed and expert technical support Replacement or refund for products not performing as stated on the datasheet Valid for 12 months from date of delivery Response to your inquiry within 24 hours We provide support in Chinese, English, French, German, Japanese and Spanish Extensive multi-media technical resources to help you We investigate all quality concerns to ensure our products perform to the highest standards If the product does not perform as described on this datasheet, we will offer a refund or replacement. For full details of the Abpromise, please visit http://www.abcam.com/abpromise or contact our technical team. Terms and conditions Guarantee only valid for products bought direct from Abcam or one of our authorized distributors 3