Regular Languages and Regular Grammars Chapter 3 Regular Languages Describes Regular Expression Regular Language Accepts Finite State Machine Operators on Regular Expressions In order of precedence: () Parentheses Example: * Star Closure Over = {a, b, c}, (a + (b . c))* produces: . Concatenation {λ, a, bc, aa, abc, bcbc, … } + Union Note: The concatenation symbol is often omitted. Regular Expressions Let be a given alphabet. Then 1. , λ, and a are all primitive regular expressions. 2. If r1 and r2 are regular expressions, so are r1 + r2, r1 . r2, r1*, and (r1) 3. A string is a regular expression, iff it can be derived from the primitive regular expressions by a finite number of application of the rules in (2). Languages Associated with Regular Expressions If r is a regular expression L(r) is a language associated with r. Rules to simplify languages associated with r: L() = L(λ) = λ L(r1 + r2) = L(r1) U L(r2) L(r1 . r2) = L(r1) . L(r2) L((r1)) = L(r1) L(r1*) = (L(r1))* L(a) = {a} Analyzing a Regular Expression L((a + b)*b) = L((a + b)*) L(b) = (L(a + b))* L(b) = (L(a) U L(b))* L(b) = ({a} U {b})* {b} = {a, b}* {b}. A string of a’s and b’s that end with b Analyzing a Regular Expression L(a*b*) = L(a*)L(b*) = {a}*{b}* A string of zero or more a’s followed by a string of zero or more b’s. Given a Language, find a rex L = {w {a, b}* : w = |w| is even} ((a + b)(a + b))* or (aa + ab + ba + bb)* Examples L = {w {a, b}* : w contains an odd number of a’s} b*(ab*ab*)*ab* or b*ab*(ab*ab*)* Both expressions require that there be a single a somewhere. There can also be other a’s, but they must occur in pairs. More Regular Expression Examples Try these: L = {w {a, b}*: there is no more than one b in w} L(r) = {a2nb2m+1 : n 0, m 0} More Regular Expression Examples Try these: L = {w {a, b}*: there is no more than one b in w} a*(λ+b)a* or a* + a*ba* L(r) = {a2n b2m+1 : n 0, m 0} (aa)*(bb)*b The Details Matter a* + b* (a + b)* (ab)* a*b* Rex to NFA Finite state machines and regular expressions define the same class of languages. Theorem: Any language that can be defined with a regular expression can be accepted by some NFA and so is regular. Proof by Construction: Must show that an NFA can be constructed using rules for: , λ, any symbol in , union, and concatenation. For Every Regular Expression There is a Corresponding FSM We’ll show this by construction. An FSM for: : For Every Regular Expression There is a Corresponding FSM We’ll show this by construction. An FSM for: : For Every Regular Expression There is a Corresponding FSM We’ll show this by construction. An FSM for: : A single element of : For Every Regular Expression There is a Corresponding FSM We’ll show this by construction. An FSM for: : A single element of : For Every Regular Expression There is a Corresponding FSM We’ll show this by construction. An FSM for: : A single element of : λ: For Every Regular Expression There is a Corresponding FSM We’ll show this by construction. An FSM for: : A single element of : λ: Union M1 (recognizes string s) ;;; … λ λ λ … M2 (recognizes string t) FSA that recognizes s + t λ Concatenation M1 (recognizes string s) λ ;;; … M2 (recognizes string t) λ … FSA that recognizes st λ Star Closure λ M1 (recognizes string s) λ ;;; λ … λ λ FSA that recognizes s* An Example (b + ab)* An FSM for a An FSM for b An FSM for ab: λ An Example (b + ab)* An FSM for (b + ab): λ λ λ An Example An FSM for (b + ab)*: λ λ λ λ λ λ λ λ An Example A Simplified FSM for (b + ab)*: λ b a b λ For Every FSM There is a Corresponding Regular Expression Theorem: Every regular language (i.e., every language that can be accepted by some DFSM) can be defined with a regular expression. Proof by Construction: Use generalized transition graphs (GTGs) to convert FSM to REX. A GTG is a transition graph whose edges are labeled with regular expressions. A Simple Example Let M be: Suppose we rip out state 2: The Algorithm fsmtoregexheuristic fsmtoregexheuristic(M: FSM) = 1. Remove unreachable states from M. 2. If M has no accepting states then return . 3. If the start state of M is part of a loop, create a new start state s and connect s to M’s start state via an λ-transition. 4. If there is more than one accepting state of M or there are any transitions out of any of them, create a new accepting state and connect each of M’s accepting states to it via an λ-transition. The old accepting states no longer accept. 5. If M has only one state then return λ. 6. Until only the start state and the accepting state remain do: 6.1 Select rip (not s or an accepting state). 6.2 Remove rip from M. 6.3 *Modify the transitions among the remaining states so M accepts the same strings. 7. Return the regular expression that labels the one remaining transition from the start state to the accepting state. Example 1 1. Create a new initial state and a new, unique accepting state, neither of which is part of a loop. Note: λ Example 1, Continued 2. Remove states and arcs and replace with arcs labeled with larger and larger regular expressions. Example 1, Continued Remove state 3: Example 1, Continued + Remove state 2: Example 1, Continued + Remove state 1: + + Example 2 a*(a + b)c* Example 3 a* + a*(a + b)c* Simplifying Regular Expressions Regex’s describe sets: ● Union is commutative: + = + . ● Union is associative: ( + ) + = + ( + ). ● is the identity for union: + = + = . ● Union is idempotent: + = . Concatenation: ● Concatenation is associative: () = (). ● λ is the identity for concatenation: λ = λ = . ● is a zero for concatenation: = = . Concatenation distributes over union: ● ( + ) = ( ) + ( ). ● ( + ) = ( ) + ( ). Kleene star: ● * = λ. ● λ* = λ. ●(*)* = *. ● ** = *. ●( + )* = (**)*. Applications of regular expressions: Pattern Matching Many applications allow pattern matches unix perl Excel Access … Pattern matching programs use automata pattern rex nfa dfa transition table driver A Biology Example – BLAST Given a protein or DNA sequence, find others that are likely to be evolutionarily close to it. ESGHDTTTYYNKNRYPAGWNNHHDQMFFWV Build a DFSM that can examine thousands of other sequences and find those that match any of the selected patterns. Regular Expressions in Perl Syntax Name Description abc Concatenation Matches a, then b, then c, where a, b, and c are any regexs a|b|c Union (Or) Matches a or b or c, where a, b, and c are any regexs a* Kleene star Matches 0 or more a’s, where a is any regex a+ At least one Matches 1 or more a’s, where a is any regex a? Matches 0 or 1 a’s, where a is any regex a{n, m} Replication Matches at least n but no more than m a’s, where a is any regex a*? Parsimonious Turns off greedy matching so the shortest match is selected a+? . Wild card Matches any character except newline ^ Left anchor Anchors the match to the beginning of a line or string $ Right anchor Anchors the match to the end of a line or string [a-z] Assuming a collating sequence, matches any single character in range [^a-z] Assuming a collating sequence, matches any single character not in range \d Digit Matches any single digit, i.e., string in [0-9] \D Nondigit Matches any single nondigit character, i.e., [^0-9] \w Alphanumeric Matches any single “word” character, i.e., [a-zA-Z0-9] \W Nonalphanumeric Matches any character in [^a-zA-Z0-9] \s White space Matches any character in [space, tab, newline, etc.] Regular Expressions in Perl Syntax Name Description \S Nonwhite space Matches any character not matched by \s \n Newline Matches newline \r Return Matches return \t Tab Matches tab \f Formfeed Matches formfeed \b Backspace Matches backspace inside [] \b Word boundary Matches a word boundary outside [] \B Nonword boundary Matches a non-word boundary \0 Null Matches a null character \nnn Octal Matches an ASCII character with octal value nnn \xnn Hexadecimal Matches an ASCII character with hexadecimal value nn \cX Control Matches an ASCII control character \char Quote Matches char; used to quote symbols such as . and \ (a) Store Matches a, where a is any regex, and stores the matched string in the next variable \1 Variable Matches whatever the first parenthesized expression matched \2 Matches whatever the second parenthesized expression matched … For all remaining variables Using Regular Expressions in the Real World Matching numbers: -? ([0-9]+(\.[0-9]*)? | \.[0-9]+) Matching ip addresses: S !<emphasis> ([0-9]{1,3} (\ . [0-9] {1,3}){3}) </emphasis> !<inet> $1 </inet>! Finding doubled words: \< ([A-Za-z]+) \s+ \1 \> From Friedl, J., Mastering Regular Expressions, O’Reilly,1997. More Regular Expressions Identifying spam: \badv\(?ert\)?\b Trawl for email addresses: \b[A-Za-z0-9_%-]+@[A-Za-z0-9_%-]+ (\.[A-Zaz]+){1,4}\b Using Substitution Building a chatbot: On input: <phrase1> is <phrase2> the chatbot will reply: Why is <phrase1> <phrase2>? Chatbot Example <user> The food there is awful <chatbot> Why is the food there awful? Assume that the input text is stored in the variable $text: $text =~ s/^([A-Za-z]+)\sis\s([A-Za-z]+)\.?$/ Why is \1 \2?/ ; Regular Grammars A regular grammar G is a quadruple (V, T, S, P) that is either consistently right-linear or consistently left-linear. ● V - Variables ● T – Terminals ● S - Start variable, S V ● P - Productions Right-Linear Grammar All production rules are of the form: A xB or Ax A,B V x T* A and B are variables x is a string in the alphabet Example: G = ({S}, {a, b}, S, P) P: S abS | a Corresponding Regular Expression: (ab)*a Left-Linear Grammar All production rules are of the form: A Bx or Ax A,B V x T* A and B are variables x is a string in the alphabet Example: G = ({S, S1, S2}, {a, b}, S, P) P: S S1ab S1 S1ab | S2 S2 a Corresponding Regular Expression: aab(ab)* Focus on Right-Linear Grammars A language generated by a right-linear grammar is always regular. Proof by construction of FA on page 91 of text. Example: Construct an FA that accepts the language generated by the grammar: V0 aV1 V1 abV0 | b Focus on Right-Linear Grammars V0 aV1 V1 b V1 abV0 Complete FA: Right-Linear Grammars Every regular language can be generated by some right-linear grammar. Proof by reverse construction of an FA, page 93 of text. Example: Find a right-linear grammar that generates the language accepted by the FA shown below. G = {{Q0, Q1, Q2}, {0, 1}, Q0, P} P: Q0 1Q1 | Q2 | λ Q1 0Q0 | 0Q2 Q2 1Q2 Each state in the FA is represented by a variable in the grammar. Each transition symbol in the FA is a terminal in the grammar. Each transition in the FA is represented by a rule in the grammar. If a state, qk is a final state, include the production qk λ