Product datasheet Anti-ADFP antibody [2C5H8] ab181452 7 Images Overview Product name Anti-ADFP antibody [2C5H8] Description Mouse monoclonal [2C5H8] to ADFP Tested applications IHC-P, WB, ICC/IF, Flow Cyt Species reactivity Reacts with: Human Predicted to work with: Cow, Pig Immunogen Recombinant fragment corresponding to Human ADFP aa 268-437. Expressed in E. coli. Sequence: VEWKRSIGYDDTDESHCAEHIESRTLAIARNLTQQLQTTCHTLLSNIQGV PQNIQDQAKHMGVMAGDIYSVFRNAASFKEVSDSLLTSSKGQLQKMKESL DDVMDYLVNNTPLNWLVGPFYPQLT ESQNAQDQGA EMDKSSQETQ RSEHKTH Database link: Q99541 Run BLAST with Positive control Run BLAST with ADFP recombinant protein; ADFP transfected HEK293 cell lysate; HepG2 cells and cell lysate; Human rectum cancer tissue; Human bladder cancer tissue. Properties Form Liquid Storage instructions Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Storage buffer Preservative: 0.05% Sodium azide Constituent: 99% PBS 0.5% stabilization buffer (amino acid =85% pH(1% water solution) =7.0~7.5, Water =2% As(mg/kg) =0.5 Pb(mg/kg) =0.1) Purity Protein G purified Clonality Monoclonal Clone number 2C5H8 Isotype IgG1 Applications 1 Our Abpromise guarantee covers the use of ab181452 in the following tested applications. The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user. Application Abreviews Notes IHC-P 1/200 - 1/1000. WB 1/500 - 1/2000. ICC/IF 1/200 - 1/1000. Flow Cyt 1/200 - 1/400. ab170190-Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody. Target Function May be involved in development and maintenance of adipose tissue. Tissue specificity Milk lipid globules. Sequence similarities Belongs to the perilipin family. Post-translational modifications Acylated; primarily with C14, C16 and C18 fatty acids. Cellular localization Membrane. Anti-ADFP antibody [2C5H8] images Anti-ADFP antibody [2C5H8] (ab181452) at 1/500 dilution + HepG2 cell lysate Western blot - Anti-ADFP [2C5H8] antibody (ab181452) 2 All lanes : Anti-ADFP antibody [2C5H8] (ab181452) at 1/500 dilution Lane 1 : HEK293 cell lysate Lane 2 : ADFP-transfected HEK293 cell lysate Western blot - Anti-ADFP [2C5H8] antibody (ab181452) Anti-ADFP antibody [2C5H8] (ab181452) at 1/500 dilution + ADFP recombinant protein Western blot - Anti-ADFP [2C5H8] antibody (ab181452) Immunohistochemical analysis of paraffinembedded Human bladder cancer tissue labeling ADFP with ab181452 at 1/200 dilution. Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ADFP [2C5H8] antibody (ab181452) 3 Immunohistochemical analysis of paraffinembedded Human rectum cancer tissue labeling ADFP with ab181452 at 1/200 dilution. Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ADFP [2C5H8] antibody (ab181452) Immunofluorescent analysis of HepG2 cells labeling ADFP with ab181452 (green) at 1/200 dilution. Blue: DRAQ5 fluorescent DNA dye. Immunocytochemistry/ Immunofluorescence Anti-ADFP [2C5H8] antibody (ab181452) Flow cytometric analysis of HepG2 cells labeling ADFP with ab181452 (green) at 1/200 dilution, and negative control (red). Flow Cytometry - Anti-ADFP [2C5H8] antibody (ab181452) Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE" Our Abpromise to you: Quality guaranteed and expert technical support Replacement or refund for products not performing as stated on the datasheet Valid for 12 months from date of delivery Response to your inquiry within 24 hours 4 We provide support in Chinese, English, French, German, Japanese and Spanish Extensive multi-media technical resources to help you We investigate all quality concerns to ensure our products perform to the highest standards If the product does not perform as described on this datasheet, we will offer a refund or replacement. For full details of the Abpromise, please visit http://www.abcam.com/abpromise or contact our technical team. Terms and conditions Guarantee only valid for products bought direct from Abcam or one of our authorized distributors 5