Product datasheet
Anti-MARCH5 antibody - N-terminal ab185054
1 Image
Overview
Product name
Anti-MARCH5 antibody - N-terminal
Description
Rabbit polyclonal to MARCH5 - N-terminal
Tested applications
WB
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog,
Xenopus laevis, Zebrafish, African Green Monkey, Xenopus tropicalis
Immunogen
Synthetic peptide within Human MARCH5 aa 35-84 (N terminal). The exact sequence is
proprietary. NCBI Accession No. NP_060294
Sequence:
CRGSTKWVHQACLQRWVDEKQRGNSTARVACPQCNAEYLIVFPKLGPVVY
Database link: Q9NX47
Run BLAST with
Positive control
Run BLAST with
U937 cell lysate.
Properties
Form
Liquid
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long
term. Avoid freeze / thaw cycle.
Storage buffer
Constituents: 2% Sucrose, 98% PBS
Purity
Immunogen affinity purified
Clonality
Polyclonal
Isotype
IgG
Applications
Our Abpromise guarantee covers the use of ab185054 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application
WB
Abreviews
Notes
Use a concentration of 1 µg/ml. Predicted molecular weight: 31 kDa.
1
Target
Function
Mitochondrial E3 ubiquitin-protein ligase that plays a crucial role in the control of mitochondrial
morphology by acting as a positive regulator of mitochondrial fission. May play a role in the
prevention of cell senescence acting as a regulator of mitochondrial quality control. Promotes
ubiquitination of FIS1, DNM1L and MFN1.
Tissue specificity
Expressed in brain, heart, liver, lung, spleen, stomach, testis, skeletal and muscle.
Pathway
Protein modification; protein ubiquitination.
Sequence similarities
Contains 1 RING-CH-type zinc finger.
Domain
The RING-CH-type zinc finger domain is required for E3 ligase activity.
Post-translational
modifications
Autoubiquitinated leading to degradation (short half-life).
Cellular localization
Mitochondrion outer membrane. Endoplasmic reticulum membrane. Authors show that the
protein can be detected in endoplasmic reticulum (PubMed:14722266). Authors
(PubMed:16874301) show its presence only in mitochondria.
Anti-MARCH5 antibody - N-terminal images
Anti-MARCH5 antibody - N-terminal
(ab185054) at 1 µg/ml + U937 whole cell
lysate
Predicted band size : 31 kDa
Western blot - Anti-MARCH5 antibody - Nterminal (ab185054)
Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"
Our Abpromise to you: Quality guaranteed and expert technical support
Replacement or refund for products not performing as stated on the datasheet
Valid for 12 months from date of delivery
Response to your inquiry within 24 hours
We provide support in Chinese, English, French, German, Japanese and Spanish
Extensive multi-media technical resources to help you
We investigate all quality concerns to ensure our products perform to the highest standards
If the product does not perform as described on this datasheet, we will offer a refund or replacement. For full details of the Abpromise,
please visit http://www.abcam.com/abpromise or contact our technical team.
Terms and conditions
Guarantee only valid for products bought direct from Abcam or one of our authorized distributors
2
3
Download

Anti-MARCH5 antibody - N-terminal ab185054 Product datasheet 1 Image